F348174

General Info

Members Datasets Scaffolds Average Seq Length
235 181 470 197

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10000207|Ga0213872_1000020753
Length 215
Sequence MSEAAPAFDPNAMAASHVPPAAVPGAVEAPTAKPTVAGIFGAFLLIGATSFGGGVVAYLRSSLVTKHKWVDDKTFVELLAISQTLPGLNATNMAILVGDRLRGLPGAIAAVIGICLPGALLMYLVGMVYHEHGDRPLVTAALKGVAAAAVGLILATTVQLSKKSLAHVYDLVFIALTVIGVNRLHQRVPRVLVVVGILAILWYRPRKKVEEGSSQ

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
175 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
180 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
181 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0.85
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.62
Nodule 0.85
Rhizoplane 1.28
Rhizosphere 81.7
Stem 0
Stem Tuber 0
Unclassified 20.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10000207 3300021361 Bacteria 52310
2 JGI25406J46586_10037200 3300003203 Unclassified 1757
3 JGI25406J46586_10039900 3300003203 Bacteria 1669
4 JGI25405J52794_10081215 3300003911 Bacteria 714
5 Ga0065707_10177160 3300005295 Unclassified 1419
6 Ga0070658_10012153 3300005327 Bacteria 6912
7 Ga0070683_100220665 3300005329 Unclassified 1802
8 Ga0070680_100016428 3300005336 Bacteria 5826
9 Ga0070680_100133780 3300005336 Bacteria 2076
10 Ga0070669_100464854 3300005353 Bacteria 1045
11 Ga0070673_100136765 3300005364 Archaea 2063
12 Ga0070688_100019742 3300005365 Bacteria 3908
13 Ga0070709_10262721 3300005434 Unclassified 1248
14 Ga0070714_100173045 3300005435 Unclassified 1960
15 Ga0070713_100042193 3300005436 Unclassified 3722
16 Ga0070710_10303101 3300005437 Bacteria 1043
17 Ga0070701_10435587 3300005438 Bacteria 838
18 Ga0070711_100062469 3300005439 Bacteria 2596
19 Ga0070711_100169810 3300005439 Bacteria 1661
20 Ga0070711_100540916 3300005439 Bacteria 965
21 Ga0070700_100539514 3300005441 Unclassified 904
22 Ga0070694_100263631 3300005444 Bacteria 1308
23 Ga0070708_100041294 3300005445 Bacteria 4044
24 Ga0070708_100675185 3300005445 Bacteria 973
25 Ga0070708_100957408 3300005445 Unclassified 803
26 Ga0070681_10005094 3300005458 Bacteria 12678
27 Ga0070681_10179230 3300005458 Bacteria 2040
28 Ga0070706_100067456 3300005467 Bacteria 3309
29 Ga0070706_100084200 3300005467 Bacteria 2946
30 Ga0070707_100206770 3300005468 Bacteria 1913
31 Ga0070707_100439673 3300005468 Bacteria 1265
32 Ga0070698_100005107 3300005471 Bacteria 14369
33 Ga0070698_101183652 3300005471 Unclassified 713
34 Ga0070699_100117978 3300005518 Bacteria 2332
35 Ga0070699_100146533 3300005518 Bacteria 2086
36 Ga0070679_100014660 3300005530 Bacteria 7532
37 Ga0070679_100150458 3300005530 Bacteria 2304
38 Ga0070684_100629813 3300005535 Bacteria 998
39 Ga0070697_100060241 3300005536 Bacteria 3093
40 Ga0070697_100062645 3300005536 Bacteria 3036
41 Ga0070665_100047344 3300005548 Bacteria 4316
42 Ga0070665_101365884 3300005548 Unclassified 718
43 Ga0068855_100042037 3300005563 Bacteria 5416
44 Ga0068859_100838481 3300005617 Bacteria 1006
45 Ga0068866_10210343 3300005718 Bacteria 1167
46 Ga0068861_101054755 3300005719 Bacteria 779
47 Ga0068858_100687715 3300005842 Bacteria 995
48 Ga0081455_10000537 3300005937 Bacteria 49240
49 Ga0081538_10060658 3300005981 Bacteria 2173
50 Ga0081540_1003427 3300005983 Bacteria 12537
51 Ga0081539_10001282 3300005985 Bacteria 44233
52 Ga0081539_10038760 3300005985 Bacteria 2820
53 Ga0070717_10089696 3300006028 Bacteria 2593
54 Ga0070717_10149962 3300006028 Bacteria 2017
55 Ga0075365_10018830 3300006038 Unclassified 4252
56 Ga0075365_10038912 3300006038 Bacteria 3094
57 Ga0075365_10158699 3300006038 Bacteria 1575
58 Ga0075368_10183673 3300006042 Bacteria 882
59 Ga0075363_100016174 3300006048 Unclassified 3681
60 Ga0075363_100201011 3300006048 Bacteria 1138
61 Ga0075364_10281366 3300006051 Bacteria 1132
62 Ga0070716_100092530 3300006173 Bacteria 1833
63 Ga0070712_100257386 3300006175 Bacteria 1397
64 Ga0075362_10003434 3300006177 Bacteria 5534
65 Ga0075367_10007209 3300006178 Bacteria 5677
66 Ga0075367_10028401 3300006178 Bacteria 3191
67 Ga0075367_10129881 3300006178 Bacteria 1557
68 Ga0075369_10000525 3300006186 Bacteria 12057
69 Ga0075369_10039107 3300006186 Bacteria 2025
70 Ga0097621_100025392 3300006237 Bacteria 4636
71 Ga0075370_10023950 3300006353 Bacteria 3367
72 Ga0075370_10194518 3300006353 Bacteria 1196
73 Ga0068871_100076134 3300006358 Unclassified 2771
74 Ga0075428_100103870 3300006844 Bacteria 3099
75 Ga0075429_100581631 3300006880 Bacteria 981
76 Ga0097620_100838469 3300006931 Bacteria 1006
77 Ga0075435_100005266 3300007076 Bacteria 9008
78 Ga0099795_10048414 3300007788 Bacteria 1539
79 Ga0105240_10032627 3300009093 Bacteria 6741
80 Ga0111539_10598817 3300009094 Bacteria 1284
81 Ga0114129_11035958 3300009147 Unclassified 1031
82 Ga0114129_11280882 3300009147 Unclassified 909
83 Ga0105243_11428421 3300009148 Bacteria 713
84 Ga0105248_12243273 3300009177 Bacteria 621
85 Ga0105238_10600237 3300009551 Unclassified 1109
86 Ga0105249_10489465 3300009553 Bacteria 1274
87 Ga0157379_10679865 3300014968 Unclassified 965
88 Ga0157376_10009110 3300014969 Bacteria 7195
89 Ga0213872_10001315 3300021361 Bacteria 16474
90 Ga0207685_10143657 3300025905 Unclassified 1072
91 Ga0207705_10051735 3300025909 Unclassified 2956
92 Ga0207684_10338108 3300025910 Unclassified 1297
93 Ga0207707_10066243 3300025912 Bacteria 3145
94 Ga0207695_10214825 3300025913 Unclassified 1833
95 Ga0207693_10112191 3300025915 Bacteria 2139
96 Ga0207663_10033523 3300025916 Bacteria 3060
97 Ga0207663_10035645 3300025916 Bacteria 2987
98 Ga0207660_10062496 3300025917 Unclassified 2683
99 Ga0207652_10040994 3300025921 Bacteria 3934
100 Ga0207652_10089349 3300025921 Bacteria 2705
101 Ga0207646_10041964 3300025922 Bacteria 4110
102 Ga0207681_10211555 3300025923 Bacteria 1495
103 Ga0207694_10364916 3300025924 Unclassified 1197
104 Ga0207700_10024875 3300025928 Unclassified 4150
105 Ga0207700_10113571 3300025928 Bacteria 2184
106 Ga0207709_10383451 3300025935 Bacteria 1070
107 Ga0207709_10533487 3300025935 Bacteria 920
108 Ga0207665_10006765 3300025939 Bacteria 7594
109 Ga0207661_10334503 3300025944 Unclassified 1364
110 Ga0207679_10807668 3300025945 Bacteria 855
111 Ga0207640_10249525 3300025981 Unclassified 1376
112 Ga0207708_10485268 3300026075 Unclassified 1034
113 Ga0207675_100350027 3300026118 Unclassified 1448
114 Ga0268266_10001645 3300028379 Bacteria 25894
115 Ga0268266_10506922 3300028379 Bacteria 1153
116 Ga0265338_10283897 3300028800 Bacteria 1208
117 Ga0265770_1037756 3300030878 Unclassified 834
118 Ga0265760_10011660 3300031090 Bacteria 2511
119 Ga0265330_10003853 3300031235 Bacteria 7722
120 Ga0265330_10139752 3300031235 Bacteria 1030
121 Ga0265330_10175571 3300031235 Bacteria 908
122 Ga0265332_10000355 3300031238 Bacteria 34319
123 Ga0265325_10002634 3300031241 Bacteria 12016
124 Ga0265340_10003451 3300031247 Bacteria 8920
125 Ga0265340_10004861 3300031247 Bacteria 7473
126 Ga0265339_10026385 3300031249 Unclassified 3328
127 Ga0265339_10113741 3300031249 Bacteria 1398
128 Ga0265331_10000381 3300031250 Bacteria 46160
129 Ga0265331_10034671 3300031250 Bacteria 2488
130 Ga0265331_10040329 3300031250 Unclassified 2271
131 Ga0265327_10017400 3300031251 Bacteria 4513
132 Ga0265316_10000522 3300031344 Bacteria 43400
133 Ga0265316_10035459 3300031344 Bacteria 4043
134 Ga0265316_10105196 3300031344 Unclassified 2141
135 Ga0265316_10236481 3300031344 Bacteria 1344
136 Ga0265313_10003809 3300031595 Bacteria 11926
137 Ga0265314_10001989 3300031711 Bacteria 21700
138 Ga0265314_10042073 3300031711 Bacteria 3263
139 Ga0265314_10080608 3300031711 Bacteria 2149
140 Ga0265342_10122603 3300031712 Bacteria 1462
141 Ga0307415_101574365 3300032126 Bacteria 631
142 Ga0373935_0223343 3300035692 Unclassified 1309
143 Ga0373927_0121339 3300035695 Unclassified 1706
144 Ga0373947_0081871 3300035725 Unclassified 2000
145 Ga0373925_0502030 3300037068 Bacteria 996
146 Ga0436364_0998371 3300037853 Unclassified 3250
147 Ga0436365_0367872 3300039437 Unclassified 2401
148 Ga0436365_0621552 3300039437 Unclassified 2302
149 Ga0436360_0296163 3300039438 Unclassified 984
150 Ga0436360_1123449 3300039438 Bacteria 21112
151 Ga0436360_1290276 3300039438 Bacteria 7755
152 Ga0436361_0077605 3300039447 Bacteria 18273
153 Ga0436361_0649704 3300039447 Bacteria 13854
154 Ga0436361_1052449 3300039447 Bacteria 57332
155 Ga0436363_1326646 3300039450 Bacteria 5706
156 Ga0436362_1241382 3300039453 Bacteria 8570
157 Ga0439431_0092119 3300041997 Bacteria 827
158 Ga0439432_138174 3300042006 Bacteria 717
159 Ga0439459_0012767 3300042438 Bacteria 1501
160 Ga0453684_0377560 3300044712 Bacteria 1592
161 Ga0453684_0553639 3300044712 Bacteria 1267
162 Ga0451576_0382134 3300045051 Unclassified 1476
163 Ga0495603_0120777 3300046455 Bacteria 1527
164 Ga0495629_0007728 3300046459 Bacteria 7912
165 Ga0495651_0017978 3300046462 Bacteria 5475
166 Ga0495653_0036459 3300046463 Bacteria 3873
167 Ga0495582_0030945 3300046473 Bacteria 2940
168 Ga0495639_0006106 3300046475 Bacteria 5177
169 Ga0495662_0006162 3300046476 Bacteria 5995
170 Ga0495664_0001058 3300046477 Bacteria 14209
171 Ga0495594_0006384 3300046499 Bacteria 6066
172 Ga0495618_0056911 3300046514 Bacteria 2476
173 Ga0495628_0012551 3300046516 Bacteria 7139
174 Ga0495628_0427188 3300046516 Bacteria 965
175 Ga0495666_0029752 3300046526 Bacteria 2686
176 Ga0495652_0063309 3300046529 Bacteria 3114
177 Ga0495665_0092566 3300046531 Bacteria 1588
178 Ga0495586_0014719 3300046535 Bacteria 4157
179 Ga0495587_0068213 3300046536 Bacteria 2072
180 Ga0495645_0026377 3300046543 Bacteria 4217
181 Ga0495667_0083410 3300046559 Bacteria 2076
182 Ga0495634_0018394 3300046642 Bacteria 4974
183 Ga0495625_0417021 3300046660 Bacteria 836
184 Ga0495635_0028771 3300046663 Bacteria 3861
185 Ga0495599_0026099 3300046678 Bacteria 3660
186 Ga0495623_0043735 3300046679 Bacteria 2848
187 Ga0495646_0018058 3300046680 Bacteria 4466
188 Ga0495647_0115092 3300046681 Bacteria 1126
189 Ga0495669_0049060 3300046684 Unclassified 1889
190 Ga0495613_0053343 3300046689 Bacteria 2975
191 Ga0495624_0008512 3300046690 Bacteria 7147
192 Ga0495600_0009063 3300046809 Bacteria 6136
193 Ga0495581_0000524 3300047315 Bacteria 19652
194 Ga0495604_0028144 3300047317 Bacteria 4470
195 Ga0495674_0046643 3300047319 Bacteria 3845
196 Ga0495676_0003557 3300047321 Bacteria 14129
197 Ga0495680_0012595 3300047322 Bacteria 7432
198 Ga0495675_0018502 3300047444 Bacteria 4422
199 Ga0495602_0518698 3300048088 Bacteria 830
200 Ga0496104_0374713 3300048907 Unclassified 1336
201 Ga0496110_0818364 3300048913 Bacteria 836
202 Ga0496115_0189059 3300048918 Unclassified 1701
203 Ga0496119_0000206 3300048922 Bacteria 83950
204 Ga0496126_0030264 3300048929 Bacteria 5131
205 Ga0501034_0043135 3300049571 Bacteria 4566
206 Ga0501038_1195763 3300049574 Bacteria 552
207 Ga0501043_0236982 3300049579 Bacteria 1408
208 Ga0501047_0464360 3300049581 Bacteria 1094
209 Ga0501072_0696162 3300049588 Bacteria 799
210 nmdc:mga03683_52255_c1 3300050489 Unclassified 1708
211 nmdc:mga03n38_189395_c1 3300050490 Bacteria 1059
212 nmdc:mga03n38_42757_c1 3300050490 Bacteria 1982
213 nmdc:mga00v17_229624_c1 3300050491 Bacteria 1202
214 nmdc:mga0yw44_2991_c1 3300050492 Bacteria 7375
215 nmdc:mga0yw44_467686_c1 3300050492 Unclassified 855
216 nmdc:mga0k408_104518_c1 3300050493 Bacteria 1671
217 nmdc:mga06z11_140915_c1 3300050494 Bacteria 1363
218 nmdc:mga06z11_30870_c1 3300050494 Bacteria 2598
219 nmdc:mga06z11_5395_c1 3300050494 Bacteria 5124
220 nmdc:mga07m45_6328_c1 3300050496 Bacteria 5979
221 nmdc:mga09592_540835_c1 3300050508 Bacteria 1001
222 nmdc:mga08y16_332589_c1 3300050511 Unclassified 1562
223 nmdc:mga08y16_610712_c1 3300050511 Bacteria 1098
224 nmdc:mga0rr50_12939_c1 3300050513 Bacteria 5412
225 nmdc:mga08x19_379132_c1 3300050514 Unclassified 990
226 nmdc:mga0sz30_34134_c1 3300050516 Bacteria 2116
227 nmdc:mga0sz30_402_c1 3300050516 Bacteria 16495
228 Ga0500651_0074892 3300053093 Bacteria 2104
229 Ga0500641_0001304 3300053096 Bacteria 8860
230 Ga0500616_0001131 3300053153 Bacteria 27441
231 Ga0500552_013957 3300053733 Unclassified 1051
232 Ga0530510_0806234 3300061734 Unclassified 716
233 2524539680 2524023228 Bacteria 10118060
234 2876761968 2876761206 Bacteria 10111113
235 8055228734 8055225921 Bacteria 3341787
236 Ga0213872_10000207
237 JGI25406J46586_10037200
238 JGI25406J46586_10039900
239 JGI25405J52794_10081215
240 Ga0065707_10177160
241 Ga0070658_10012153
242 Ga0070683_100220665
243 Ga0070680_100016428
244 Ga0070680_100133780
245 Ga0070669_100464854
246 Ga0070673_100136765
247 Ga0070688_100019742
248 Ga0070709_10262721
249 Ga0070714_100173045
250 Ga0070713_100042193
251 Ga0070710_10303101
252 Ga0070701_10435587
253 Ga0070711_100062469
254 Ga0070711_100169810
255 Ga0070711_100540916
256 Ga0070700_100539514
257 Ga0070694_100263631
258 Ga0070708_100041294
259 Ga0070708_100675185
260 Ga0070708_100957408
261 Ga0070681_10005094
262 Ga0070681_10179230
263 Ga0070706_100067456
264 Ga0070706_100084200
265 Ga0070707_100206770
266 Ga0070707_100439673
267 Ga0070698_100005107
268 Ga0070698_101183652
269 Ga0070699_100117978
270 Ga0070699_100146533
271 Ga0070679_100014660
272 Ga0070679_100150458
273 Ga0070684_100629813
274 Ga0070697_100060241
275 Ga0070697_100062645
276 Ga0070665_100047344
277 Ga0070665_101365884
278 Ga0068855_100042037
279 Ga0068859_100838481
280 Ga0068866_10210343
281 Ga0068861_101054755
282 Ga0068858_100687715
283 Ga0081455_10000537
284 Ga0081538_10060658
285 Ga0081540_1003427
286 Ga0081539_10001282
287 Ga0081539_10038760
288 Ga0070717_10089696
289 Ga0070717_10149962
290 Ga0075365_10018830
291 Ga0075365_10038912
292 Ga0075365_10158699
293 Ga0075368_10183673
294 Ga0075363_100016174
295 Ga0075363_100201011
296 Ga0075364_10281366
297 Ga0070716_100092530
298 Ga0070712_100257386
299 Ga0075362_10003434
300 Ga0075367_10007209
301 Ga0075367_10028401
302 Ga0075367_10129881
303 Ga0075369_10000525
304 Ga0075369_10039107
305 Ga0097621_100025392
306 Ga0075370_10023950
307 Ga0075370_10194518
308 Ga0068871_100076134
309 Ga0075428_100103870
310 Ga0075429_100581631
311 Ga0097620_100838469
312 Ga0075435_100005266
313 Ga0099795_10048414
314 Ga0105240_10032627
315 Ga0111539_10598817
316 Ga0114129_11035958
317 Ga0114129_11280882
318 Ga0105243_11428421
319 Ga0105248_12243273
320 Ga0105238_10600237
321 Ga0105249_10489465
322 Ga0157379_10679865
323 Ga0157376_10009110
324 Ga0213872_10001315
325 Ga0207685_10143657
326 Ga0207705_10051735
327 Ga0207684_10338108
328 Ga0207707_10066243
329 Ga0207695_10214825
330 Ga0207693_10112191
331 Ga0207663_10033523
332 Ga0207663_10035645
333 Ga0207660_10062496
334 Ga0207652_10040994
335 Ga0207652_10089349
336 Ga0207646_10041964
337 Ga0207681_10211555
338 Ga0207694_10364916
339 Ga0207700_10024875
340 Ga0207700_10113571
341 Ga0207709_10383451
342 Ga0207709_10533487
343 Ga0207665_10006765
344 Ga0207661_10334503
345 Ga0207679_10807668
346 Ga0207640_10249525
347 Ga0207708_10485268
348 Ga0207675_100350027
349 Ga0268266_10001645
350 Ga0268266_10506922
351 Ga0265338_10283897
352 Ga0265770_1037756
353 Ga0265760_10011660
354 Ga0265330_10003853
355 Ga0265330_10139752
356 Ga0265330_10175571
357 Ga0265332_10000355
358 Ga0265325_10002634
359 Ga0265340_10003451
360 Ga0265340_10004861
361 Ga0265339_10026385
362 Ga0265339_10113741
363 Ga0265331_10000381
364 Ga0265331_10034671
365 Ga0265331_10040329
366 Ga0265327_10017400
367 Ga0265316_10000522
368 Ga0265316_10035459
369 Ga0265316_10105196
370 Ga0265316_10236481
371 Ga0265313_10003809
372 Ga0265314_10001989
373 Ga0265314_10042073
374 Ga0265314_10080608
375 Ga0265342_10122603
376 Ga0307415_101574365
377 Ga0373935_0223343
378 Ga0373927_0121339
379 Ga0373947_0081871
380 Ga0373925_0502030
381 Ga0436364_0998371
382 Ga0436365_0367872
383 Ga0436365_0621552
384 Ga0436360_0296163
385 Ga0436360_1123449
386 Ga0436360_1290276
387 Ga0436361_0077605
388 Ga0436361_0649704
389 Ga0436361_1052449
390 Ga0436363_1326646
391 Ga0436362_1241382
392 Ga0439431_0092119
393 Ga0439432_138174
394 Ga0439459_0012767
395 Ga0453684_0377560
396 Ga0453684_0553639
397 Ga0451576_0382134
398 Ga0495603_0120777
399 Ga0495629_0007728
400 Ga0495651_0017978
401 Ga0495653_0036459
402 Ga0495582_0030945
403 Ga0495639_0006106
404 Ga0495662_0006162
405 Ga0495664_0001058
406 Ga0495594_0006384
407 Ga0495618_0056911
408 Ga0495628_0012551
409 Ga0495628_0427188
410 Ga0495666_0029752
411 Ga0495652_0063309
412 Ga0495665_0092566
413 Ga0495586_0014719
414 Ga0495587_0068213
415 Ga0495645_0026377
416 Ga0495667_0083410
417 Ga0495634_0018394
418 Ga0495625_0417021
419 Ga0495635_0028771
420 Ga0495599_0026099
421 Ga0495623_0043735
422 Ga0495646_0018058
423 Ga0495647_0115092
424 Ga0495669_0049060
425 Ga0495613_0053343
426 Ga0495624_0008512
427 Ga0495600_0009063
428 Ga0495581_0000524
429 Ga0495604_0028144
430 Ga0495674_0046643
431 Ga0495676_0003557
432 Ga0495680_0012595
433 Ga0495675_0018502
434 Ga0495602_0518698
435 Ga0496104_0374713
436 Ga0496110_0818364
437 Ga0496115_0189059
438 Ga0496119_0000206
439 Ga0496126_0030264
440 Ga0501034_0043135
441 Ga0501038_1195763
442 Ga0501043_0236982
443 Ga0501047_0464360
444 Ga0501072_0696162
445 nmdc:mga03683_52255_c1
446 nmdc:mga03n38_189395_c1
447 nmdc:mga03n38_42757_c1
448 nmdc:mga00v17_229624_c1
449 nmdc:mga0yw44_2991_c1
450 nmdc:mga0yw44_467686_c1
451 nmdc:mga0k408_104518_c1
452 nmdc:mga06z11_140915_c1
453 nmdc:mga06z11_30870_c1
454 nmdc:mga06z11_5395_c1
455 nmdc:mga07m45_6328_c1
456 nmdc:mga09592_540835_c1
457 nmdc:mga08y16_332589_c1
458 nmdc:mga08y16_610712_c1
459 nmdc:mga0rr50_12939_c1
460 nmdc:mga08x19_379132_c1
461 nmdc:mga0sz30_34134_c1
462 nmdc:mga0sz30_402_c1
463 Ga0500651_0074892
464 Ga0500641_0001304
465 Ga0500616_0001131
466 Ga0500552_013957
467 Ga0530510_0806234
468 2524539680
469 2876761968
470 8055228734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

37

202

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5njt-assembly1.cif.gz_D structure of the bacillus subtilis hibernating 100s ribosome reveals the basis for 70s dimerization. 0.5425 19 78
6byq-assembly1.cif.gz_A-2 crystal structure of tyrosine-trna ligase from helicobacter pylori g27 0.3969 18 92
3f7c-assembly1.cif.gz_A-2 crystal structure of a duf416 family protein (maqu_0942) from marinobacter aquaeolei vt8 at 2.00 a resolution 0.3285 15 162
3lvy-assembly2.cif.gz_D crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.3198 13 97
6ql5-assembly1.cif.gz_M structure of fatty acid synthase complex with bound gamma subunit from saccharomyces cerevisiae at 2.8 angstrom 0.316 11 115
ID Description Score Start End Superfamily
af_I1KWM1_425_499_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4491 31 89 1.25.40.10
af_Q940A6_615_684_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4415 31 89 1.25.40.10
af_A0A1D6EWY0_599_667_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4414 31 89 1.25.40.10
af_A0A1D6J7J7_207_276_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4407 31 93 1.25.40.10
af_K7V1S5_472_543_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4358 31 93 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7X9KYE9-F1-model_v4 Chromate transporter 0.9526 15 106 GO:0005886
GO:0015109
AF-A0A2V7FHG5-F1-model_v4 Chromate transporter 0.9022 10 185 GO:0005886
GO:0015109
AF-A0A176Z732-F1-model_v4 Chromate transporter 0.8962 9 185 GO:0005886
GO:0015109
AF-A0A386C5F5-F1-model_v4 Chromate transporter 0.8947 1 97 GO:0005886
GO:0015109
AF-A0A7U7GDH6-F1-model_v4 Chromate transporter 0.8906 13 134 GO:0005886
GO:0015109

Map