F348334

General Info

Members Datasets Scaffolds Average Seq Length
235 166 235 149

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0435607|Ga0436360_0435607_2073_2600
Length 175
Sequence VPQQDKRVVQQDGVSPEALLQLTISRMEIAGSVGSVLAHKGSAVWSIAPNATVFDAIELMADKNVGALPVVDDGQLVGMISERDYTRKVSLKGKSSKHTPVREIMTQDVVTVNVADTIRECMGVMTDSRIRHLPVMEGEKMIGLVSLGDLVKWVILEQAATIEALQKYITGDYPA

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
90 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.7
Rhizosphere 92.34
Stem 0
Stem Tuber 0
Unclassified 5.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10219847 3300005289 Bacteria 1078
2 Ga0065707_10248267 3300005295 Bacteria 1133
3 Ga0065707_10349503 3300005295 Unclassified 920
4 Ga0065707_10415509 3300005295 Unclassified 836
5 Ga0070676_10420623 3300005328 Unclassified 934
6 Ga0070690_100384670 3300005330 Bacteria 1027
7 Ga0070677_10172752 3300005333 Bacteria 1023
8 Ga0070677_10242259 3300005333 Bacteria 891
9 Ga0070666_10302024 3300005335 Bacteria 1140
10 Ga0070689_100072491 3300005340 Unclassified 2692
11 Ga0070668_100116971 3300005347 Bacteria 2127
12 Ga0070668_101100382 3300005347 Unclassified 717
13 Ga0070675_100686641 3300005354 Bacteria 932
14 Ga0070674_100002286 3300005356 Bacteria 10579
15 Ga0070674_100361987 3300005356 Bacteria 1175
16 Ga0070659_100716203 3300005366 Bacteria 866
17 Ga0070709_10197740 3300005434 Bacteria 1422
18 Ga0070713_100004684 3300005436 Bacteria 9236
19 Ga0070713_100241039 3300005436 Unclassified 1646
20 Ga0070713_101626631 3300005436 Unclassified 627
21 Ga0070710_10300057 3300005437 Unclassified 1048
22 Ga0070710_10846917 3300005437 Unclassified 656
23 Ga0070710_10865512 3300005437 Bacteria 650
24 Ga0070710_11248209 3300005437 Bacteria 551
25 Ga0070701_10138749 3300005438 Bacteria 1388
26 Ga0070700_100159169 3300005441 Bacteria 1553
27 Ga0070708_100843367 3300005445 Unclassified 861
28 Ga0070708_101873450 3300005445 Unclassified 556
29 Ga0070678_100589735 3300005456 Bacteria 991
30 Ga0070678_101083216 3300005456 Bacteria 739
31 Ga0068867_100134413 3300005459 Bacteria 1926
32 Ga0070685_10130149 3300005466 Bacteria 1573
33 Ga0070706_100226938 3300005467 Bacteria 1743
34 Ga0070698_100013579 3300005471 Bacteria 8624
35 Ga0070698_101506572 3300005471 Unclassified 624
36 Ga0070699_100370269 3300005518 Bacteria 1292
37 Ga0070699_100454436 3300005518 Unclassified 1162
38 Ga0070697_100012337 3300005536 Bacteria 6695
39 Ga0070697_100482349 3300005536 Bacteria 1083
40 Ga0070697_101244178 3300005536 Bacteria 664
41 Ga0070672_100243377 3300005543 Bacteria 1513
42 Ga0070695_100346273 3300005545 Bacteria 1112
43 Ga0070695_101172021 3300005545 Bacteria 631
44 Ga0070696_100347478 3300005546 Bacteria 1148
45 Ga0070696_100514094 3300005546 Bacteria 955
46 Ga0070704_100144584 3300005549 Bacteria 1862
47 Ga0068866_10183682 3300005718 Bacteria 1237
48 Ga0068861_100143762 3300005719 Bacteria 1950
49 Ga0068858_100006101 3300005842 Bacteria 11757
50 Ga0068858_100233339 3300005842 Bacteria 1744
51 Ga0068862_100033122 3300005844 Bacteria 4365
52 Ga0068862_101346419 3300005844 Bacteria 716
53 Ga0068862_101947908 3300005844 Bacteria 598
54 Ga0070717_10097646 3300006028 Bacteria 2489
55 Ga0070717_10212411 3300006028 Bacteria 1698
56 Ga0070715_10105680 3300006163 Bacteria 1320
57 Ga0070715_10809678 3300006163 Unclassified 569
58 Ga0075428_100247972 3300006844 Bacteria 1920
59 Ga0075433_10819537 3300006852 Unclassified 813
60 Ga0075434_100318124 3300006871 Bacteria 1577
61 Ga0075434_102110335 3300006871 Bacteria 568
62 Ga0075435_100511250 3300007076 Unclassified 1039
63 Ga0105247_10141587 3300009101 Bacteria 1576
64 Ga0114129_10034563 3300009147 Bacteria 7141
65 Ga0114129_10050700 3300009147 Bacteria 5829
66 Ga0114129_10297070 3300009147 Bacteria 2154
67 Ga0105243_10055234 3300009148 Bacteria 3155
68 Ga0105242_10530561 3300009176 Bacteria 1125
69 Ga0105242_11596455 3300009176 Bacteria 686
70 Ga0105248_10012641 3300009177 Bacteria 9315
71 Ga0105249_10050369 3300009553 Bacteria 3797
72 Ga0157378_10182131 3300013297 Bacteria 1977
73 Ga0157378_11588317 3300013297 Bacteria 700
74 Ga0157378_13319460 3300013297 Bacteria 500
75 Ga0163162_10199388 3300013306 Bacteria 2130
76 Ga0157375_10197727 3300013308 Bacteria 2166
77 Ga0157375_10374983 3300013308 Bacteria 1589
78 Ga0157380_10086566 3300014326 Bacteria 2575
79 Ga0157379_10321508 3300014968 Bacteria 1413
80 Ga0213873_10007201 3300021358 Bacteria 2219
81 Ga0213873_10008690 3300021358 Bacteria 2084
82 Ga0213873_10136830 3300021358 Bacteria 729
83 Ga0213872_10016090 3300021361 Bacteria 3473
84 Ga0213872_10025692 3300021361 Bacteria 2706
85 Ga0213872_10048825 3300021361 Bacteria 1923
86 Ga0213872_10057856 3300021361 Bacteria 1755
87 Ga0213872_10244420 3300021361 Unclassified 758
88 Ga0213875_10081008 3300021388 Unclassified 1515
89 Ga0213871_10003675 3300021441 Bacteria 2989
90 Ga0213871_10013882 3300021441 Bacteria 1901
91 Ga0213871_10224357 3300021441 Bacteria 591
92 Ga0207710_10187419 3300025900 Bacteria 1017
93 Ga0207680_10182509 3300025903 Bacteria 1420
94 Ga0207685_10631342 3300025905 Bacteria 577
95 Ga0207699_10043019 3300025906 Unclassified 2622
96 Ga0207645_10407152 3300025907 Bacteria 915
97 Ga0207684_10411628 3300025910 Bacteria 1162
98 Ga0207693_10151737 3300025915 Bacteria 1822
99 Ga0207646_11270447 3300025922 Unclassified 644
100 Ga0207646_11394089 3300025922 Bacteria 610
101 Ga0207681_10236789 3300025923 Bacteria 1419
102 Ga0207650_10072459 3300025925 Unclassified 2593
103 Ga0207700_10445298 3300025928 Bacteria 1141
104 Ga0207664_10240382 3300025929 Bacteria 1577
105 Ga0207664_10265998 3300025929 Bacteria 1501
106 Ga0207686_10553790 3300025934 Bacteria 899
107 Ga0207670_10066894 3300025936 Bacteria 2470
108 Ga0207669_10104637 3300025937 Bacteria 1881
109 Ga0207665_10882071 3300025939 Unclassified 709
110 Ga0207691_10256613 3300025940 Bacteria 1508
111 Ga0207712_10482804 3300025961 Bacteria 1057
112 Ga0207640_10625670 3300025981 Bacteria 914
113 Ga0207658_10365636 3300025986 Bacteria 1260
114 Ga0207678_10769070 3300026067 Unclassified 850
115 Ga0207708_10296925 3300026075 Bacteria 1313
116 Ga0207641_10930553 3300026088 Unclassified 864
117 Ga0207648_10049801 3300026089 Bacteria 3664
118 Ga0207648_10089797 3300026089 Bacteria 2685
119 Ga0207676_11597821 3300026095 Bacteria 650
120 Ga0207675_100082020 3300026118 Bacteria 3024
121 Ga0207675_101968284 3300026118 Bacteria 602
122 Ga0268265_11250097 3300028380 Bacteria 741
123 Ga0268264_10748106 3300028381 Bacteria 974
124 Ga0316182_1345904 3300030745 Bacteria 1755
125 Ga0265330_10003169 3300031235 Bacteria 8696
126 Ga0265327_10006483 3300031251 Bacteria 9343
127 Ga0265316_10035005 3300031344 Unclassified 4075
128 Ga0316579_10176082 3300031691 Bacteria 1034
129 Ga0265342_10081495 3300031712 Unclassified 1868
130 Ga0316576_10016571 3300031727 Bacteria 4983
131 Ga0316583_10021544 3300032133 Bacteria 2310
132 Ga0316593_10034913 3300032168 Bacteria 1652
133 Ga0373934_0220178 3300035086 Bacteria 783
134 Ga0373923_0064594 3300035111 Unclassified 1561
135 Ga0373953_0014109 3300035117 Bacteria 2867
136 Ga0373954_0007787 3300035118 Bacteria 4690
137 Ga0373956_0002608 3300035119 Bacteria 7310
138 Ga0373943_0812494 3300035170 Bacteria 557
139 Ga0373955_0087002 3300035172 Bacteria 1775
140 Ga0316574_0057866 3300035398 Bacteria 2428
141 Ga0373933_0075449 3300035724 Unclassified 2058
142 Ga0316582_0024092 3300036647 Bacteria 3638
143 Ga0316582_0054014 3300036647 Bacteria 2556
144 Ga0373925_0150939 3300037068 Bacteria 1825
145 Ga0436364_0220468 3300037853 Bacteria 1133
146 Ga0436364_0735347 3300037853 Unclassified 1038
147 Ga0436364_1544936 3300037853 Bacteria 2175
148 Ga0436365_0121356 3300039437 Bacteria 1577
149 Ga0436365_1046022 3300039437 Bacteria 4676
150 Ga0436360_0435607 3300039438 Bacteria 3498
151 Ga0436360_1001631 3300039438 Bacteria 2687
152 Ga0436360_1145256 3300039438 Bacteria 1785
153 Ga0436360_1283839 3300039438 Bacteria 3030
154 Ga0436360_1344517 3300039438 Bacteria 1775
155 Ga0436361_0084085 3300039447 Bacteria 2779
156 Ga0436361_0111052 3300039447 Bacteria 2810
157 Ga0436361_0360478 3300039447 Bacteria 2580
158 Ga0436361_0832009 3300039447 Bacteria 2046
159 Ga0436361_0917364 3300039447 Unclassified 3539
160 Ga0436363_0246847 3300039450 Bacteria 4435
161 Ga0436363_1346061 3300039450 Unclassified 1648
162 Ga0436362_0134258 3300039453 Bacteria 3565
163 Ga0436362_0499418 3300039453 Bacteria 2689
164 Ga0436362_0530764 3300039453 Bacteria 747
165 Ga0436362_0869820 3300039453 Bacteria 1405
166 Ga0436362_1296339 3300039453 Bacteria 1290
167 Ga0439465_0028158 3300041413 Bacteria 1781
168 Ga0451837_0826166 3300041494 Bacteria 3111
169 Ga0466969_0023892 3300044656 Bacteria 3146
170 Ga0466972_0027019 3300044658 Bacteria 2841
171 Ga0466982_0000007 3300044672 Bacteria 250854
172 Ga0466966_0006305 3300044684 Bacteria 7846
173 Ga0466964_0004034 3300044706 Bacteria 5397
174 Ga0453684_0608580 3300044712 Unclassified 1197
175 Ga0466968_0000902 3300044735 Bacteria 10457
176 Ga0466970_0035220 3300044765 Bacteria 2652
177 Ga0466960_0021962 3300044901 Bacteria 2847
178 Ga0451576_0227836 3300045051 Bacteria 1946
179 Ga0466958_0161424 3300045836 Bacteria 1416
180 Ga0495628_1115443 3300046516 Bacteria 538
181 Ga0495643_0000359 3300046522 Bacteria 62167
182 Ga0495643_0004670 3300046522 Bacteria 9512
183 Ga0495642_0001995 3300046528 Bacteria 8543
184 Ga0495640_0297121 3300046533 Bacteria 1004
185 Ga0495597_0009756 3300046542 Bacteria 4728
186 Ga0495645_0190571 3300046543 Bacteria 1398
187 Ga0495668_0046843 3300046616 Bacteria 2402
188 Ga0495634_0029406 3300046642 Bacteria 3804
189 Ga0495661_0005406 3300046665 Bacteria 9083
190 Ga0495599_0199401 3300046678 Bacteria 1230
191 Ga0495647_0023649 3300046681 Bacteria 2230
192 Ga0495658_0159836 3300046683 Bacteria 1389
193 Ga0495658_0369322 3300046683 Unclassified 913
194 Ga0495581_0789610 3300047315 Bacteria 545
195 Ga0495604_0274591 3300047317 Bacteria 1141
196 Ga0495676_0260385 3300047321 Bacteria 1180
197 Ga0495687_008722 3300047443 Bacteria 5758
198 Ga0495686_0132032 3300047472 Bacteria 1480
199 Ga0496102_0117248 3300048905 Bacteria 2485
200 Ga0496107_0963051 3300048910 Bacteria 620
201 Ga0496112_1100029 3300048915 Unclassified 713
202 Ga0496115_0604348 3300048918 Bacteria 872
203 Ga0496117_0002696 3300048920 Bacteria 21946
204 Ga0496118_0002064 3300048921 Bacteria 28295
205 Ga0496126_0000164 3300048929 Bacteria 152791
206 Ga0501034_0429036 3300049571 Unclassified 1242
207 Ga0501036_0105300 3300049572 Bacteria 2386
208 Ga0501038_0248793 3300049574 Bacteria 1409
209 Ga0501039_0680803 3300049575 Bacteria 805
210 Ga0501041_0065689 3300049577 Bacteria 2223
211 Ga0501041_0084789 3300049577 Bacteria 1953
212 Ga0501042_0741701 3300049578 Bacteria 714
213 Ga0501042_0873469 3300049578 Bacteria 655
214 Ga0501046_0701204 3300049580 Bacteria 713
215 Ga0501048_0403174 3300049582 Bacteria 978
216 Ga0501071_0507093 3300049587 Bacteria 926
217 Ga0501075_0009480 3300049591 Bacteria 6814
218 Ga0501076_0046055 3300049592 Bacteria 3445
219 Ga0501076_0430673 3300049592 Bacteria 1086
220 Ga0501079_0046343 3300049741 Bacteria 3355
221 Ga0501079_0083266 3300049741 Unclassified 2475
222 Ga0501081_0062584 3300049743 Bacteria 2581
223 Ga0501081_0211237 3300049743 Bacteria 1409
224 Ga0501045_0481541 3300049824 Bacteria 922
225 nmdc:mga05p37_176698_c1 3300050507 Bacteria 2601
226 nmdc:mga05p37_27944_c2 3300050507 Bacteria 5840
227 nmdc:mga05p37_81886_c1 3300050507 Bacteria 3976
228 nmdc:mga0n895_623470_c1 3300050512 Bacteria 1079
229 nmdc:mga0a205_904050_c1 3300050515 Unclassified 730
230 Ga0495601_0076379 3300053077 Bacteria 2145
231 Ga0495619_0178316 3300053085 Bacteria 1470
232 Ga0495619_0441742 3300053085 Bacteria 897
233 Ga0500645_007544 3300053730 Bacteria 3778
234 Ga0466962_0002611 3300061719 Bacteria 8565
235 Ga0530510_0683203 3300061734 Bacteria 782

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026088 Ga0207641_10930553 Ga0207641_109305532 114
2 3300006871 Ga0075434_100318124 Ga0075434_1003181242 140
3 3300030745 Ga0316182_1345904 Ga0316182_13459041 140
4 3300031251 Ga0265327_10006483 Ga0265327_100064836 140
5 3300041494 Ga0451837_0826166 Ga0451837_0826166_2081_2512 140
6 3300047315 Ga0495581_0789610 Ga0495581_0789610_47_478 140
7 3300048910 Ga0496107_0963051 Ga0496107_0963051_44_472 140
8 3300050512 nmdc:mga0n895_623470_c1 nmdc:mga0n895_623470_c1_584_1012 140
9 3300032168 Ga0316593_10034913 Ga0316593_100349133 141
10 3300044656 Ga0466969_0023892 Ga0466969_0023892_699_1130 141
11 3300044658 Ga0466972_0027019 Ga0466972_0027019_2053_2484 141
12 3300044672 Ga0466982_0000007 Ga0466982_0000007_164402_164833 141
13 3300044684 Ga0466966_0006305 Ga0466966_0006305_2236_2667 141
14 3300044706 Ga0466964_0004034 Ga0466964_0004034_1157_1588 141
15 3300044735 Ga0466968_0000902 Ga0466968_0000902_267_698 141
16 3300044765 Ga0466970_0035220 Ga0466970_0035220_2051_2482 141
17 3300044901 Ga0466960_0021962 Ga0466960_0021962_1815_2246 141
18 3300045836 Ga0466958_0161424 Ga0466958_0161424_725_1156 141
19 3300061719 Ga0466962_0002611 Ga0466962_0002611_4041_4472 141
20 3300031235 Ga0265330_10003169 Ga0265330_100031694 142
21 3300031344 Ga0265316_10035005 Ga0265316_100350052 142
22 3300031712 Ga0265342_10081495 Ga0265342_100814952 142
23 3300032133 Ga0316583_10021544 Ga0316583_100215443 142
24 3300035398 Ga0316574_0057866 Ga0316574_0057866_1933_2367 142
25 3300036647 Ga0316582_0054014 Ga0316582_0054014_1138_1572 142
26 3300041413 Ga0439465_0028158 Ga0439465_0028158_713_1147 142
27 3300048905 Ga0496102_0117248 Ga0496102_0117248_606_1040 142
28 3300025905 Ga0207685_10631342 Ga0207685_106313421 143
29 3300031691 Ga0316579_10176082 Ga0316579_101760821 143
30 3300031727 Ga0316576_10016571 Ga0316576_100165713 143
31 3300036647 Ga0316582_0024092 Ga0316582_0024092_1865_2302 143
32 3300046522 Ga0495643_0004670 Ga0495643_0004670_4109_4549 143
33 3300046528 Ga0495642_0001995 Ga0495642_0001995_992_1432 143
34 3300046542 Ga0495597_0009756 Ga0495597_0009756_1966_2406 143
35 3300046616 Ga0495668_0046843 Ga0495668_0046843_1196_1636 143
36 3300046665 Ga0495661_0005406 Ga0495661_0005406_4548_4988 143
37 3300046683 Ga0495658_0159836 Ga0495658_0159836_804_1244 143
38 3300046683 Ga0495658_0369322 Ga0495658_0369322_405_845 143
39 3300047321 Ga0495676_0260385 Ga0495676_0260385_512_952 143
40 3300047443 Ga0495687_008722 Ga0495687_008722_2303_2743 143
41 3300053085 Ga0495619_0441742 Ga0495619_0441742_73_513 143
42 3300046522 Ga0495643_0000359 Ga0495643_0000359_19908_20348 144
43 3300047472 Ga0495686_0132032 Ga0495686_0132032_737_1246 144
44 3300048920 Ga0496117_0002696 Ga0496117_0002696_8189_8677 144
45 3300048921 Ga0496118_0002064 Ga0496118_0002064_619_1107 144
46 3300048929 Ga0496126_0000164 Ga0496126_0000164_59550_60038 144
47 3300005333 Ga0070677_10172752 Ga0070677_101727522 145
48 3300005347 Ga0070668_101100382 Ga0070668_1011003822 145
49 3300005456 Ga0070678_100589735 Ga0070678_1005897352 145
50 3300006852 Ga0075433_10819537 Ga0075433_108195372 145
51 3300007076 Ga0075435_100511250 Ga0075435_1005112501 145
52 3300009147 Ga0114129_10034563 Ga0114129_100345634 145
53 3300013308 Ga0157375_10197727 Ga0157375_101977272 145
54 3300021358 Ga0213873_10007201 Ga0213873_100072012 145
55 3300021361 Ga0213872_10016090 Ga0213872_100160902 145
56 3300025937 Ga0207669_10104637 Ga0207669_101046373 145
57 3300026067 Ga0207678_10769070 Ga0207678_107690702 145
58 3300037853 Ga0436364_0735347 Ga0436364_0735347_346_807 145
59 3300039438 Ga0436360_1344517 Ga0436360_1344517_58_501 145
60 3300039447 Ga0436361_0360478 Ga0436361_0360478_2122_2565 145
61 3300039450 Ga0436363_0246847 Ga0436363_0246847_3356_3802 145
62 3300039453 Ga0436362_0134258 Ga0436362_0134258_876_1319 145
63 3300049571 Ga0501034_0429036 Ga0501034_0429036_69_512 145
64 3300050507 nmdc:mga05p37_81886_c1 nmdc:mga05p37_81886_c1_147_590 145
65 3300050515 nmdc:mga0a205_904050_c1 nmdc:mga0a205_904050_c1_277_720 145
66 3300061734 Ga0530510_0683203 Ga0530510_0683203_277_756 145
67 3300035086 Ga0373934_0220178 Ga0373934_0220178_182_622 146
68 3300035111 Ga0373923_0064594 Ga0373923_0064594_478_918 146
69 3300035117 Ga0373953_0014109 Ga0373953_0014109_2111_2551 146
70 3300035118 Ga0373954_0007787 Ga0373954_0007787_3859_4299 146
71 3300035119 Ga0373956_0002608 Ga0373956_0002608_2795_3235 146
72 3300035172 Ga0373955_0087002 Ga0373955_0087002_1180_1620 146
73 3300035724 Ga0373933_0075449 Ga0373933_0075449_608_1048 146
74 3300046681 Ga0495647_0023649 Ga0495647_0023649_1733_2173 146
75 3300005289 Ga0065704_10219847 Ga0065704_102198472 147
76 3300005295 Ga0065707_10248267 Ga0065707_102482671 147
77 3300005295 Ga0065707_10349503 Ga0065707_103495031 147
78 3300005295 Ga0065707_10415509 Ga0065707_104155092 147
79 3300005328 Ga0070676_10420623 Ga0070676_104206231 147
80 3300005330 Ga0070690_100384670 Ga0070690_1003846701 147
81 3300005333 Ga0070677_10242259 Ga0070677_102422591 147
82 3300005335 Ga0070666_10302024 Ga0070666_103020241 147
83 3300005340 Ga0070689_100072491 Ga0070689_1000724912 147
84 3300005347 Ga0070668_100116971 Ga0070668_1001169712 147
85 3300005354 Ga0070675_100686641 Ga0070675_1006866411 147
86 3300005356 Ga0070674_100002286 Ga0070674_1000022864 147
87 3300005356 Ga0070674_100361987 Ga0070674_1003619871 147
88 3300005366 Ga0070659_100716203 Ga0070659_1007162032 147
89 3300005434 Ga0070709_10197740 Ga0070709_101977403 147
90 3300005436 Ga0070713_100004684 Ga0070713_1000046847 147
91 3300005436 Ga0070713_100241039 Ga0070713_1002410392 147
92 3300005436 Ga0070713_101626631 Ga0070713_1016266311 147
93 3300005437 Ga0070710_10300057 Ga0070710_103000572 147
94 3300005437 Ga0070710_10846917 Ga0070710_108469171 147
95 3300005437 Ga0070710_10865512 Ga0070710_108655121 147
96 3300005437 Ga0070710_11248209 Ga0070710_112482091 147
97 3300005438 Ga0070701_10138749 Ga0070701_101387491 147
98 3300005441 Ga0070700_100159169 Ga0070700_1001591692 147
99 3300005445 Ga0070708_100843367 Ga0070708_1008433672 147
100 3300005445 Ga0070708_101873450 Ga0070708_1018734501 147
101 3300005456 Ga0070678_101083216 Ga0070678_1010832161 147
102 3300005459 Ga0068867_100134413 Ga0068867_1001344132 147
103 3300005466 Ga0070685_10130149 Ga0070685_101301491 147
104 3300005467 Ga0070706_100226938 Ga0070706_1002269381 147
105 3300005471 Ga0070698_100013579 Ga0070698_1000135797 147
106 3300005471 Ga0070698_101506572 Ga0070698_1015065721 147
107 3300005518 Ga0070699_100370269 Ga0070699_1003702693 147
108 3300005518 Ga0070699_100454436 Ga0070699_1004544361 147
109 3300005536 Ga0070697_100012337 Ga0070697_1000123374 147
110 3300005536 Ga0070697_100482349 Ga0070697_1004823491 147
111 3300005536 Ga0070697_101244178 Ga0070697_1012441781 147
112 3300005543 Ga0070672_100243377 Ga0070672_1002433772 147
113 3300005545 Ga0070695_100346273 Ga0070695_1003462732 147
114 3300005545 Ga0070695_101172021 Ga0070695_1011720211 147
115 3300005546 Ga0070696_100347478 Ga0070696_1003474782 147
116 3300005546 Ga0070696_100514094 Ga0070696_1005140942 147
117 3300005549 Ga0070704_100144584 Ga0070704_1001445842 147
118 3300005718 Ga0068866_10183682 Ga0068866_101836822 147
119 3300005719 Ga0068861_100143762 Ga0068861_1001437623 147
120 3300005842 Ga0068858_100006101 Ga0068858_1000061016 147
121 3300005842 Ga0068858_100233339 Ga0068858_1002333393 147
122 3300005844 Ga0068862_100033122 Ga0068862_1000331222 147
123 3300005844 Ga0068862_101346419 Ga0068862_1013464192 147
124 3300005844 Ga0068862_101947908 Ga0068862_1019479081 147
125 3300006028 Ga0070717_10097646 Ga0070717_100976462 147
126 3300006028 Ga0070717_10212411 Ga0070717_102124112 147
127 3300006163 Ga0070715_10105680 Ga0070715_101056801 147
128 3300006163 Ga0070715_10809678 Ga0070715_108096781 147
129 3300006844 Ga0075428_100247972 Ga0075428_1002479722 147
130 3300006871 Ga0075434_102110335 Ga0075434_1021103351 147
131 3300009101 Ga0105247_10141587 Ga0105247_101415874 147
132 3300009147 Ga0114129_10050700 Ga0114129_100507003 147
133 3300009147 Ga0114129_10297070 Ga0114129_102970702 147
134 3300009148 Ga0105243_10055234 Ga0105243_100552342 147
135 3300009176 Ga0105242_10530561 Ga0105242_105305612 147
136 3300009176 Ga0105242_11596455 Ga0105242_115964551 147
137 3300009177 Ga0105248_10012641 Ga0105248_100126416 147
138 3300009553 Ga0105249_10050369 Ga0105249_100503692 147
139 3300013297 Ga0157378_10182131 Ga0157378_101821312 147
140 3300013297 Ga0157378_11588317 Ga0157378_115883171 147
141 3300013297 Ga0157378_13319460 Ga0157378_133194601 147
142 3300013306 Ga0163162_10199388 Ga0163162_101993881 147
143 3300013308 Ga0157375_10374983 Ga0157375_103749832 147
144 3300014326 Ga0157380_10086566 Ga0157380_100865663 147
145 3300014968 Ga0157379_10321508 Ga0157379_103215082 147
146 3300021358 Ga0213873_10008690 Ga0213873_100086903 147
147 3300021358 Ga0213873_10136830 Ga0213873_101368301 147
148 3300021361 Ga0213872_10025692 Ga0213872_100256921 147
149 3300021361 Ga0213872_10048825 Ga0213872_100488253 147
150 3300021361 Ga0213872_10057856 Ga0213872_100578562 147
151 3300021361 Ga0213872_10244420 Ga0213872_102444201 147
152 3300021388 Ga0213875_10081008 Ga0213875_100810082 147
153 3300021441 Ga0213871_10003675 Ga0213871_100036754 147
154 3300021441 Ga0213871_10013882 Ga0213871_100138822 147
155 3300021441 Ga0213871_10224357 Ga0213871_102243571 147
156 3300025900 Ga0207710_10187419 Ga0207710_101874192 147
157 3300025903 Ga0207680_10182509 Ga0207680_101825092 147
158 3300025906 Ga0207699_10043019 Ga0207699_100430193 147
159 3300025907 Ga0207645_10407152 Ga0207645_104071521 147
160 3300025910 Ga0207684_10411628 Ga0207684_104116282 147
161 3300025915 Ga0207693_10151737 Ga0207693_101517372 147
162 3300025922 Ga0207646_11270447 Ga0207646_112704471 147
163 3300025922 Ga0207646_11394089 Ga0207646_113940891 147
164 3300025923 Ga0207681_10236789 Ga0207681_102367892 147
165 3300025925 Ga0207650_10072459 Ga0207650_100724594 147
166 3300025928 Ga0207700_10445298 Ga0207700_104452982 147
167 3300025929 Ga0207664_10240382 Ga0207664_102403822 147
168 3300025929 Ga0207664_10265998 Ga0207664_102659982 147
169 3300025934 Ga0207686_10553790 Ga0207686_105537901 147
170 3300025936 Ga0207670_10066894 Ga0207670_100668943 147
171 3300025939 Ga0207665_10882071 Ga0207665_108820712 147
172 3300025940 Ga0207691_10256613 Ga0207691_102566133 147
173 3300025961 Ga0207712_10482804 Ga0207712_104828042 147
174 3300025981 Ga0207640_10625670 Ga0207640_106256701 147
175 3300025986 Ga0207658_10365636 Ga0207658_103656361 147
176 3300026075 Ga0207708_10296925 Ga0207708_102969252 147
177 3300026089 Ga0207648_10049801 Ga0207648_100498013 147
178 3300026089 Ga0207648_10089797 Ga0207648_100897973 147
179 3300026095 Ga0207676_11597821 Ga0207676_115978212 147
180 3300026118 Ga0207675_100082020 Ga0207675_1000820202 147
181 3300026118 Ga0207675_101968284 Ga0207675_1019682841 147
182 3300028380 Ga0268265_11250097 Ga0268265_112500972 147
183 3300028381 Ga0268264_10748106 Ga0268264_107481061 147
184 3300035170 Ga0373943_0812494 Ga0373943_0812494_67_510 147
185 3300037068 Ga0373925_0150939 Ga0373925_0150939_585_1028 147
186 3300037853 Ga0436364_0220468 Ga0436364_0220468_455_910 147
187 3300037853 Ga0436364_1544936 Ga0436364_1544936_650_1099 147
188 3300039437 Ga0436365_0121356 Ga0436365_0121356_88_537 147
189 3300039437 Ga0436365_1046022 Ga0436365_1046022_1593_2042 147
190 3300039438 Ga0436360_0435607 Ga0436360_0435607_2073_2600 147
191 3300039438 Ga0436360_1001631 Ga0436360_1001631_1434_1883 147
192 3300039438 Ga0436360_1145256 Ga0436360_1145256_222_671 147
193 3300039438 Ga0436360_1283839 Ga0436360_1283839_86_535 147
194 3300039447 Ga0436361_0084085 Ga0436361_0084085_449_898 147
195 3300039447 Ga0436361_0111052 Ga0436361_0111052_1954_2403 147
196 3300039447 Ga0436361_0832009 Ga0436361_0832009_152_601 147
197 3300039447 Ga0436361_0917364 Ga0436361_0917364_2449_2973 147
198 3300039450 Ga0436363_1346061 Ga0436363_1346061_704_1153 147
199 3300039453 Ga0436362_0499418 Ga0436362_0499418_2109_2558 147
200 3300039453 Ga0436362_0530764 Ga0436362_0530764_265_714 147
201 3300039453 Ga0436362_0869820 Ga0436362_0869820_561_1010 147
202 3300039453 Ga0436362_1296339 Ga0436362_1296339_260_709 147
203 3300044712 Ga0453684_0608580 Ga0453684_0608580_371_841 147
204 3300045051 Ga0451576_0227836 Ga0451576_0227836_1208_1657 147
205 3300046516 Ga0495628_1115443 Ga0495628_1115443_47_523 147
206 3300046533 Ga0495640_0297121 Ga0495640_0297121_432_875 147
207 3300046543 Ga0495645_0190571 Ga0495645_0190571_14_490 147
208 3300046642 Ga0495634_0029406 Ga0495634_0029406_3195_3638 147
209 3300046678 Ga0495599_0199401 Ga0495599_0199401_407_883 147
210 3300047317 Ga0495604_0274591 Ga0495604_0274591_14_490 147
211 3300048915 Ga0496112_1100029 Ga0496112_1100029_180_629 147
212 3300048918 Ga0496115_0604348 Ga0496115_0604348_100_549 147
213 3300049572 Ga0501036_0105300 Ga0501036_0105300_447_896 147
214 3300049574 Ga0501038_0248793 Ga0501038_0248793_482_931 147
215 3300049575 Ga0501039_0680803 Ga0501039_0680803_188_637 147
216 3300049577 Ga0501041_0065689 Ga0501041_0065689_1539_1988 147
217 3300049577 Ga0501041_0084789 Ga0501041_0084789_1253_1702 147
218 3300049578 Ga0501042_0741701 Ga0501042_0741701_182_631 147
219 3300049578 Ga0501042_0873469 Ga0501042_0873469_76_570 147
220 3300049580 Ga0501046_0701204 Ga0501046_0701204_121_570 147
221 3300049582 Ga0501048_0403174 Ga0501048_0403174_451_900 147
222 3300049587 Ga0501071_0507093 Ga0501071_0507093_44_493 147
223 3300049591 Ga0501075_0009480 Ga0501075_0009480_2321_2770 147
224 3300049592 Ga0501076_0046055 Ga0501076_0046055_1036_1485 147
225 3300049592 Ga0501076_0430673 Ga0501076_0430673_523_984 147
226 3300049741 Ga0501079_0046343 Ga0501079_0046343_1690_2139 147
227 3300049741 Ga0501079_0083266 Ga0501079_0083266_1918_2379 147
228 3300049743 Ga0501081_0062584 Ga0501081_0062584_754_1215 147
229 3300049743 Ga0501081_0211237 Ga0501081_0211237_905_1354 147
230 3300049824 Ga0501045_0481541 Ga0501045_0481541_392_841 147
231 3300050507 nmdc:mga05p37_176698_c1 nmdc:mga05p37_176698_c1_1398_1841 147
232 3300050507 nmdc:mga05p37_27944_c2 nmdc:mga05p37_27944_c2_5055_5498 147
233 3300053077 Ga0495601_0076379 Ga0495601_0076379_1547_1990 147
234 3300053085 Ga0495619_0178316 Ga0495619_0178316_609_1052 147
235 3300053730 Ga0500645_007544 Ga0500645_007544_208_657 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

101

156

0.94

PF00571

CBS

CBS domain

38

91

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9624 1 127
4fry-assembly1.cif.gz_A the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 0.9584 4 130
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.9567 3 127
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9477 1 127
3fhm-assembly2.cif.gz_B crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9448 4 125
ID Description Score Start End Superfamily
af_P71737_1_141_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9712 4 142 3.10.580.10
af_O13965_237_391_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9617 2 129 3.10.580.10
af_K7KHU5_50_204_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9617 3 144 3.10.580.10
4fryA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9584 4 130 3.10.580.10
2rc3D00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9567 3 127 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A127FDE4-F1-model_v4 Histidine kinase 0.992 3 143 GO:0016301
AF-A0A7Y2K6A9-F1-model_v4 CBS domain-containing protein 0.9893 4 125
AF-A0A7C4BV57-F1-model_v4 CBS domain-containing protein 0.9886 2 132
AF-A0A7W7YAX3-F1-model_v4 CBS domain-containing protein 0.9878 1 123
AF-T1B6V4-F1-model_v4 Signal-transduction protein with CBS domain protein 0.9869 1 119

Feature Viewer

pLDDT pTM Quality
92.15 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map