F347231

General Info

Members Datasets Scaffolds Average Seq Length
234 152 468 257

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10203320|Ga0307513_102033202
Length 300
Sequence MYVLMAQARSLACRTRVHCHDRFSANTPVSDTLLAATDPPSFSIHGSHGDWPVLICCDHASNRIPGSLGTLGLPAVSLARHIAWDIGAAELARRMADRLGAMAVLAGFSRLVIDCNRQLDDPTSIAEHSDAEPIPGNHGLSAEQRAERVRSCFRPYQQAVDAQLEALRIRGTREEFAPALIAVHSFTPLMQGGAPRPWHCGVLWNVDPRIAVPLIHALRVEPNLIVGDNEPYSGRHPAGYTIDIHAERRGWPGVSLEIRQDLISDSAGAERWADRLSAALRPILRDATLYRSEPAYRTSI

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
87 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
90 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
143 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
144 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
145 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
146 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
151 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.09
Nodule 0
Rhizoplane 1.71
Rhizosphere 71.79
Stem 0
Stem Tuber 0
Unclassified 5.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10203320 3300031456 Bacteria 1819
2 JGI24750J21931_1010263 3300002070 Bacteria 1218
3 JGI25406J46586_10071991 3300003203 Bacteria 1082
4 rootL2_10188104 3300003322 Bacteria 2212
5 rootH1_10048685 3300003323 Bacteria 1745
6 rootH1_10276538 3300003323 Unclassified 3044
7 Ga0070683_100153359 3300005329 Bacteria 2184
8 Ga0070670_100086279 3300005331 Bacteria 2697
9 Ga0070666_10017575 3300005335 Bacteria 4586
10 Ga0070660_100432732 3300005339 Bacteria 1090
11 Ga0070689_100332631 3300005340 Bacteria 1271
12 Ga0070692_10306263 3300005345 Bacteria 972
13 Ga0070675_100233641 3300005354 Bacteria 1605
14 Ga0070671_100000483 3300005355 Bacteria 27720
15 Ga0070671_100289539 3300005355 Bacteria 1394
16 Ga0070673_100475917 3300005364 Bacteria 1127
17 Ga0070667_100002067 3300005367 Bacteria 17769
18 Ga0070708_100207852 3300005445 Bacteria 1834
19 Ga0070678_100146883 3300005456 Bacteria 1894
20 Ga0070681_10002257 3300005458 Bacteria 17602
21 Ga0070706_100087229 3300005467 Bacteria 2892
22 Ga0070698_100008747 3300005471 Bacteria 10902
23 Ga0070699_100024689 3300005518 Bacteria 5182
24 Ga0068853_100058853 3300005539 Bacteria 3318
25 Ga0068853_100210294 3300005539 Bacteria 1773
26 Ga0070686_100025648 3300005544 Bacteria 3549
27 Ga0070665_100006675 3300005548 Bacteria 11734
28 Ga0070665_100051761 3300005548 Bacteria 4118
29 Ga0070665_100081232 3300005548 Bacteria 3247
30 Ga0068855_100000198 3300005563 Bacteria 77745
31 Ga0068857_100017161 3300005577 Bacteria 6341
32 Ga0068856_100301308 3300005614 Bacteria 1620
33 Ga0068852_100060221 3300005616 Bacteria 3296
34 Ga0068859_100000181 3300005617 Bacteria 61904
35 Ga0068859_100010552 3300005617 Bacteria 9301
36 Ga0068859_100166836 3300005617 Bacteria 2282
37 Ga0068859_100459818 3300005617 Bacteria 1369
38 Ga0068859_100876931 3300005617 Bacteria 983
39 Ga0068864_100495832 3300005618 Unclassified 1174
40 Ga0068863_100008268 3300005841 Bacteria 10165
41 Ga0068863_100394932 3300005841 Bacteria 1352
42 Ga0068858_100000878 3300005842 Bacteria 31153
43 Ga0068860_100000559 3300005843 Bacteria 45258
44 Ga0068860_100003259 3300005843 Bacteria 16723
45 Ga0068860_100079245 3300005843 Bacteria 3123
46 Ga0068862_100366600 3300005844 Bacteria 1340
47 Ga0068862_100376377 3300005844 Bacteria 1323
48 Ga0081455_10006616 3300005937 Bacteria 12401
49 Ga0081455_10006926 3300005937 Bacteria 12058
50 Ga0081455_10177371 3300005937 Bacteria 1617
51 Ga0081539_10002091 3300005985 Bacteria 29806
52 Ga0081539_10004580 3300005985 Bacteria 15093
53 Ga0075365_10037875 3300006038 Bacteria 3131
54 Ga0075365_10469581 3300006038 Bacteria 889
55 Ga0075362_10008982 3300006177 Bacteria 3844
56 Ga0075362_10022761 3300006177 Bacteria 2643
57 Ga0075362_10037035 3300006177 Bacteria 2137
58 Ga0075367_10035329 3300006178 Bacteria 2893
59 Ga0075367_10040702 3300006178 Bacteria 2714
60 Ga0075367_10058972 3300006178 Bacteria 2284
61 Ga0075367_10081284 3300006178 Bacteria 1961
62 Ga0075369_10002082 3300006186 Bacteria 7063
63 Ga0075369_10006311 3300006186 Bacteria 4478
64 Ga0075369_10079710 3300006186 Bacteria 1451
65 Ga0075369_10125286 3300006186 Bacteria 1165
66 Ga0075370_10037691 3300006353 Bacteria 2719
67 Ga0097620_100000181 3300006931 Bacteria 61904
68 Ga0097620_100010552 3300006931 Bacteria 9301
69 Ga0097620_100166848 3300006931 Bacteria 2282
70 Ga0097620_100459812 3300006931 Bacteria 1369
71 Ga0097620_100876793 3300006931 Bacteria 983
72 Ga0099794_10095136 3300007265 Bacteria 1482
73 Ga0105240_10010200 3300009093 Bacteria 13222
74 Ga0105240_10525019 3300009093 Bacteria 1313
75 Ga0111539_10174160 3300009094 Bacteria 2514
76 Ga0105247_10000549 3300009101 Bacteria 30547
77 Ga0105241_10132909 3300009174 Bacteria 2017
78 Ga0105248_10009601 3300009177 Bacteria 10651
79 Ga0105237_10142164 3300009545 Bacteria 2394
80 Ga0105238_10206788 3300009551 Bacteria 1939
81 Ga0105249_10012975 3300009553 Bacteria 7354
82 Ga0105239_10545126 3300010375 Bacteria 1321
83 Ga0157370_10004512 3300013104 Bacteria 15954
84 Ga0157369_10453307 3300013105 Bacteria 1328
85 Ga0157369_10556078 3300013105 Bacteria 1186
86 Ga0163162_10057506 3300013306 Bacteria 3917
87 Ga0163162_10172935 3300013306 Bacteria 2285
88 Ga0163163_10020651 3300014325 Bacteria 6207
89 Ga0157379_10022176 3300014968 Bacteria 5627
90 Ga0157379_10588724 3300014968 Bacteria 1037
91 Ga0206353_11067883 3300020082 Bacteria 1443
92 Ga0213871_10080738 3300021441 Bacteria 931
93 Ga0207710_10000347 3300025900 Bacteria 33831
94 Ga0207688_10139682 3300025901 Bacteria 1425
95 Ga0207680_10094867 3300025903 Bacteria 1905
96 Ga0207680_10128175 3300025903 Bacteria 1669
97 Ga0207684_10090613 3300025910 Bacteria 2605
98 Ga0207671_10188662 3300025914 Bacteria 1607
99 Ga0207694_10070730 3300025924 Bacteria 2727
100 Ga0207650_10077129 3300025925 Bacteria 2519
101 Ga0207700_10017332 3300025928 Bacteria 4810
102 Ga0207644_10001890 3300025931 Bacteria 13622
103 Ga0207690_10375335 3300025932 Bacteria 1129
104 Ga0207670_10109769 3300025936 Bacteria 1986
105 Ga0207711_10025267 3300025941 Bacteria 4983
106 Ga0207711_10176946 3300025941 Bacteria 1939
107 Ga0207661_10043935 3300025944 Bacteria 3528
108 Ga0207679_10502431 3300025945 Bacteria 1082
109 Ga0207667_10007144 3300025949 Bacteria 13481
110 Ga0207703_10001895 3300026035 Bacteria 18543
111 Ga0207639_10055052 3300026041 Bacteria 3043
112 Ga0207678_10137192 3300026067 Bacteria 2087
113 Ga0207702_10426272 3300026078 Bacteria 1283
114 Ga0207641_10000625 3300026088 Bacteria 38603
115 Ga0207641_10009346 3300026088 Bacteria 8085
116 Ga0207641_10554851 3300026088 Bacteria 1121
117 Ga0207674_10146583 3300026116 Bacteria 2319
118 Ga0207683_10166397 3300026121 Bacteria 1995
119 Ga0268266_10001610 3300028379 Bacteria 26353
120 Ga0268266_10032307 3300028379 Bacteria 4447
121 Ga0268266_10040121 3300028379 Bacteria 3989
122 Ga0268264_10000100 3300028381 Bacteria 227852
123 Ga0268264_10013535 3300028381 Bacteria 6718
124 Ga0268264_10159323 3300028381 Bacteria 2031
125 Ga0265340_10004665 3300031247 Bacteria 7624
126 Ga0265316_10227825 3300031344 Bacteria 1373
127 Ga0316575_10077798 3300031665 Unclassified 1336
128 Ga0316579_10046731 3300031691 Bacteria 2020
129 Ga0316576_10091144 3300031727 Bacteria 2271
130 Ga0316578_10100669 3300031728 Bacteria 1732
131 Ga0316578_10169622 3300031728 Unclassified 1315
132 Ga0316577_10036175 3300031733 Bacteria 2760
133 Ga0316577_10097741 3300031733 Bacteria 1645
134 Ga0316577_10250935 3300031733 Bacteria 1001
135 Ga0307510_10000001 3300033180 Bacteria 1172244
136 Ga0373929_0024421 3300035085 Bacteria 1249
137 Ga0373936_0060009 3300035113 Bacteria 1551
138 Ga0316574_0000712 3300035398 Bacteria 14207
139 Ga0316574_0042844 3300035398 Bacteria 2795
140 Ga0316574_0135252 3300035398 Bacteria 1587
141 Ga0316574_0210408 3300035398 Unclassified 1248
142 Ga0316574_0288092 3300035398 Bacteria 1045
143 Ga0373931_0024674 3300035691 Bacteria 3049
144 Ga0373927_0104477 3300035695 Bacteria 1844
145 Ga0373927_0128730 3300035695 Bacteria 1653
146 Ga0373927_0142773 3300035695 Bacteria 1567
147 Ga0316582_0060917 3300036647 Bacteria 2420
148 Ga0316582_0114881 3300036647 Bacteria 1796
149 Ga0316582_0132229 3300036647 Unclassified 1677
150 Ga0316582_0602478 3300036647 Unclassified 756
151 Ga0316584_0008820 3300036712 Bacteria 6967
152 Ga0373925_0065950 3300037068 Bacteria 2728
153 Ga0395899_0112164 3300037312 Bacteria 1959
154 Ga0395899_0120979 3300037312 Bacteria 1875
155 Ga0395900_0013937 3300037418 Bacteria 8204
156 Ga0395898_0889664 3300037466 Bacteria 829
157 Ga0395901_0008019 3300038443 Bacteria 10665
158 Ga0395901_0097896 3300038443 Bacteria 3075
159 Ga0436360_0017650 3300039438 Bacteria 12851
160 Ga0436360_0682466 3300039438 Bacteria 1979
161 Ga0436361_0557468 3300039447 Bacteria 4823
162 Ga0439441_036360 3300042001 Unclassified 973
163 Ga0451577_0023366 3300042876 Bacteria 5639
164 Ga0451577_0074197 3300042876 Bacteria 3034
165 Ga0451577_0075130 3300042876 Bacteria 3014
166 Ga0451577_0191471 3300042876 Unclassified 1845
167 Ga0451577_0291648 3300042876 Bacteria 1478
168 Ga0453683_0069650 3300044673 Bacteria 2199
169 Ga0466961_0157788 3300044693 Bacteria 1415
170 Ga0453684_0076173 3300044712 Bacteria 4212
171 Ga0466957_0020962 3300044842 Bacteria 3846
172 Ga0466967_0042465 3300045976 Bacteria 3929
173 Ga0495620_0164690 3300046515 Unclassified 861
174 Ga0496102_0001890 3300048905 Bacteria 18044
175 Ga0496102_0031421 3300048905 Bacteria 4764
176 Ga0496109_0603939 3300048912 Unclassified 1033
177 Ga0496112_0230120 3300048915 Bacteria 1808
178 Ga0496116_0035108 3300048919 Bacteria 3526
179 Ga0496117_0000102 3300048920 Bacteria 189959
180 Ga0496118_0000038 3300048921 Bacteria 315464
181 Ga0496119_0008058 3300048922 Bacteria 9352
182 Ga0496119_0032827 3300048922 Bacteria 3454
183 Ga0496119_0093478 3300048922 Bacteria 1703
184 Ga0496120_0000348 3300048923 Bacteria 76112
185 Ga0496120_0022672 3300048923 Bacteria 3947
186 Ga0496121_0007519 3300048924 Bacteria 13140
187 Ga0496121_0023587 3300048924 Bacteria 5917
188 Ga0496124_0022003 3300048927 Bacteria 5860
189 Ga0496125_0005247 3300048928 Bacteria 14519
190 Ga0496125_0042109 3300048928 Bacteria 3895
191 Ga0496125_0137222 3300048928 Bacteria 1708
192 Ga0496126_0020245 3300048929 Bacteria 6529
193 Ga0496126_0094537 3300048929 Bacteria 2623
194 Ga0496126_0370217 3300048929 Bacteria 1168
195 Ga0501031_0337311 3300049568 Bacteria 976
196 Ga0501034_0001373 3300049571 Bacteria 32696
197 Ga0501034_0041519 3300049571 Bacteria 4654
198 Ga0501034_0467179 3300049571 Bacteria 1178
199 Ga0501034_0478522 3300049571 Bacteria 1161
200 Ga0501038_0277667 3300049574 Bacteria 1320
201 Ga0501046_0300866 3300049580 Bacteria 1171
202 Ga0501047_0176414 3300049581 Bacteria 2004
203 Ga0501068_0022191 3300049584 Bacteria 3710
204 Ga0501076_0150525 3300049592 Bacteria 1893
205 Ga0501044_0475400 3300049823 Bacteria 1153
206 Ga0501045_0007391 3300049824 Bacteria 7637
207 nmdc:mga03683_1430_c1 3300050489 Bacteria 2853
208 nmdc:mga03683_1430_c5 3300050489 Bacteria 2853
209 nmdc:mga03683_16841_c1 3300050489 Bacteria 2755
210 nmdc:mga03683_31337_c1 3300050489 Bacteria 2132
211 nmdc:mga03n38_223280_c1 3300050490 Bacteria 984
212 nmdc:mga0yw44_114749_c2 3300050492 Bacteria 1286
213 nmdc:mga0yw44_237563_c1 3300050492 Bacteria 1211
214 nmdc:mga0yw44_44894_c1 3300050492 Bacteria 2646
215 nmdc:mga0yw44_99843_c1 3300050492 Bacteria 1847
216 nmdc:mga06z11_3688_c1 3300050494 Bacteria 5946
217 nmdc:mga06z11_73145_c1 3300050494 Bacteria 1819
218 nmdc:mga06z11_76473_c1 3300050494 Bacteria 1785
219 nmdc:mga07m45_104383_c1 3300050496 Bacteria 1629
220 nmdc:mga08y16_416154_c1 3300050511 Bacteria 1374
221 nmdc:mga0sz30_1502_c1 3300050516 Bacteria 8310
222 nmdc:mga0sz30_53914_c1 3300050516 Bacteria 1709
223 nmdc:mga0sz30_5406_c1 3300050516 Bacteria 4682
224 Ga0500647_0034704 3300053091 Bacteria 2409
225 Ga0500651_0324953 3300053093 Bacteria 878
226 Ga0500641_0004259 3300053096 Bacteria 5050
227 Ga0500642_0076722 3300053130 Bacteria 1529
228 Ga0500568_0066747 3300053139 Bacteria 1383
229 Ga0500616_0001044 3300053153 Bacteria 29289
230 Ga0500620_012838 3300053155 Bacteria 2295
231 Ga0500622_0079369 3300053156 Unclassified 1645
232 Ga0500630_030858 3300053159 Bacteria 2636
233 Ga0500552_000862 3300053733 Bacteria 2862
234 Ga0501084_0039521 3300054114 Bacteria 3946
235 Ga0307513_10203320
236 JGI24750J21931_1010263
237 JGI25406J46586_10071991
238 rootL2_10188104
239 rootH1_10048685
240 rootH1_10276538
241 Ga0070683_100153359
242 Ga0070670_100086279
243 Ga0070666_10017575
244 Ga0070660_100432732
245 Ga0070689_100332631
246 Ga0070692_10306263
247 Ga0070675_100233641
248 Ga0070671_100000483
249 Ga0070671_100289539
250 Ga0070673_100475917
251 Ga0070667_100002067
252 Ga0070708_100207852
253 Ga0070678_100146883
254 Ga0070681_10002257
255 Ga0070706_100087229
256 Ga0070698_100008747
257 Ga0070699_100024689
258 Ga0068853_100058853
259 Ga0068853_100210294
260 Ga0070686_100025648
261 Ga0070665_100006675
262 Ga0070665_100051761
263 Ga0070665_100081232
264 Ga0068855_100000198
265 Ga0068857_100017161
266 Ga0068856_100301308
267 Ga0068852_100060221
268 Ga0068859_100000181
269 Ga0068859_100010552
270 Ga0068859_100166836
271 Ga0068859_100459818
272 Ga0068859_100876931
273 Ga0068864_100495832
274 Ga0068863_100008268
275 Ga0068863_100394932
276 Ga0068858_100000878
277 Ga0068860_100000559
278 Ga0068860_100003259
279 Ga0068860_100079245
280 Ga0068862_100366600
281 Ga0068862_100376377
282 Ga0081455_10006616
283 Ga0081455_10006926
284 Ga0081455_10177371
285 Ga0081539_10002091
286 Ga0081539_10004580
287 Ga0075365_10037875
288 Ga0075365_10469581
289 Ga0075362_10008982
290 Ga0075362_10022761
291 Ga0075362_10037035
292 Ga0075367_10035329
293 Ga0075367_10040702
294 Ga0075367_10058972
295 Ga0075367_10081284
296 Ga0075369_10002082
297 Ga0075369_10006311
298 Ga0075369_10079710
299 Ga0075369_10125286
300 Ga0075370_10037691
301 Ga0097620_100000181
302 Ga0097620_100010552
303 Ga0097620_100166848
304 Ga0097620_100459812
305 Ga0097620_100876793
306 Ga0099794_10095136
307 Ga0105240_10010200
308 Ga0105240_10525019
309 Ga0111539_10174160
310 Ga0105247_10000549
311 Ga0105241_10132909
312 Ga0105248_10009601
313 Ga0105237_10142164
314 Ga0105238_10206788
315 Ga0105249_10012975
316 Ga0105239_10545126
317 Ga0157370_10004512
318 Ga0157369_10453307
319 Ga0157369_10556078
320 Ga0163162_10057506
321 Ga0163162_10172935
322 Ga0163163_10020651
323 Ga0157379_10022176
324 Ga0157379_10588724
325 Ga0206353_11067883
326 Ga0213871_10080738
327 Ga0207710_10000347
328 Ga0207688_10139682
329 Ga0207680_10094867
330 Ga0207680_10128175
331 Ga0207684_10090613
332 Ga0207671_10188662
333 Ga0207694_10070730
334 Ga0207650_10077129
335 Ga0207700_10017332
336 Ga0207644_10001890
337 Ga0207690_10375335
338 Ga0207670_10109769
339 Ga0207711_10025267
340 Ga0207711_10176946
341 Ga0207661_10043935
342 Ga0207679_10502431
343 Ga0207667_10007144
344 Ga0207703_10001895
345 Ga0207639_10055052
346 Ga0207678_10137192
347 Ga0207702_10426272
348 Ga0207641_10000625
349 Ga0207641_10009346
350 Ga0207641_10554851
351 Ga0207674_10146583
352 Ga0207683_10166397
353 Ga0268266_10001610
354 Ga0268266_10032307
355 Ga0268266_10040121
356 Ga0268264_10000100
357 Ga0268264_10013535
358 Ga0268264_10159323
359 Ga0265340_10004665
360 Ga0265316_10227825
361 Ga0316575_10077798
362 Ga0316579_10046731
363 Ga0316576_10091144
364 Ga0316578_10100669
365 Ga0316578_10169622
366 Ga0316577_10036175
367 Ga0316577_10097741
368 Ga0316577_10250935
369 Ga0307510_10000001
370 Ga0373929_0024421
371 Ga0373936_0060009
372 Ga0316574_0000712
373 Ga0316574_0042844
374 Ga0316574_0135252
375 Ga0316574_0210408
376 Ga0316574_0288092
377 Ga0373931_0024674
378 Ga0373927_0104477
379 Ga0373927_0128730
380 Ga0373927_0142773
381 Ga0316582_0060917
382 Ga0316582_0114881
383 Ga0316582_0132229
384 Ga0316582_0602478
385 Ga0316584_0008820
386 Ga0373925_0065950
387 Ga0395899_0112164
388 Ga0395899_0120979
389 Ga0395900_0013937
390 Ga0395898_0889664
391 Ga0395901_0008019
392 Ga0395901_0097896
393 Ga0436360_0017650
394 Ga0436360_0682466
395 Ga0436361_0557468
396 Ga0439441_036360
397 Ga0451577_0023366
398 Ga0451577_0074197
399 Ga0451577_0075130
400 Ga0451577_0191471
401 Ga0451577_0291648
402 Ga0453683_0069650
403 Ga0466961_0157788
404 Ga0453684_0076173
405 Ga0466957_0020962
406 Ga0466967_0042465
407 Ga0495620_0164690
408 Ga0496102_0001890
409 Ga0496102_0031421
410 Ga0496109_0603939
411 Ga0496112_0230120
412 Ga0496116_0035108
413 Ga0496117_0000102
414 Ga0496118_0000038
415 Ga0496119_0008058
416 Ga0496119_0032827
417 Ga0496119_0093478
418 Ga0496120_0000348
419 Ga0496120_0022672
420 Ga0496121_0007519
421 Ga0496121_0023587
422 Ga0496124_0022003
423 Ga0496125_0005247
424 Ga0496125_0042109
425 Ga0496125_0137222
426 Ga0496126_0020245
427 Ga0496126_0094537
428 Ga0496126_0370217
429 Ga0501031_0337311
430 Ga0501034_0001373
431 Ga0501034_0041519
432 Ga0501034_0467179
433 Ga0501034_0478522
434 Ga0501038_0277667
435 Ga0501046_0300866
436 Ga0501047_0176414
437 Ga0501068_0022191
438 Ga0501076_0150525
439 Ga0501044_0475400
440 Ga0501045_0007391
441 nmdc:mga03683_1430_c1
442 nmdc:mga03683_1430_c5
443 nmdc:mga03683_16841_c1
444 nmdc:mga03683_31337_c1
445 nmdc:mga03n38_223280_c1
446 nmdc:mga0yw44_114749_c2
447 nmdc:mga0yw44_237563_c1
448 nmdc:mga0yw44_44894_c1
449 nmdc:mga0yw44_99843_c1
450 nmdc:mga06z11_3688_c1
451 nmdc:mga06z11_73145_c1
452 nmdc:mga06z11_76473_c1
453 nmdc:mga07m45_104383_c1
454 nmdc:mga08y16_416154_c1
455 nmdc:mga0sz30_1502_c1
456 nmdc:mga0sz30_53914_c1
457 nmdc:mga0sz30_5406_c1
458 Ga0500647_0034704
459 Ga0500651_0324953
460 Ga0500641_0004259
461 Ga0500642_0076722
462 Ga0500568_0066747
463 Ga0500616_0001044
464 Ga0500620_012838
465 Ga0500622_0079369
466 Ga0500630_030858
467 Ga0500552_000862
468 Ga0501084_0039521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05013

FGase

N-formylglutamate amidohydrolase

51

264

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2odf-assembly3.cif.gz_C the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.9562 4 247
2odf-assembly2.cif.gz_B the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.9345 3 248
2odf-assembly3.cif.gz_C the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.9337 4 247
2odf-assembly2.cif.gz_B the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.9129 3 248
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7134 9 246
ID Description Score Start End Superfamily
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.9344 12 248 3.40.630.40
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.9231 12 248 3.40.630.40
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7064 9 246 3.40.630.40
af_Q55BQ6_51_145_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6993 163 192 3.40.30.10
1b9iA02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.6988 220 247 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A7U3HD73-F1-model_v4 deleted 0.9973 9 246
AF-A0A537SKI3-F1-model_v4 N-formylglutamate amidohydrolase 0.9956 2 173 GO:0016787
AF-A0A095V136-F1-model_v4 N-formylglutamate amidohydrolase 0.9942 1 245 GO:0016787
AF-A0A7W7Z5Z9-F1-model_v4 Putative N-formylglutamate amidohydrolase 0.9936 13 246 GO:0016787
AF-A0A3L7ANM9-F1-model_v4 N-formylglutamate amidohydrolase 0.9934 1 246 GO:0016787

Map