F348334
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 235 | 166 | 235 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_0435607|Ga0436360_0435607_2073_2600 |
| Length | 175 |
| Sequence | VPQQDKRVVQQDGVSPEALLQLTISRMEIAGSVGSVLAHKGSAVWSIAPNATVFDAIELMADKNVGALPVVDDGQLVGMISERDYTRKVSLKGKSSKHTPVREIMTQDVVTVNVADTIRECMGVMTDSRIRHLPVMEGEKMIGLVSLGDLVKWVILEQAATIEALQKYITGDYPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 39 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 51 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 52 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 53 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 54 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 83 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 84 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 87 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 88 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 89 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 90 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 92 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 93 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 94 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 95 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 96 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 97 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 98 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 99 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 100 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 101 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 103 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 104 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 105 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 106 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 107 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 108 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 109 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 110 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 111 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 112 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 113 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 114 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 115 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 116 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 117 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 118 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 119 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 120 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 121 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 142 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 143 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 144 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 145 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 165 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 166 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.43 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 1.7 |
| Rhizosphere | 92.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10219847 | 3300005289 | Bacteria | 1078 |
| 2 | Ga0065707_10248267 | 3300005295 | Bacteria | 1133 |
| 3 | Ga0065707_10349503 | 3300005295 | Unclassified | 920 |
| 4 | Ga0065707_10415509 | 3300005295 | Unclassified | 836 |
| 5 | Ga0070676_10420623 | 3300005328 | Unclassified | 934 |
| 6 | Ga0070690_100384670 | 3300005330 | Bacteria | 1027 |
| 7 | Ga0070677_10172752 | 3300005333 | Bacteria | 1023 |
| 8 | Ga0070677_10242259 | 3300005333 | Bacteria | 891 |
| 9 | Ga0070666_10302024 | 3300005335 | Bacteria | 1140 |
| 10 | Ga0070689_100072491 | 3300005340 | Unclassified | 2692 |
| 11 | Ga0070668_100116971 | 3300005347 | Bacteria | 2127 |
| 12 | Ga0070668_101100382 | 3300005347 | Unclassified | 717 |
| 13 | Ga0070675_100686641 | 3300005354 | Bacteria | 932 |
| 14 | Ga0070674_100002286 | 3300005356 | Bacteria | 10579 |
| 15 | Ga0070674_100361987 | 3300005356 | Bacteria | 1175 |
| 16 | Ga0070659_100716203 | 3300005366 | Bacteria | 866 |
| 17 | Ga0070709_10197740 | 3300005434 | Bacteria | 1422 |
| 18 | Ga0070713_100004684 | 3300005436 | Bacteria | 9236 |
| 19 | Ga0070713_100241039 | 3300005436 | Unclassified | 1646 |
| 20 | Ga0070713_101626631 | 3300005436 | Unclassified | 627 |
| 21 | Ga0070710_10300057 | 3300005437 | Unclassified | 1048 |
| 22 | Ga0070710_10846917 | 3300005437 | Unclassified | 656 |
| 23 | Ga0070710_10865512 | 3300005437 | Bacteria | 650 |
| 24 | Ga0070710_11248209 | 3300005437 | Bacteria | 551 |
| 25 | Ga0070701_10138749 | 3300005438 | Bacteria | 1388 |
| 26 | Ga0070700_100159169 | 3300005441 | Bacteria | 1553 |
| 27 | Ga0070708_100843367 | 3300005445 | Unclassified | 861 |
| 28 | Ga0070708_101873450 | 3300005445 | Unclassified | 556 |
| 29 | Ga0070678_100589735 | 3300005456 | Bacteria | 991 |
| 30 | Ga0070678_101083216 | 3300005456 | Bacteria | 739 |
| 31 | Ga0068867_100134413 | 3300005459 | Bacteria | 1926 |
| 32 | Ga0070685_10130149 | 3300005466 | Bacteria | 1573 |
| 33 | Ga0070706_100226938 | 3300005467 | Bacteria | 1743 |
| 34 | Ga0070698_100013579 | 3300005471 | Bacteria | 8624 |
| 35 | Ga0070698_101506572 | 3300005471 | Unclassified | 624 |
| 36 | Ga0070699_100370269 | 3300005518 | Bacteria | 1292 |
| 37 | Ga0070699_100454436 | 3300005518 | Unclassified | 1162 |
| 38 | Ga0070697_100012337 | 3300005536 | Bacteria | 6695 |
| 39 | Ga0070697_100482349 | 3300005536 | Bacteria | 1083 |
| 40 | Ga0070697_101244178 | 3300005536 | Bacteria | 664 |
| 41 | Ga0070672_100243377 | 3300005543 | Bacteria | 1513 |
| 42 | Ga0070695_100346273 | 3300005545 | Bacteria | 1112 |
| 43 | Ga0070695_101172021 | 3300005545 | Bacteria | 631 |
| 44 | Ga0070696_100347478 | 3300005546 | Bacteria | 1148 |
| 45 | Ga0070696_100514094 | 3300005546 | Bacteria | 955 |
| 46 | Ga0070704_100144584 | 3300005549 | Bacteria | 1862 |
| 47 | Ga0068866_10183682 | 3300005718 | Bacteria | 1237 |
| 48 | Ga0068861_100143762 | 3300005719 | Bacteria | 1950 |
| 49 | Ga0068858_100006101 | 3300005842 | Bacteria | 11757 |
| 50 | Ga0068858_100233339 | 3300005842 | Bacteria | 1744 |
| 51 | Ga0068862_100033122 | 3300005844 | Bacteria | 4365 |
| 52 | Ga0068862_101346419 | 3300005844 | Bacteria | 716 |
| 53 | Ga0068862_101947908 | 3300005844 | Bacteria | 598 |
| 54 | Ga0070717_10097646 | 3300006028 | Bacteria | 2489 |
| 55 | Ga0070717_10212411 | 3300006028 | Bacteria | 1698 |
| 56 | Ga0070715_10105680 | 3300006163 | Bacteria | 1320 |
| 57 | Ga0070715_10809678 | 3300006163 | Unclassified | 569 |
| 58 | Ga0075428_100247972 | 3300006844 | Bacteria | 1920 |
| 59 | Ga0075433_10819537 | 3300006852 | Unclassified | 813 |
| 60 | Ga0075434_100318124 | 3300006871 | Bacteria | 1577 |
| 61 | Ga0075434_102110335 | 3300006871 | Bacteria | 568 |
| 62 | Ga0075435_100511250 | 3300007076 | Unclassified | 1039 |
| 63 | Ga0105247_10141587 | 3300009101 | Bacteria | 1576 |
| 64 | Ga0114129_10034563 | 3300009147 | Bacteria | 7141 |
| 65 | Ga0114129_10050700 | 3300009147 | Bacteria | 5829 |
| 66 | Ga0114129_10297070 | 3300009147 | Bacteria | 2154 |
| 67 | Ga0105243_10055234 | 3300009148 | Bacteria | 3155 |
| 68 | Ga0105242_10530561 | 3300009176 | Bacteria | 1125 |
| 69 | Ga0105242_11596455 | 3300009176 | Bacteria | 686 |
| 70 | Ga0105248_10012641 | 3300009177 | Bacteria | 9315 |
| 71 | Ga0105249_10050369 | 3300009553 | Bacteria | 3797 |
| 72 | Ga0157378_10182131 | 3300013297 | Bacteria | 1977 |
| 73 | Ga0157378_11588317 | 3300013297 | Bacteria | 700 |
| 74 | Ga0157378_13319460 | 3300013297 | Bacteria | 500 |
| 75 | Ga0163162_10199388 | 3300013306 | Bacteria | 2130 |
| 76 | Ga0157375_10197727 | 3300013308 | Bacteria | 2166 |
| 77 | Ga0157375_10374983 | 3300013308 | Bacteria | 1589 |
| 78 | Ga0157380_10086566 | 3300014326 | Bacteria | 2575 |
| 79 | Ga0157379_10321508 | 3300014968 | Bacteria | 1413 |
| 80 | Ga0213873_10007201 | 3300021358 | Bacteria | 2219 |
| 81 | Ga0213873_10008690 | 3300021358 | Bacteria | 2084 |
| 82 | Ga0213873_10136830 | 3300021358 | Bacteria | 729 |
| 83 | Ga0213872_10016090 | 3300021361 | Bacteria | 3473 |
| 84 | Ga0213872_10025692 | 3300021361 | Bacteria | 2706 |
| 85 | Ga0213872_10048825 | 3300021361 | Bacteria | 1923 |
| 86 | Ga0213872_10057856 | 3300021361 | Bacteria | 1755 |
| 87 | Ga0213872_10244420 | 3300021361 | Unclassified | 758 |
| 88 | Ga0213875_10081008 | 3300021388 | Unclassified | 1515 |
| 89 | Ga0213871_10003675 | 3300021441 | Bacteria | 2989 |
| 90 | Ga0213871_10013882 | 3300021441 | Bacteria | 1901 |
| 91 | Ga0213871_10224357 | 3300021441 | Bacteria | 591 |
| 92 | Ga0207710_10187419 | 3300025900 | Bacteria | 1017 |
| 93 | Ga0207680_10182509 | 3300025903 | Bacteria | 1420 |
| 94 | Ga0207685_10631342 | 3300025905 | Bacteria | 577 |
| 95 | Ga0207699_10043019 | 3300025906 | Unclassified | 2622 |
| 96 | Ga0207645_10407152 | 3300025907 | Bacteria | 915 |
| 97 | Ga0207684_10411628 | 3300025910 | Bacteria | 1162 |
| 98 | Ga0207693_10151737 | 3300025915 | Bacteria | 1822 |
| 99 | Ga0207646_11270447 | 3300025922 | Unclassified | 644 |
| 100 | Ga0207646_11394089 | 3300025922 | Bacteria | 610 |
| 101 | Ga0207681_10236789 | 3300025923 | Bacteria | 1419 |
| 102 | Ga0207650_10072459 | 3300025925 | Unclassified | 2593 |
| 103 | Ga0207700_10445298 | 3300025928 | Bacteria | 1141 |
| 104 | Ga0207664_10240382 | 3300025929 | Bacteria | 1577 |
| 105 | Ga0207664_10265998 | 3300025929 | Bacteria | 1501 |
| 106 | Ga0207686_10553790 | 3300025934 | Bacteria | 899 |
| 107 | Ga0207670_10066894 | 3300025936 | Bacteria | 2470 |
| 108 | Ga0207669_10104637 | 3300025937 | Bacteria | 1881 |
| 109 | Ga0207665_10882071 | 3300025939 | Unclassified | 709 |
| 110 | Ga0207691_10256613 | 3300025940 | Bacteria | 1508 |
| 111 | Ga0207712_10482804 | 3300025961 | Bacteria | 1057 |
| 112 | Ga0207640_10625670 | 3300025981 | Bacteria | 914 |
| 113 | Ga0207658_10365636 | 3300025986 | Bacteria | 1260 |
| 114 | Ga0207678_10769070 | 3300026067 | Unclassified | 850 |
| 115 | Ga0207708_10296925 | 3300026075 | Bacteria | 1313 |
| 116 | Ga0207641_10930553 | 3300026088 | Unclassified | 864 |
| 117 | Ga0207648_10049801 | 3300026089 | Bacteria | 3664 |
| 118 | Ga0207648_10089797 | 3300026089 | Bacteria | 2685 |
| 119 | Ga0207676_11597821 | 3300026095 | Bacteria | 650 |
| 120 | Ga0207675_100082020 | 3300026118 | Bacteria | 3024 |
| 121 | Ga0207675_101968284 | 3300026118 | Bacteria | 602 |
| 122 | Ga0268265_11250097 | 3300028380 | Bacteria | 741 |
| 123 | Ga0268264_10748106 | 3300028381 | Bacteria | 974 |
| 124 | Ga0316182_1345904 | 3300030745 | Bacteria | 1755 |
| 125 | Ga0265330_10003169 | 3300031235 | Bacteria | 8696 |
| 126 | Ga0265327_10006483 | 3300031251 | Bacteria | 9343 |
| 127 | Ga0265316_10035005 | 3300031344 | Unclassified | 4075 |
| 128 | Ga0316579_10176082 | 3300031691 | Bacteria | 1034 |
| 129 | Ga0265342_10081495 | 3300031712 | Unclassified | 1868 |
| 130 | Ga0316576_10016571 | 3300031727 | Bacteria | 4983 |
| 131 | Ga0316583_10021544 | 3300032133 | Bacteria | 2310 |
| 132 | Ga0316593_10034913 | 3300032168 | Bacteria | 1652 |
| 133 | Ga0373934_0220178 | 3300035086 | Bacteria | 783 |
| 134 | Ga0373923_0064594 | 3300035111 | Unclassified | 1561 |
| 135 | Ga0373953_0014109 | 3300035117 | Bacteria | 2867 |
| 136 | Ga0373954_0007787 | 3300035118 | Bacteria | 4690 |
| 137 | Ga0373956_0002608 | 3300035119 | Bacteria | 7310 |
| 138 | Ga0373943_0812494 | 3300035170 | Bacteria | 557 |
| 139 | Ga0373955_0087002 | 3300035172 | Bacteria | 1775 |
| 140 | Ga0316574_0057866 | 3300035398 | Bacteria | 2428 |
| 141 | Ga0373933_0075449 | 3300035724 | Unclassified | 2058 |
| 142 | Ga0316582_0024092 | 3300036647 | Bacteria | 3638 |
| 143 | Ga0316582_0054014 | 3300036647 | Bacteria | 2556 |
| 144 | Ga0373925_0150939 | 3300037068 | Bacteria | 1825 |
| 145 | Ga0436364_0220468 | 3300037853 | Bacteria | 1133 |
| 146 | Ga0436364_0735347 | 3300037853 | Unclassified | 1038 |
| 147 | Ga0436364_1544936 | 3300037853 | Bacteria | 2175 |
| 148 | Ga0436365_0121356 | 3300039437 | Bacteria | 1577 |
| 149 | Ga0436365_1046022 | 3300039437 | Bacteria | 4676 |
| 150 | Ga0436360_0435607 | 3300039438 | Bacteria | 3498 |
| 151 | Ga0436360_1001631 | 3300039438 | Bacteria | 2687 |
| 152 | Ga0436360_1145256 | 3300039438 | Bacteria | 1785 |
| 153 | Ga0436360_1283839 | 3300039438 | Bacteria | 3030 |
| 154 | Ga0436360_1344517 | 3300039438 | Bacteria | 1775 |
| 155 | Ga0436361_0084085 | 3300039447 | Bacteria | 2779 |
| 156 | Ga0436361_0111052 | 3300039447 | Bacteria | 2810 |
| 157 | Ga0436361_0360478 | 3300039447 | Bacteria | 2580 |
| 158 | Ga0436361_0832009 | 3300039447 | Bacteria | 2046 |
| 159 | Ga0436361_0917364 | 3300039447 | Unclassified | 3539 |
| 160 | Ga0436363_0246847 | 3300039450 | Bacteria | 4435 |
| 161 | Ga0436363_1346061 | 3300039450 | Unclassified | 1648 |
| 162 | Ga0436362_0134258 | 3300039453 | Bacteria | 3565 |
| 163 | Ga0436362_0499418 | 3300039453 | Bacteria | 2689 |
| 164 | Ga0436362_0530764 | 3300039453 | Bacteria | 747 |
| 165 | Ga0436362_0869820 | 3300039453 | Bacteria | 1405 |
| 166 | Ga0436362_1296339 | 3300039453 | Bacteria | 1290 |
| 167 | Ga0439465_0028158 | 3300041413 | Bacteria | 1781 |
| 168 | Ga0451837_0826166 | 3300041494 | Bacteria | 3111 |
| 169 | Ga0466969_0023892 | 3300044656 | Bacteria | 3146 |
| 170 | Ga0466972_0027019 | 3300044658 | Bacteria | 2841 |
| 171 | Ga0466982_0000007 | 3300044672 | Bacteria | 250854 |
| 172 | Ga0466966_0006305 | 3300044684 | Bacteria | 7846 |
| 173 | Ga0466964_0004034 | 3300044706 | Bacteria | 5397 |
| 174 | Ga0453684_0608580 | 3300044712 | Unclassified | 1197 |
| 175 | Ga0466968_0000902 | 3300044735 | Bacteria | 10457 |
| 176 | Ga0466970_0035220 | 3300044765 | Bacteria | 2652 |
| 177 | Ga0466960_0021962 | 3300044901 | Bacteria | 2847 |
| 178 | Ga0451576_0227836 | 3300045051 | Bacteria | 1946 |
| 179 | Ga0466958_0161424 | 3300045836 | Bacteria | 1416 |
| 180 | Ga0495628_1115443 | 3300046516 | Bacteria | 538 |
| 181 | Ga0495643_0000359 | 3300046522 | Bacteria | 62167 |
| 182 | Ga0495643_0004670 | 3300046522 | Bacteria | 9512 |
| 183 | Ga0495642_0001995 | 3300046528 | Bacteria | 8543 |
| 184 | Ga0495640_0297121 | 3300046533 | Bacteria | 1004 |
| 185 | Ga0495597_0009756 | 3300046542 | Bacteria | 4728 |
| 186 | Ga0495645_0190571 | 3300046543 | Bacteria | 1398 |
| 187 | Ga0495668_0046843 | 3300046616 | Bacteria | 2402 |
| 188 | Ga0495634_0029406 | 3300046642 | Bacteria | 3804 |
| 189 | Ga0495661_0005406 | 3300046665 | Bacteria | 9083 |
| 190 | Ga0495599_0199401 | 3300046678 | Bacteria | 1230 |
| 191 | Ga0495647_0023649 | 3300046681 | Bacteria | 2230 |
| 192 | Ga0495658_0159836 | 3300046683 | Bacteria | 1389 |
| 193 | Ga0495658_0369322 | 3300046683 | Unclassified | 913 |
| 194 | Ga0495581_0789610 | 3300047315 | Bacteria | 545 |
| 195 | Ga0495604_0274591 | 3300047317 | Bacteria | 1141 |
| 196 | Ga0495676_0260385 | 3300047321 | Bacteria | 1180 |
| 197 | Ga0495687_008722 | 3300047443 | Bacteria | 5758 |
| 198 | Ga0495686_0132032 | 3300047472 | Bacteria | 1480 |
| 199 | Ga0496102_0117248 | 3300048905 | Bacteria | 2485 |
| 200 | Ga0496107_0963051 | 3300048910 | Bacteria | 620 |
| 201 | Ga0496112_1100029 | 3300048915 | Unclassified | 713 |
| 202 | Ga0496115_0604348 | 3300048918 | Bacteria | 872 |
| 203 | Ga0496117_0002696 | 3300048920 | Bacteria | 21946 |
| 204 | Ga0496118_0002064 | 3300048921 | Bacteria | 28295 |
| 205 | Ga0496126_0000164 | 3300048929 | Bacteria | 152791 |
| 206 | Ga0501034_0429036 | 3300049571 | Unclassified | 1242 |
| 207 | Ga0501036_0105300 | 3300049572 | Bacteria | 2386 |
| 208 | Ga0501038_0248793 | 3300049574 | Bacteria | 1409 |
| 209 | Ga0501039_0680803 | 3300049575 | Bacteria | 805 |
| 210 | Ga0501041_0065689 | 3300049577 | Bacteria | 2223 |
| 211 | Ga0501041_0084789 | 3300049577 | Bacteria | 1953 |
| 212 | Ga0501042_0741701 | 3300049578 | Bacteria | 714 |
| 213 | Ga0501042_0873469 | 3300049578 | Bacteria | 655 |
| 214 | Ga0501046_0701204 | 3300049580 | Bacteria | 713 |
| 215 | Ga0501048_0403174 | 3300049582 | Bacteria | 978 |
| 216 | Ga0501071_0507093 | 3300049587 | Bacteria | 926 |
| 217 | Ga0501075_0009480 | 3300049591 | Bacteria | 6814 |
| 218 | Ga0501076_0046055 | 3300049592 | Bacteria | 3445 |
| 219 | Ga0501076_0430673 | 3300049592 | Bacteria | 1086 |
| 220 | Ga0501079_0046343 | 3300049741 | Bacteria | 3355 |
| 221 | Ga0501079_0083266 | 3300049741 | Unclassified | 2475 |
| 222 | Ga0501081_0062584 | 3300049743 | Bacteria | 2581 |
| 223 | Ga0501081_0211237 | 3300049743 | Bacteria | 1409 |
| 224 | Ga0501045_0481541 | 3300049824 | Bacteria | 922 |
| 225 | nmdc:mga05p37_176698_c1 | 3300050507 | Bacteria | 2601 |
| 226 | nmdc:mga05p37_27944_c2 | 3300050507 | Bacteria | 5840 |
| 227 | nmdc:mga05p37_81886_c1 | 3300050507 | Bacteria | 3976 |
| 228 | nmdc:mga0n895_623470_c1 | 3300050512 | Bacteria | 1079 |
| 229 | nmdc:mga0a205_904050_c1 | 3300050515 | Unclassified | 730 |
| 230 | Ga0495601_0076379 | 3300053077 | Bacteria | 2145 |
| 231 | Ga0495619_0178316 | 3300053085 | Bacteria | 1470 |
| 232 | Ga0495619_0441742 | 3300053085 | Bacteria | 897 |
| 233 | Ga0500645_007544 | 3300053730 | Bacteria | 3778 |
| 234 | Ga0466962_0002611 | 3300061719 | Bacteria | 8565 |
| 235 | Ga0530510_0683203 | 3300061734 | Bacteria | 782 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026088 | Ga0207641_10930553 | Ga0207641_109305532 | 114 |
| 2 | 3300006871 | Ga0075434_100318124 | Ga0075434_1003181242 | 140 |
| 3 | 3300030745 | Ga0316182_1345904 | Ga0316182_13459041 | 140 |
| 4 | 3300031251 | Ga0265327_10006483 | Ga0265327_100064836 | 140 |
| 5 | 3300041494 | Ga0451837_0826166 | Ga0451837_0826166_2081_2512 | 140 |
| 6 | 3300047315 | Ga0495581_0789610 | Ga0495581_0789610_47_478 | 140 |
| 7 | 3300048910 | Ga0496107_0963051 | Ga0496107_0963051_44_472 | 140 |
| 8 | 3300050512 | nmdc:mga0n895_623470_c1 | nmdc:mga0n895_623470_c1_584_1012 | 140 |
| 9 | 3300032168 | Ga0316593_10034913 | Ga0316593_100349133 | 141 |
| 10 | 3300044656 | Ga0466969_0023892 | Ga0466969_0023892_699_1130 | 141 |
| 11 | 3300044658 | Ga0466972_0027019 | Ga0466972_0027019_2053_2484 | 141 |
| 12 | 3300044672 | Ga0466982_0000007 | Ga0466982_0000007_164402_164833 | 141 |
| 13 | 3300044684 | Ga0466966_0006305 | Ga0466966_0006305_2236_2667 | 141 |
| 14 | 3300044706 | Ga0466964_0004034 | Ga0466964_0004034_1157_1588 | 141 |
| 15 | 3300044735 | Ga0466968_0000902 | Ga0466968_0000902_267_698 | 141 |
| 16 | 3300044765 | Ga0466970_0035220 | Ga0466970_0035220_2051_2482 | 141 |
| 17 | 3300044901 | Ga0466960_0021962 | Ga0466960_0021962_1815_2246 | 141 |
| 18 | 3300045836 | Ga0466958_0161424 | Ga0466958_0161424_725_1156 | 141 |
| 19 | 3300061719 | Ga0466962_0002611 | Ga0466962_0002611_4041_4472 | 141 |
| 20 | 3300031235 | Ga0265330_10003169 | Ga0265330_100031694 | 142 |
| 21 | 3300031344 | Ga0265316_10035005 | Ga0265316_100350052 | 142 |
| 22 | 3300031712 | Ga0265342_10081495 | Ga0265342_100814952 | 142 |
| 23 | 3300032133 | Ga0316583_10021544 | Ga0316583_100215443 | 142 |
| 24 | 3300035398 | Ga0316574_0057866 | Ga0316574_0057866_1933_2367 | 142 |
| 25 | 3300036647 | Ga0316582_0054014 | Ga0316582_0054014_1138_1572 | 142 |
| 26 | 3300041413 | Ga0439465_0028158 | Ga0439465_0028158_713_1147 | 142 |
| 27 | 3300048905 | Ga0496102_0117248 | Ga0496102_0117248_606_1040 | 142 |
| 28 | 3300025905 | Ga0207685_10631342 | Ga0207685_106313421 | 143 |
| 29 | 3300031691 | Ga0316579_10176082 | Ga0316579_101760821 | 143 |
| 30 | 3300031727 | Ga0316576_10016571 | Ga0316576_100165713 | 143 |
| 31 | 3300036647 | Ga0316582_0024092 | Ga0316582_0024092_1865_2302 | 143 |
| 32 | 3300046522 | Ga0495643_0004670 | Ga0495643_0004670_4109_4549 | 143 |
| 33 | 3300046528 | Ga0495642_0001995 | Ga0495642_0001995_992_1432 | 143 |
| 34 | 3300046542 | Ga0495597_0009756 | Ga0495597_0009756_1966_2406 | 143 |
| 35 | 3300046616 | Ga0495668_0046843 | Ga0495668_0046843_1196_1636 | 143 |
| 36 | 3300046665 | Ga0495661_0005406 | Ga0495661_0005406_4548_4988 | 143 |
| 37 | 3300046683 | Ga0495658_0159836 | Ga0495658_0159836_804_1244 | 143 |
| 38 | 3300046683 | Ga0495658_0369322 | Ga0495658_0369322_405_845 | 143 |
| 39 | 3300047321 | Ga0495676_0260385 | Ga0495676_0260385_512_952 | 143 |
| 40 | 3300047443 | Ga0495687_008722 | Ga0495687_008722_2303_2743 | 143 |
| 41 | 3300053085 | Ga0495619_0441742 | Ga0495619_0441742_73_513 | 143 |
| 42 | 3300046522 | Ga0495643_0000359 | Ga0495643_0000359_19908_20348 | 144 |
| 43 | 3300047472 | Ga0495686_0132032 | Ga0495686_0132032_737_1246 | 144 |
| 44 | 3300048920 | Ga0496117_0002696 | Ga0496117_0002696_8189_8677 | 144 |
| 45 | 3300048921 | Ga0496118_0002064 | Ga0496118_0002064_619_1107 | 144 |
| 46 | 3300048929 | Ga0496126_0000164 | Ga0496126_0000164_59550_60038 | 144 |
| 47 | 3300005333 | Ga0070677_10172752 | Ga0070677_101727522 | 145 |
| 48 | 3300005347 | Ga0070668_101100382 | Ga0070668_1011003822 | 145 |
| 49 | 3300005456 | Ga0070678_100589735 | Ga0070678_1005897352 | 145 |
| 50 | 3300006852 | Ga0075433_10819537 | Ga0075433_108195372 | 145 |
| 51 | 3300007076 | Ga0075435_100511250 | Ga0075435_1005112501 | 145 |
| 52 | 3300009147 | Ga0114129_10034563 | Ga0114129_100345634 | 145 |
| 53 | 3300013308 | Ga0157375_10197727 | Ga0157375_101977272 | 145 |
| 54 | 3300021358 | Ga0213873_10007201 | Ga0213873_100072012 | 145 |
| 55 | 3300021361 | Ga0213872_10016090 | Ga0213872_100160902 | 145 |
| 56 | 3300025937 | Ga0207669_10104637 | Ga0207669_101046373 | 145 |
| 57 | 3300026067 | Ga0207678_10769070 | Ga0207678_107690702 | 145 |
| 58 | 3300037853 | Ga0436364_0735347 | Ga0436364_0735347_346_807 | 145 |
| 59 | 3300039438 | Ga0436360_1344517 | Ga0436360_1344517_58_501 | 145 |
| 60 | 3300039447 | Ga0436361_0360478 | Ga0436361_0360478_2122_2565 | 145 |
| 61 | 3300039450 | Ga0436363_0246847 | Ga0436363_0246847_3356_3802 | 145 |
| 62 | 3300039453 | Ga0436362_0134258 | Ga0436362_0134258_876_1319 | 145 |
| 63 | 3300049571 | Ga0501034_0429036 | Ga0501034_0429036_69_512 | 145 |
| 64 | 3300050507 | nmdc:mga05p37_81886_c1 | nmdc:mga05p37_81886_c1_147_590 | 145 |
| 65 | 3300050515 | nmdc:mga0a205_904050_c1 | nmdc:mga0a205_904050_c1_277_720 | 145 |
| 66 | 3300061734 | Ga0530510_0683203 | Ga0530510_0683203_277_756 | 145 |
| 67 | 3300035086 | Ga0373934_0220178 | Ga0373934_0220178_182_622 | 146 |
| 68 | 3300035111 | Ga0373923_0064594 | Ga0373923_0064594_478_918 | 146 |
| 69 | 3300035117 | Ga0373953_0014109 | Ga0373953_0014109_2111_2551 | 146 |
| 70 | 3300035118 | Ga0373954_0007787 | Ga0373954_0007787_3859_4299 | 146 |
| 71 | 3300035119 | Ga0373956_0002608 | Ga0373956_0002608_2795_3235 | 146 |
| 72 | 3300035172 | Ga0373955_0087002 | Ga0373955_0087002_1180_1620 | 146 |
| 73 | 3300035724 | Ga0373933_0075449 | Ga0373933_0075449_608_1048 | 146 |
| 74 | 3300046681 | Ga0495647_0023649 | Ga0495647_0023649_1733_2173 | 146 |
| 75 | 3300005289 | Ga0065704_10219847 | Ga0065704_102198472 | 147 |
| 76 | 3300005295 | Ga0065707_10248267 | Ga0065707_102482671 | 147 |
| 77 | 3300005295 | Ga0065707_10349503 | Ga0065707_103495031 | 147 |
| 78 | 3300005295 | Ga0065707_10415509 | Ga0065707_104155092 | 147 |
| 79 | 3300005328 | Ga0070676_10420623 | Ga0070676_104206231 | 147 |
| 80 | 3300005330 | Ga0070690_100384670 | Ga0070690_1003846701 | 147 |
| 81 | 3300005333 | Ga0070677_10242259 | Ga0070677_102422591 | 147 |
| 82 | 3300005335 | Ga0070666_10302024 | Ga0070666_103020241 | 147 |
| 83 | 3300005340 | Ga0070689_100072491 | Ga0070689_1000724912 | 147 |
| 84 | 3300005347 | Ga0070668_100116971 | Ga0070668_1001169712 | 147 |
| 85 | 3300005354 | Ga0070675_100686641 | Ga0070675_1006866411 | 147 |
| 86 | 3300005356 | Ga0070674_100002286 | Ga0070674_1000022864 | 147 |
| 87 | 3300005356 | Ga0070674_100361987 | Ga0070674_1003619871 | 147 |
| 88 | 3300005366 | Ga0070659_100716203 | Ga0070659_1007162032 | 147 |
| 89 | 3300005434 | Ga0070709_10197740 | Ga0070709_101977403 | 147 |
| 90 | 3300005436 | Ga0070713_100004684 | Ga0070713_1000046847 | 147 |
| 91 | 3300005436 | Ga0070713_100241039 | Ga0070713_1002410392 | 147 |
| 92 | 3300005436 | Ga0070713_101626631 | Ga0070713_1016266311 | 147 |
| 93 | 3300005437 | Ga0070710_10300057 | Ga0070710_103000572 | 147 |
| 94 | 3300005437 | Ga0070710_10846917 | Ga0070710_108469171 | 147 |
| 95 | 3300005437 | Ga0070710_10865512 | Ga0070710_108655121 | 147 |
| 96 | 3300005437 | Ga0070710_11248209 | Ga0070710_112482091 | 147 |
| 97 | 3300005438 | Ga0070701_10138749 | Ga0070701_101387491 | 147 |
| 98 | 3300005441 | Ga0070700_100159169 | Ga0070700_1001591692 | 147 |
| 99 | 3300005445 | Ga0070708_100843367 | Ga0070708_1008433672 | 147 |
| 100 | 3300005445 | Ga0070708_101873450 | Ga0070708_1018734501 | 147 |
| 101 | 3300005456 | Ga0070678_101083216 | Ga0070678_1010832161 | 147 |
| 102 | 3300005459 | Ga0068867_100134413 | Ga0068867_1001344132 | 147 |
| 103 | 3300005466 | Ga0070685_10130149 | Ga0070685_101301491 | 147 |
| 104 | 3300005467 | Ga0070706_100226938 | Ga0070706_1002269381 | 147 |
| 105 | 3300005471 | Ga0070698_100013579 | Ga0070698_1000135797 | 147 |
| 106 | 3300005471 | Ga0070698_101506572 | Ga0070698_1015065721 | 147 |
| 107 | 3300005518 | Ga0070699_100370269 | Ga0070699_1003702693 | 147 |
| 108 | 3300005518 | Ga0070699_100454436 | Ga0070699_1004544361 | 147 |
| 109 | 3300005536 | Ga0070697_100012337 | Ga0070697_1000123374 | 147 |
| 110 | 3300005536 | Ga0070697_100482349 | Ga0070697_1004823491 | 147 |
| 111 | 3300005536 | Ga0070697_101244178 | Ga0070697_1012441781 | 147 |
| 112 | 3300005543 | Ga0070672_100243377 | Ga0070672_1002433772 | 147 |
| 113 | 3300005545 | Ga0070695_100346273 | Ga0070695_1003462732 | 147 |
| 114 | 3300005545 | Ga0070695_101172021 | Ga0070695_1011720211 | 147 |
| 115 | 3300005546 | Ga0070696_100347478 | Ga0070696_1003474782 | 147 |
| 116 | 3300005546 | Ga0070696_100514094 | Ga0070696_1005140942 | 147 |
| 117 | 3300005549 | Ga0070704_100144584 | Ga0070704_1001445842 | 147 |
| 118 | 3300005718 | Ga0068866_10183682 | Ga0068866_101836822 | 147 |
| 119 | 3300005719 | Ga0068861_100143762 | Ga0068861_1001437623 | 147 |
| 120 | 3300005842 | Ga0068858_100006101 | Ga0068858_1000061016 | 147 |
| 121 | 3300005842 | Ga0068858_100233339 | Ga0068858_1002333393 | 147 |
| 122 | 3300005844 | Ga0068862_100033122 | Ga0068862_1000331222 | 147 |
| 123 | 3300005844 | Ga0068862_101346419 | Ga0068862_1013464192 | 147 |
| 124 | 3300005844 | Ga0068862_101947908 | Ga0068862_1019479081 | 147 |
| 125 | 3300006028 | Ga0070717_10097646 | Ga0070717_100976462 | 147 |
| 126 | 3300006028 | Ga0070717_10212411 | Ga0070717_102124112 | 147 |
| 127 | 3300006163 | Ga0070715_10105680 | Ga0070715_101056801 | 147 |
| 128 | 3300006163 | Ga0070715_10809678 | Ga0070715_108096781 | 147 |
| 129 | 3300006844 | Ga0075428_100247972 | Ga0075428_1002479722 | 147 |
| 130 | 3300006871 | Ga0075434_102110335 | Ga0075434_1021103351 | 147 |
| 131 | 3300009101 | Ga0105247_10141587 | Ga0105247_101415874 | 147 |
| 132 | 3300009147 | Ga0114129_10050700 | Ga0114129_100507003 | 147 |
| 133 | 3300009147 | Ga0114129_10297070 | Ga0114129_102970702 | 147 |
| 134 | 3300009148 | Ga0105243_10055234 | Ga0105243_100552342 | 147 |
| 135 | 3300009176 | Ga0105242_10530561 | Ga0105242_105305612 | 147 |
| 136 | 3300009176 | Ga0105242_11596455 | Ga0105242_115964551 | 147 |
| 137 | 3300009177 | Ga0105248_10012641 | Ga0105248_100126416 | 147 |
| 138 | 3300009553 | Ga0105249_10050369 | Ga0105249_100503692 | 147 |
| 139 | 3300013297 | Ga0157378_10182131 | Ga0157378_101821312 | 147 |
| 140 | 3300013297 | Ga0157378_11588317 | Ga0157378_115883171 | 147 |
| 141 | 3300013297 | Ga0157378_13319460 | Ga0157378_133194601 | 147 |
| 142 | 3300013306 | Ga0163162_10199388 | Ga0163162_101993881 | 147 |
| 143 | 3300013308 | Ga0157375_10374983 | Ga0157375_103749832 | 147 |
| 144 | 3300014326 | Ga0157380_10086566 | Ga0157380_100865663 | 147 |
| 145 | 3300014968 | Ga0157379_10321508 | Ga0157379_103215082 | 147 |
| 146 | 3300021358 | Ga0213873_10008690 | Ga0213873_100086903 | 147 |
| 147 | 3300021358 | Ga0213873_10136830 | Ga0213873_101368301 | 147 |
| 148 | 3300021361 | Ga0213872_10025692 | Ga0213872_100256921 | 147 |
| 149 | 3300021361 | Ga0213872_10048825 | Ga0213872_100488253 | 147 |
| 150 | 3300021361 | Ga0213872_10057856 | Ga0213872_100578562 | 147 |
| 151 | 3300021361 | Ga0213872_10244420 | Ga0213872_102444201 | 147 |
| 152 | 3300021388 | Ga0213875_10081008 | Ga0213875_100810082 | 147 |
| 153 | 3300021441 | Ga0213871_10003675 | Ga0213871_100036754 | 147 |
| 154 | 3300021441 | Ga0213871_10013882 | Ga0213871_100138822 | 147 |
| 155 | 3300021441 | Ga0213871_10224357 | Ga0213871_102243571 | 147 |
| 156 | 3300025900 | Ga0207710_10187419 | Ga0207710_101874192 | 147 |
| 157 | 3300025903 | Ga0207680_10182509 | Ga0207680_101825092 | 147 |
| 158 | 3300025906 | Ga0207699_10043019 | Ga0207699_100430193 | 147 |
| 159 | 3300025907 | Ga0207645_10407152 | Ga0207645_104071521 | 147 |
| 160 | 3300025910 | Ga0207684_10411628 | Ga0207684_104116282 | 147 |
| 161 | 3300025915 | Ga0207693_10151737 | Ga0207693_101517372 | 147 |
| 162 | 3300025922 | Ga0207646_11270447 | Ga0207646_112704471 | 147 |
| 163 | 3300025922 | Ga0207646_11394089 | Ga0207646_113940891 | 147 |
| 164 | 3300025923 | Ga0207681_10236789 | Ga0207681_102367892 | 147 |
| 165 | 3300025925 | Ga0207650_10072459 | Ga0207650_100724594 | 147 |
| 166 | 3300025928 | Ga0207700_10445298 | Ga0207700_104452982 | 147 |
| 167 | 3300025929 | Ga0207664_10240382 | Ga0207664_102403822 | 147 |
| 168 | 3300025929 | Ga0207664_10265998 | Ga0207664_102659982 | 147 |
| 169 | 3300025934 | Ga0207686_10553790 | Ga0207686_105537901 | 147 |
| 170 | 3300025936 | Ga0207670_10066894 | Ga0207670_100668943 | 147 |
| 171 | 3300025939 | Ga0207665_10882071 | Ga0207665_108820712 | 147 |
| 172 | 3300025940 | Ga0207691_10256613 | Ga0207691_102566133 | 147 |
| 173 | 3300025961 | Ga0207712_10482804 | Ga0207712_104828042 | 147 |
| 174 | 3300025981 | Ga0207640_10625670 | Ga0207640_106256701 | 147 |
| 175 | 3300025986 | Ga0207658_10365636 | Ga0207658_103656361 | 147 |
| 176 | 3300026075 | Ga0207708_10296925 | Ga0207708_102969252 | 147 |
| 177 | 3300026089 | Ga0207648_10049801 | Ga0207648_100498013 | 147 |
| 178 | 3300026089 | Ga0207648_10089797 | Ga0207648_100897973 | 147 |
| 179 | 3300026095 | Ga0207676_11597821 | Ga0207676_115978212 | 147 |
| 180 | 3300026118 | Ga0207675_100082020 | Ga0207675_1000820202 | 147 |
| 181 | 3300026118 | Ga0207675_101968284 | Ga0207675_1019682841 | 147 |
| 182 | 3300028380 | Ga0268265_11250097 | Ga0268265_112500972 | 147 |
| 183 | 3300028381 | Ga0268264_10748106 | Ga0268264_107481061 | 147 |
| 184 | 3300035170 | Ga0373943_0812494 | Ga0373943_0812494_67_510 | 147 |
| 185 | 3300037068 | Ga0373925_0150939 | Ga0373925_0150939_585_1028 | 147 |
| 186 | 3300037853 | Ga0436364_0220468 | Ga0436364_0220468_455_910 | 147 |
| 187 | 3300037853 | Ga0436364_1544936 | Ga0436364_1544936_650_1099 | 147 |
| 188 | 3300039437 | Ga0436365_0121356 | Ga0436365_0121356_88_537 | 147 |
| 189 | 3300039437 | Ga0436365_1046022 | Ga0436365_1046022_1593_2042 | 147 |
| 190 | 3300039438 | Ga0436360_0435607 | Ga0436360_0435607_2073_2600 | 147 |
| 191 | 3300039438 | Ga0436360_1001631 | Ga0436360_1001631_1434_1883 | 147 |
| 192 | 3300039438 | Ga0436360_1145256 | Ga0436360_1145256_222_671 | 147 |
| 193 | 3300039438 | Ga0436360_1283839 | Ga0436360_1283839_86_535 | 147 |
| 194 | 3300039447 | Ga0436361_0084085 | Ga0436361_0084085_449_898 | 147 |
| 195 | 3300039447 | Ga0436361_0111052 | Ga0436361_0111052_1954_2403 | 147 |
| 196 | 3300039447 | Ga0436361_0832009 | Ga0436361_0832009_152_601 | 147 |
| 197 | 3300039447 | Ga0436361_0917364 | Ga0436361_0917364_2449_2973 | 147 |
| 198 | 3300039450 | Ga0436363_1346061 | Ga0436363_1346061_704_1153 | 147 |
| 199 | 3300039453 | Ga0436362_0499418 | Ga0436362_0499418_2109_2558 | 147 |
| 200 | 3300039453 | Ga0436362_0530764 | Ga0436362_0530764_265_714 | 147 |
| 201 | 3300039453 | Ga0436362_0869820 | Ga0436362_0869820_561_1010 | 147 |
| 202 | 3300039453 | Ga0436362_1296339 | Ga0436362_1296339_260_709 | 147 |
| 203 | 3300044712 | Ga0453684_0608580 | Ga0453684_0608580_371_841 | 147 |
| 204 | 3300045051 | Ga0451576_0227836 | Ga0451576_0227836_1208_1657 | 147 |
| 205 | 3300046516 | Ga0495628_1115443 | Ga0495628_1115443_47_523 | 147 |
| 206 | 3300046533 | Ga0495640_0297121 | Ga0495640_0297121_432_875 | 147 |
| 207 | 3300046543 | Ga0495645_0190571 | Ga0495645_0190571_14_490 | 147 |
| 208 | 3300046642 | Ga0495634_0029406 | Ga0495634_0029406_3195_3638 | 147 |
| 209 | 3300046678 | Ga0495599_0199401 | Ga0495599_0199401_407_883 | 147 |
| 210 | 3300047317 | Ga0495604_0274591 | Ga0495604_0274591_14_490 | 147 |
| 211 | 3300048915 | Ga0496112_1100029 | Ga0496112_1100029_180_629 | 147 |
| 212 | 3300048918 | Ga0496115_0604348 | Ga0496115_0604348_100_549 | 147 |
| 213 | 3300049572 | Ga0501036_0105300 | Ga0501036_0105300_447_896 | 147 |
| 214 | 3300049574 | Ga0501038_0248793 | Ga0501038_0248793_482_931 | 147 |
| 215 | 3300049575 | Ga0501039_0680803 | Ga0501039_0680803_188_637 | 147 |
| 216 | 3300049577 | Ga0501041_0065689 | Ga0501041_0065689_1539_1988 | 147 |
| 217 | 3300049577 | Ga0501041_0084789 | Ga0501041_0084789_1253_1702 | 147 |
| 218 | 3300049578 | Ga0501042_0741701 | Ga0501042_0741701_182_631 | 147 |
| 219 | 3300049578 | Ga0501042_0873469 | Ga0501042_0873469_76_570 | 147 |
| 220 | 3300049580 | Ga0501046_0701204 | Ga0501046_0701204_121_570 | 147 |
| 221 | 3300049582 | Ga0501048_0403174 | Ga0501048_0403174_451_900 | 147 |
| 222 | 3300049587 | Ga0501071_0507093 | Ga0501071_0507093_44_493 | 147 |
| 223 | 3300049591 | Ga0501075_0009480 | Ga0501075_0009480_2321_2770 | 147 |
| 224 | 3300049592 | Ga0501076_0046055 | Ga0501076_0046055_1036_1485 | 147 |
| 225 | 3300049592 | Ga0501076_0430673 | Ga0501076_0430673_523_984 | 147 |
| 226 | 3300049741 | Ga0501079_0046343 | Ga0501079_0046343_1690_2139 | 147 |
| 227 | 3300049741 | Ga0501079_0083266 | Ga0501079_0083266_1918_2379 | 147 |
| 228 | 3300049743 | Ga0501081_0062584 | Ga0501081_0062584_754_1215 | 147 |
| 229 | 3300049743 | Ga0501081_0211237 | Ga0501081_0211237_905_1354 | 147 |
| 230 | 3300049824 | Ga0501045_0481541 | Ga0501045_0481541_392_841 | 147 |
| 231 | 3300050507 | nmdc:mga05p37_176698_c1 | nmdc:mga05p37_176698_c1_1398_1841 | 147 |
| 232 | 3300050507 | nmdc:mga05p37_27944_c2 | nmdc:mga05p37_27944_c2_5055_5498 | 147 |
| 233 | 3300053077 | Ga0495601_0076379 | Ga0495601_0076379_1547_1990 | 147 |
| 234 | 3300053085 | Ga0495619_0178316 | Ga0495619_0178316_609_1052 | 147 |
| 235 | 3300053730 | Ga0500645_007544 | Ga0500645_007544_208_657 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rc3-assembly2.cif.gz_B | crystal structure of cbs domain, ne2398 | 0.9624 | 1 | 127 |
| 4fry-assembly1.cif.gz_A | the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 | 0.9584 | 4 | 130 |
| 2rc3-assembly1.cif.gz_D | crystal structure of cbs domain, ne2398 | 0.9567 | 3 | 127 |
| 2rc3-assembly2.cif.gz_B | crystal structure of cbs domain, ne2398 | 0.9477 | 1 | 127 |
| 3fhm-assembly2.cif.gz_B | crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens | 0.9448 | 4 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71737_1_141_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9712 | 4 | 142 | 3.10.580.10 |
| af_O13965_237_391_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9617 | 2 | 129 | 3.10.580.10 |
| af_K7KHU5_50_204_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9617 | 3 | 144 | 3.10.580.10 |
| 4fryA00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9584 | 4 | 130 | 3.10.580.10 |
| 2rc3D00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9567 | 3 | 127 | 3.10.580.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A127FDE4-F1-model_v4 | Histidine kinase | 0.992 | 3 | 143 |
GO:0016301
|
| AF-A0A7Y2K6A9-F1-model_v4 | CBS domain-containing protein | 0.9893 | 4 | 125 |
|
| AF-A0A7C4BV57-F1-model_v4 | CBS domain-containing protein | 0.9886 | 2 | 132 |
|
| AF-A0A7W7YAX3-F1-model_v4 | CBS domain-containing protein | 0.9878 | 1 | 123 |
|
| AF-T1B6V4-F1-model_v4 | Signal-transduction protein with CBS domain protein | 0.9869 | 1 | 119 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar