F348588

General Info

Members Datasets Scaffolds Average Seq Length
235 195 470 558

Family's Representative Sequence

Representative Sequence 3300053107|Ga0500560_001373|Ga0500560_001373_310_2328
Length 672
Sequence MKILILGGYGVFGGRLAELLADISGIEILICGRSLERAEAFCTSYCGLARVRPLMLDRRDIAEALCIHKPDLVVDASGPFQNYGSACYGVITACIDAGIDYLDFADAADFVFGVSQFDERTKAAGVFVLSGVSSFPVLTAAVLREMTRTMDVVAVEGGIAPSPYAGIGLNVMRAVVGYAGAPVKLWRHGKPAHGVSLAESMRFTIAVPGRLPLRNIHFSLVDVPDLQVIPPEHPSMTDIWMGAGPVPEFLHRMLNLLAKARSRLGLPSLAPLSPLFYAVLNRMRFGEHRGGMFVRARGHAADKPVEMSWHLLAEGDDGPYIPSMAIEALIRKMLNGERPQPGARSGIHALELSDYERLFRGKTIFTGFRQEEPDAPLFRKLLGPAFYELPSRVRELHDSGQAREWYGVAKVRRGRGVLARLISAVLGFPQAGTHVPVSVAFAPHKGAERWTRTFGGRRFSSTQSAGRGKDQYLLAERFGIVTVALALVLDGGRLALIPRRWNVLGIPLPCFLLPSGVSFESEEKGQFRFDVEISLPFVGLVVAYRGTLEPAAGSPEHGGPSEAPCGASLGEEARGRGRLSSWGTCREFAAVAAYSSRSRSSERVGYAHHRKRLNILFRQGAFLGIAQQEADAAGAGDRPVLGHKVSDRGAGVDALEACLCVVFAQARAGGLG

Samples

Sample ID Description Type Environment
1 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
85 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
105 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
116 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
117 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
140 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
141 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
146 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
147 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
151 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
152 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
153 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
154 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
155 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
156 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
157 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
158 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
159 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
160 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
161 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
162 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
163 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
164 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
165 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
166 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
167 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
168 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
169 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
170 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
171 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
172 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
173 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
174 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
175 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
176 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
177 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
178 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
179 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
180 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
181 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
182 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
183 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
184 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
185 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
186 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
187 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
188 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
189 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
190 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
191 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
192 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
193 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
194 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
195 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.85
Metatranscriptomes 0
Isolates 19.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.3
Nodule 10.21
Rhizoplane 1.28
Rhizosphere 52.34
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500560_001373 3300053107 Bacteria 4191
2 JGI25151J46595_10000332 3300003187 Bacteria 50552
3 JGI25165J46597_1000052 3300003214 Bacteria 236064
4 rootH1_10032678 3300003316 Bacteria 6426
5 rootH1_10012072 3300003323 Bacteria 4899
6 Ga0055536_1001049 3300003781 Bacteria 17457
7 Ga0055530_10000012 3300003791 Bacteria 164829
8 Ga0055531_10006075 3300003794 Bacteria 6917
9 Ga0055531_10014807 3300003794 Bacteria 3488
10 Ga0058692_1002024 3300003856 Bacteria 7033
11 Ga0065707_10082133 3300005295 Bacteria 21190
12 Ga0070661_100009122 3300005344 Bacteria 6856
13 Ga0070668_100028972 3300005347 Bacteria 4204
14 Ga0070668_100104810 3300005347 Bacteria 2245
15 Ga0070669_100085491 3300005353 Bacteria 2355
16 Ga0070671_100001119 3300005355 Bacteria 19892
17 Ga0070671_100046037 3300005355 Bacteria 3627
18 Ga0070674_100092603 3300005356 Bacteria 2185
19 Ga0070713_100093986 3300005436 Unclassified 2584
20 Ga0070679_100043394 3300005530 Bacteria 4479
21 Ga0070665_100125217 3300005548 Bacteria 2572
22 Ga0068859_100005814 3300005617 Bacteria 12528
23 Ga0068861_100006560 3300005719 Bacteria 7939
24 Ga0068863_100078280 3300005841 Bacteria 3131
25 Ga0068858_100000736 3300005842 Bacteria 34314
26 Ga0068858_100002567 3300005842 Bacteria 18303
27 Ga0068860_100169195 3300005843 Bacteria 2110
28 Ga0068862_100000036 3300005844 Bacteria 173453
29 Ga0075365_10009477 3300006038 Bacteria 5600
30 Ga0075368_10000701 3300006042 Bacteria 10206
31 Ga0075368_10013146 3300006042 Unclassified 3037
32 Ga0075363_100031621 3300006048 Bacteria 2745
33 Ga0075369_10000952 3300006186 Bacteria 9639
34 Ga0075366_10082148 3300006195 Bacteria 1925
35 Ga0097620_100005814 3300006931 Bacteria 12528
36 Ga0111539_10270481 3300009094 Bacteria 1978
37 Ga0105245_10000505 3300009098 Bacteria 35782
38 Ga0105248_10000407 3300009177 Bacteria 49981
39 Ga0105238_10086521 3300009551 Bacteria 3122
40 Ga0105238_10091513 3300009551 Archaea 3029
41 Ga0105249_10003540 3300009553 Bacteria 13504
42 Ga0105239_10083047 3300010375 Archaea 3527
43 Ga0157373_10014368 3300013100 Bacteria 5803
44 Ga0157373_10024727 3300013100 Bacteria 4349
45 Ga0157371_10036988 3300013102 Bacteria 3496
46 Ga0157371_10047434 3300013102 Bacteria 3054
47 Ga0157374_10028530 3300013296 Bacteria 5043
48 Ga0163163_10014155 3300014325 Bacteria 7327
49 Ga0157380_10001637 3300014326 Bacteria 14757
50 Ga0182008_10000045 3300014497 Bacteria 114620
51 Ga0163161_10000692 3300017792 Bacteria 26954
52 Ga0163161_10010740 3300017792 Bacteria 6343
53 Ga0213876_10032900 3300021384 Bacteria 2734
54 Ga0209026_1003360 3300025250 Bacteria 5308
55 Ga0209233_1000118 3300025261 Bacteria 236172
56 Ga0209130_1004234 3300025284 Bacteria 5576
57 Ga0209675_1000272 3300025291 Bacteria 49613
58 Ga0209676_1000226 3300025292 Bacteria 124004
59 Ga0209676_1000359 3300025292 Bacteria 86410
60 Ga0209025_1000265 3300025294 Bacteria 123182
61 Ga0209758_1002263 3300025297 Bacteria 19964
62 Ga0209758_1007632 3300025297 Bacteria 7295
63 Ga0209050_1000067 3300025298 Bacteria 304206
64 Ga0207426_1000287 3300025302 Bacteria 100566
65 Ga0209257_1000699 3300025304 Bacteria 51960
66 Ga0209257_1001814 3300025304 Bacteria 23373
67 Ga0209257_1005535 3300025304 Bacteria 8803
68 Ga0207680_10025092 3300025903 Bacteria 3284
69 Ga0207695_10001322 3300025913 Bacteria 42020
70 Ga0207671_10015237 3300025914 Bacteria 6035
71 Ga0207649_10010411 3300025920 Bacteria 5110
72 Ga0207681_10012691 3300025923 Bacteria 5203
73 Ga0207644_10000070 3300025931 Bacteria 74994
74 Ga0207644_10003261 3300025931 Bacteria 10477
75 Ga0207669_10067843 3300025937 Bacteria 2224
76 Ga0207711_10000607 3300025941 Bacteria 36172
77 Ga0207703_10000654 3300026035 Bacteria 34723
78 Ga0207675_100028002 3300026118 Bacteria 5247
79 Ga0209371_1001001 3300027312 Bacteria 21687
80 Ga0268266_10070010 3300028379 Bacteria 3041
81 Ga0268266_10130463 3300028379 Bacteria 2247
82 Ga0268265_10000052 3300028380 Bacteria 174254
83 Ga0268264_10145303 3300028381 Bacteria 2120
84 Ga0316176_1195196 3300030732 Bacteria 3089
85 Ga0307408_100079387 3300031548 Bacteria 2448
86 Ga0307516_10001010 3300031730 Bacteria 38997
87 Ga0307405_10000488 3300031731 Bacteria 14929
88 Ga0307405_10018401 3300031731 Bacteria 3853
89 Ga0307406_10072751 3300031901 Bacteria 2257
90 Ga0307407_10019952 3300031903 Bacteria 3422
91 Ga0307412_10001664 3300031911 Bacteria 12275
92 Ga0307414_10013131 3300032004 Bacteria 4923
93 Ga0307510_10000010 3300033180 Bacteria 377457
94 Ga0307510_10091041 3300033180 Bacteria 2894
95 Ga0395899_0057740 3300037312 Bacteria 2864
96 Ga0395900_0046055 3300037418 Bacteria 4491
97 Ga0395905_0103593 3300037471 Unclassified 2671
98 Ga0395901_0087518 3300038443 Bacteria 3257
99 Ga0395901_0149384 3300038443 Bacteria 2455
100 Ga0237819_01845 3300038705 Bacteria 4889
101 Ga0436365_0935598 3300039437 Bacteria 3444
102 Ga0439462_0000026 3300042015 Bacteria 22489
103 Ga0450911_001809 3300042115 Bacteria 4587
104 Ga0495629_0017756 3300046459 Bacteria 5099
105 Ga0495638_0003940 3300046460 Bacteria 11446
106 Ga0495638_0063346 3300046460 Bacteria 2280
107 Ga0495650_0002046 3300046471 Bacteria 17594
108 Ga0495662_0035576 3300046476 Bacteria 2403
109 Ga0495607_0003829 3300046501 Bacteria 11349
110 Ga0495607_0041974 3300046501 Bacteria 2714
111 Ga0495583_0000027 3300046506 Bacteria 256299
112 Ga0495606_0000469 3300046507 Bacteria 66319
113 Ga0495606_0002219 3300046507 Bacteria 23170
114 Ga0495610_0002939 3300046512 Bacteria 13764
115 Ga0495631_0001021 3300046518 Bacteria 17380
116 Ga0495663_0001297 3300046525 Bacteria 7933
117 Ga0495663_0010541 3300046525 Bacteria 2572
118 Ga0495597_0005232 3300046542 Bacteria 6901
119 Ga0495622_0010340 3300046557 Bacteria 4315
120 Ga0495633_0005346 3300046558 Bacteria 7874
121 Ga0495633_0020931 3300046558 Bacteria 3279
122 Ga0495668_0000002 3300046616 Bacteria 763179
123 Ga0495668_0018575 3300046616 Bacteria 4018
124 Ga0495625_0017073 3300046660 Bacteria 5689
125 Ga0495657_0011299 3300046675 Bacteria 6682
126 Ga0495660_0000357 3300046810 Bacteria 40440
127 Ga0495672_0059348 3300047320 Bacteria 2214
128 Ga0495673_0000001 3300047469 Bacteria 1630730
129 Ga0495681_0017600 3300047470 Bacteria 3960
130 Ga0495686_0000053 3300047472 Bacteria 259537
131 Ga0495686_0007132 3300047472 Bacteria 8416
132 Ga0496106_0001445 3300048909 Bacteria 17815
133 Ga0496113_0007018 3300048916 Bacteria 7204
134 Ga0496113_0083117 3300048916 Bacteria 2456
135 Ga0496116_0006018 3300048919 Bacteria 11109
136 Ga0496116_0034191 3300048919 Bacteria 3591
137 Ga0496116_0036609 3300048919 Bacteria 3431
138 Ga0496117_0003123 3300048920 Bacteria 19780
139 Ga0496117_0012677 3300048920 Bacteria 7406
140 Ga0496118_0007415 3300048921 Bacteria 11636
141 Ga0496119_0059250 3300048922 Bacteria 2301
142 Ga0496121_0013549 3300048924 Bacteria 8744
143 Ga0496121_0015836 3300048924 Bacteria 7844
144 Ga0496121_0025525 3300048924 Bacteria 5602
145 Ga0496122_0041505 3300048925 Bacteria 3636
146 Ga0496122_0048431 3300048925 Bacteria 3267
147 Ga0496123_0033462 3300048926 Bacteria 3698
148 Ga0496123_0036076 3300048926 Bacteria 3512
149 Ga0496124_0008883 3300048927 Bacteria 10427
150 Ga0496124_0041591 3300048927 Bacteria 3964
151 Ga0496124_0056810 3300048927 Bacteria 3299
152 Ga0496125_0006956 3300048928 Bacteria 12114
153 Ga0496126_0042122 3300048929 Bacteria 4219
154 Ga0501032_0034673 3300049569 Bacteria 3453
155 Ga0501033_0021984 3300049570 Bacteria 4811
156 Ga0501034_0005785 3300049571 Bacteria 13447
157 Ga0501034_0053793 3300049571 Bacteria 4053
158 Ga0501036_0017549 3300049572 Bacteria 5985
159 Ga0501037_0023118 3300049573 Bacteria 4598
160 Ga0501039_0059273 3300049575 Bacteria 2965
161 Ga0501043_0086226 3300049579 Bacteria 2467
162 Ga0501076_0065344 3300049592 Bacteria 2901
163 Ga0501249_011712 3300049679 Bacteria 1844
164 Ga0501080_0001818 3300049742 Bacteria 18284
165 Ga0501083_0013298 3300049744 Bacteria 5754
166 Ga0501268_003005 3300049765 Bacteria 2275
167 Ga0501035_0005680 3300049822 Bacteria 11776
168 Ga0501044_0011342 3300049823 Bacteria 9656
169 nmdc:mga00v17_8389_c1 3300050491 Bacteria 5559
170 nmdc:mga0yw44_10905_c1 3300050492 Bacteria 4659
171 nmdc:mga0qj67_159262_c1 3300050509 Bacteria 1832
172 Ga0500641_0017133 3300053096 Bacteria 2705
173 Ga0500555_000845 3300053103 Bacteria 10962
174 Ga0500556_0000276 3300053104 Bacteria 40145
175 Ga0500593_000010 3300053117 Bacteria 66219
176 Ga0500593_007353 3300053117 Bacteria 4476
177 Ga0500595_000010 3300053119 Bacteria 275806
178 Ga0500655_000338 3300053133 Bacteria 10331
179 Ga0500568_0000001 3300053139 Bacteria 988705
180 Ga0500568_0000887 3300053139 Bacteria 20873
181 Ga0500568_0033754 3300053139 Bacteria 2098
182 Ga0500590_002928 3300053148 Bacteria 7746
183 Ga0500622_0004880 3300053156 Bacteria 8210
184 Ga0500624_001369 3300053157 Bacteria 4083
185 Ga0500636_0032325 3300053177 Bacteria 3096
186 Ga0500637_0002165 3300053178 Bacteria 8641
187 Ga0501084_0256525 3300054114 Bacteria 1476
188 Ga0501082_0039593 3300060353 Bacteria 4066
189 Ga0501082_0042220 3300060353 Bacteria 3932
190 Ga0530510_0016680 3300061734 Bacteria 5202
191 2513613882 2513237090 Bacteria 7096802
192 2578457555 2576861471 Bacteria 4648976
193 2643820764 2643221560 Bacteria 4801179
194 2694627747 2693429783 Bacteria 7019804
195 2694636861 2693429784 Bacteria 7241525
196 2765579926 2765235840 Bacteria 4663337
197 2821445703 2821443989 Bacteria 7658172
198 2841860057 2841859092 Bacteria 5436171
199 2842516842 2842515876 Bacteria 5436280
200 2842760557 2842757796 Bacteria 3981385
201 2844533797 2844533157 Bacteria 7517899
202 2856367427 2856364286 Bacteria 6939991
203 2857444752 2857442823 Bacteria 4562550
204 2869288568 2869285874 Bacteria 6901219
205 2871431235 2871429161 Bacteria 6547891
206 2874150610 2874146452 Bacteria 7533118
207 2874158350 2874155637 Bacteria 6724144
208 2874222612 2874220319 Bacteria 4594709
209 2876385827 2876377896 Bacteria 6565995
210 2876416658 2876413966 Bacteria 6831344
211 2878747839 2878745973 Bacteria 6867388
212 2899792125 2899792073 Bacteria 4926588
213 2903502320 2903492973 Bacteria 13473544
214 2906311012 2906308376 Bacteria 6841989
215 2906323123 2906321335 Bacteria 6579571
216 2919090554 2919089067 Bacteria 4560942
217 2928498388 2928496128 Bacteria 4631123
218 2931383929 2931380184 Bacteria 4455911
219 2933012516 2933011516 Bacteria 5439334
220 2937614508 2937610967 Bacteria 4618818
221 2937815471 2937813078 Bacteria 7783518
222 2938017514 2938014810 Bacteria 6700592
223 2939624648 2939622612 Bacteria 4698046
224 2939628268 2939626828 Bacteria 4695272
225 2958053781 2958041894 Bacteria 13082850
226 2958132970 2958130278 Bacteria 6897202
227 2958182672 2958179912 Bacteria 6874908
228 2961049377 2961047084 Bacteria 4594415
229 2961080520 2961077736 Bacteria 7079850
230 2968122535 2968117919 Bacteria 6536078
231 2977846764 2977843712 Bacteria 6753583
232 8004390537 8004387939 Bacteria 7049250
233 8004645340 8004640170 Bacteria 6723001
234 8004717229 8004714634 Bacteria 6776161
235 8054461716 8054460903 Bacteria 4872905
236 Ga0500560_001373
237 JGI25151J46595_10000332
238 JGI25165J46597_1000052
239 rootH1_10032678
240 rootH1_10012072
241 Ga0055536_1001049
242 Ga0055530_10000012
243 Ga0055531_10006075
244 Ga0055531_10014807
245 Ga0058692_1002024
246 Ga0065707_10082133
247 Ga0070661_100009122
248 Ga0070668_100028972
249 Ga0070668_100104810
250 Ga0070669_100085491
251 Ga0070671_100001119
252 Ga0070671_100046037
253 Ga0070674_100092603
254 Ga0070713_100093986
255 Ga0070679_100043394
256 Ga0070665_100125217
257 Ga0068859_100005814
258 Ga0068861_100006560
259 Ga0068863_100078280
260 Ga0068858_100000736
261 Ga0068858_100002567
262 Ga0068860_100169195
263 Ga0068862_100000036
264 Ga0075365_10009477
265 Ga0075368_10000701
266 Ga0075368_10013146
267 Ga0075363_100031621
268 Ga0075369_10000952
269 Ga0075366_10082148
270 Ga0097620_100005814
271 Ga0111539_10270481
272 Ga0105245_10000505
273 Ga0105248_10000407
274 Ga0105238_10086521
275 Ga0105238_10091513
276 Ga0105249_10003540
277 Ga0105239_10083047
278 Ga0157373_10014368
279 Ga0157373_10024727
280 Ga0157371_10036988
281 Ga0157371_10047434
282 Ga0157374_10028530
283 Ga0163163_10014155
284 Ga0157380_10001637
285 Ga0182008_10000045
286 Ga0163161_10000692
287 Ga0163161_10010740
288 Ga0213876_10032900
289 Ga0209026_1003360
290 Ga0209233_1000118
291 Ga0209130_1004234
292 Ga0209675_1000272
293 Ga0209676_1000226
294 Ga0209676_1000359
295 Ga0209025_1000265
296 Ga0209758_1002263
297 Ga0209758_1007632
298 Ga0209050_1000067
299 Ga0207426_1000287
300 Ga0209257_1000699
301 Ga0209257_1001814
302 Ga0209257_1005535
303 Ga0207680_10025092
304 Ga0207695_10001322
305 Ga0207671_10015237
306 Ga0207649_10010411
307 Ga0207681_10012691
308 Ga0207644_10000070
309 Ga0207644_10003261
310 Ga0207669_10067843
311 Ga0207711_10000607
312 Ga0207703_10000654
313 Ga0207675_100028002
314 Ga0209371_1001001
315 Ga0268266_10070010
316 Ga0268266_10130463
317 Ga0268265_10000052
318 Ga0268264_10145303
319 Ga0316176_1195196
320 Ga0307408_100079387
321 Ga0307516_10001010
322 Ga0307405_10000488
323 Ga0307405_10018401
324 Ga0307406_10072751
325 Ga0307407_10019952
326 Ga0307412_10001664
327 Ga0307414_10013131
328 Ga0307510_10000010
329 Ga0307510_10091041
330 Ga0395899_0057740
331 Ga0395900_0046055
332 Ga0395905_0103593
333 Ga0395901_0087518
334 Ga0395901_0149384
335 Ga0237819_01845
336 Ga0436365_0935598
337 Ga0439462_0000026
338 Ga0450911_001809
339 Ga0495629_0017756
340 Ga0495638_0003940
341 Ga0495638_0063346
342 Ga0495650_0002046
343 Ga0495662_0035576
344 Ga0495607_0003829
345 Ga0495607_0041974
346 Ga0495583_0000027
347 Ga0495606_0000469
348 Ga0495606_0002219
349 Ga0495610_0002939
350 Ga0495631_0001021
351 Ga0495663_0001297
352 Ga0495663_0010541
353 Ga0495597_0005232
354 Ga0495622_0010340
355 Ga0495633_0005346
356 Ga0495633_0020931
357 Ga0495668_0000002
358 Ga0495668_0018575
359 Ga0495625_0017073
360 Ga0495657_0011299
361 Ga0495660_0000357
362 Ga0495672_0059348
363 Ga0495673_0000001
364 Ga0495681_0017600
365 Ga0495686_0000053
366 Ga0495686_0007132
367 Ga0496106_0001445
368 Ga0496113_0007018
369 Ga0496113_0083117
370 Ga0496116_0006018
371 Ga0496116_0034191
372 Ga0496116_0036609
373 Ga0496117_0003123
374 Ga0496117_0012677
375 Ga0496118_0007415
376 Ga0496119_0059250
377 Ga0496121_0013549
378 Ga0496121_0015836
379 Ga0496121_0025525
380 Ga0496122_0041505
381 Ga0496122_0048431
382 Ga0496123_0033462
383 Ga0496123_0036076
384 Ga0496124_0008883
385 Ga0496124_0041591
386 Ga0496124_0056810
387 Ga0496125_0006956
388 Ga0496126_0042122
389 Ga0501032_0034673
390 Ga0501033_0021984
391 Ga0501034_0005785
392 Ga0501034_0053793
393 Ga0501036_0017549
394 Ga0501037_0023118
395 Ga0501039_0059273
396 Ga0501043_0086226
397 Ga0501076_0065344
398 Ga0501249_011712
399 Ga0501080_0001818
400 Ga0501083_0013298
401 Ga0501268_003005
402 Ga0501035_0005680
403 Ga0501044_0011342
404 nmdc:mga00v17_8389_c1
405 nmdc:mga0yw44_10905_c1
406 nmdc:mga0qj67_159262_c1
407 Ga0500641_0017133
408 Ga0500555_000845
409 Ga0500556_0000276
410 Ga0500593_000010
411 Ga0500593_007353
412 Ga0500595_000010
413 Ga0500655_000338
414 Ga0500568_0000001
415 Ga0500568_0000887
416 Ga0500568_0033754
417 Ga0500590_002928
418 Ga0500622_0004880
419 Ga0500624_001369
420 Ga0500636_0032325
421 Ga0500637_0002165
422 Ga0501084_0256525
423 Ga0501082_0039593
424 Ga0501082_0042220
425 Ga0530510_0016680
426 2513613882
427 2578457555
428 2643820764
429 2694627747
430 2694636861
431 2765579926
432 2821445703
433 2841860057
434 2842516842
435 2842760557
436 2844533797
437 2856367427
438 2857444752
439 2869288568
440 2871431235
441 2874150610
442 2874158350
443 2874222612
444 2876385827
445 2876416658
446 2878747839
447 2899792125
448 2903502320
449 2906311012
450 2906323123
451 2919090554
452 2928498388
453 2931383929
454 2933012516
455 2937614508
456 2937815471
457 2938017514
458 2939624648
459 2939628268
460 2958053781
461 2958132970
462 2958182672
463 2961049377
464 2961080520
465 2968122535
466 2977846764
467 8004390537
468 8004645340
469 8004717229
470 8054461716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13761

DUF4166

Domain of unknown function (DUF4166)

389

548

0.95

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

3

159

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h50-assembly1.cif.gz_B crystal structure of carboxyspermidine dehydrogenase from helicobacter pylori in space group c2221 0.7623 7 372
4ina-assembly1.cif.gz_B crystal structure of the q7mss8_wolsu protein from wolinella succinogenes. northeast structural genomics consortium target wsr35 0.7586 8 372
1xr3-assembly1.cif.gz_B-2 actinorhodin polyketide ketoreductase with nadp and the inhibitor isoniazid bound 0.7571 2 135
4j2o-assembly1.cif.gz_E crystal structure of nadp-bound wbjb from a. baumannii community strain d1279779 0.7502 6 108
4ina-assembly1.cif.gz_A crystal structure of the q7mss8_wolsu protein from wolinella succinogenes. northeast structural genomics consortium target wsr35 0.7474 8 372
ID Description Score Start End Superfamily
af_K7UFB2_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9253 294 322 3.40.50.300
af_Q9JIL8_3_164_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9101 294 322 3.40.50.300
af_P70388_3_249_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9055 294 322 3.40.50.300
af_Q9SL02_4_294_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8867 294 322 3.40.50.300
af_Q54CS9_3_300_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8848 294 321 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A661FYZ2-F1-model_v4 Saccharopine dehydrogenase 0.9882 385 556
AF-A0A3D5VLJ8-F1-model_v4 DUF4166 domain-containing protein 0.987 380 555
AF-A0A1F8VDG5-F1-model_v4 DUF4166 domain-containing protein 0.9861 380 555
AF-A0A3B0RV32-F1-model_v4 DUF4166 domain-containing protein 0.9856 380 556
AF-A0A4Y5Z4U8-F1-model_v4 DUF4166 domain-containing protein 0.9831 375 556

Map