F345901

General Info

Members Datasets Scaffolds Average Seq Length
233 159 230 191

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100095404|Ga0068857_1000954044
Length 226
Sequence MCDLPTEFRFWSPLFLGRAMTFTWPCRVARVEITIRHEAAEKKSEFSRAQSENLLKTIKARFESHAERHKGIEWAKVQAKLEANSKKLFSLWEMEQTGGEPDVVGFDKKANEYIFFDCSPQSPEGRTGYCYDREALDSRKEHKPKNNVIDAAAAMGVELLDEEQYRELQKLGEFDTKSSTWIKTPADVRKLGGALFCDRRFGRVFTYHNGAQSYYSGRGFRCWLRV

Samples

Sample ID Description Type Environment
1 2738541302 Pedobacter sp. CF074 Isolate Unclassified
2 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
3 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
90 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
110 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
111 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
112 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
115 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 0
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 3.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10264976 3300003322 Bacteria 3259
2 rootH1_10139375 3300003323 Bacteria 12678
3 rootH1_10320401 3300003323 Bacteria 1315
4 Ga0065712_10261050 3300005290 Bacteria 937
5 Ga0065715_10000846 3300005293 Bacteria 13100
6 Ga0070658_10130117 3300005327 Bacteria 2097
7 Ga0070683_100003235 3300005329 Bacteria 13154
8 Ga0070683_100025931 3300005329 Bacteria 5271
9 Ga0070683_100459174 3300005329 Bacteria 1215
10 Ga0070690_100043407 3300005330 Bacteria 2851
11 Ga0070690_100784740 3300005330 Bacteria 738
12 Ga0070680_100102073 3300005336 Bacteria 2382
13 Ga0070680_100269226 3300005336 Bacteria 1442
14 Ga0070660_100028280 3300005339 Bacteria 4192
15 Ga0070687_100041599 3300005343 Bacteria 2323
16 Ga0070661_100069214 3300005344 Bacteria 2595
17 Ga0070692_10249224 3300005345 Bacteria 1062
18 Ga0070675_100231906 3300005354 Bacteria 1611
19 Ga0070671_100160418 3300005355 Bacteria 1901
20 Ga0070671_100928209 3300005355 Bacteria 761
21 Ga0070673_100080495 3300005364 Bacteria 2639
22 Ga0070659_100075513 3300005366 Bacteria 2686
23 Ga0070713_100094839 3300005436 Bacteria 2573
24 Ga0070662_100169937 3300005457 Bacteria 1711
25 Ga0070681_10527411 3300005458 Unclassified 1094
26 Ga0070679_100493095 3300005530 Bacteria 1169
27 Ga0070684_100232462 3300005535 Bacteria 1683
28 Ga0068853_100043254 3300005539 Bacteria 3853
29 Ga0070672_100014325 3300005543 Bacteria 5618
30 Ga0070693_100018106 3300005547 Unclassified 3674
31 Ga0070693_100048932 3300005547 Bacteria 2410
32 Ga0070693_100367890 3300005547 Bacteria 988
33 Ga0068855_100097472 3300005563 Bacteria 3387
34 Ga0068855_100114722 3300005563 Bacteria 3088
35 Ga0070664_100001016 3300005564 Bacteria 22026
36 Ga0070664_100090308 3300005564 Bacteria 2651
37 Ga0068857_100070984 3300005577 Bacteria 3102
38 Ga0068857_100095404 3300005577 Bacteria 2665
39 Ga0068857_100950026 3300005577 Unclassified 826
40 Ga0068856_100000067 3300005614 Bacteria 98357
41 Ga0068856_100005677 3300005614 Bacteria 12287
42 Ga0068856_100049987 3300005614 Bacteria 4121
43 Ga0068852_100734887 3300005616 Bacteria 998
44 Ga0068861_100399647 3300005719 Bacteria 1219
45 Ga0068851_10082246 3300005834 Bacteria 1683
46 Ga0068863_100190676 3300005841 Unclassified 1970
47 Ga0068863_100755759 3300005841 Bacteria 968
48 Ga0068858_100598201 3300005842 Bacteria 1070
49 Ga0068860_100042793 3300005843 Unclassified 4323
50 Ga0070717_10822275 3300006028 Bacteria 845
51 Ga0070716_100572823 3300006173 Bacteria 845
52 Ga0075428_100113718 3300006844 Bacteria 2949
53 Ga0075429_100123366 3300006880 Bacteria 2265
54 Ga0105240_10000702 3300009093 Bacteria 61289
55 Ga0105240_10067682 3300009093 Bacteria 4426
56 Ga0105240_10158428 3300009093 Bacteria 2691
57 Ga0105240_10871177 3300009093 Bacteria 971
58 Ga0111539_10282786 3300009094 Bacteria 1930
59 Ga0105245_10910383 3300009098 Unclassified 921
60 Ga0114129_10049971 3300009147 Bacteria 5874
61 Ga0105241_10098565 3300009174 Bacteria 2319
62 Ga0105242_10866092 3300009176 Unclassified 900
63 Ga0105237_10000895 3300009545 Bacteria 40186
64 Ga0105238_10079828 3300009551 Bacteria 3261
65 Ga0105238_10121527 3300009551 Unclassified 2591
66 Ga0105249_11770085 3300009553 Bacteria 690
67 Ga0105239_10081225 3300010375 Unclassified 3568
68 Ga0157373_10009686 3300013100 Bacteria 7112
69 Ga0157373_10049805 3300013100 Bacteria 2984
70 Ga0157370_10104829 3300013104 Bacteria 2647
71 Ga0157369_10013414 3300013105 Bacteria 9265
72 Ga0157369_10045672 3300013105 Bacteria 4762
73 Ga0157369_10442142 3300013105 Bacteria 1347
74 Ga0157374_10077678 3300013296 Bacteria 3142
75 Ga0157378_10010592 3300013297 Bacteria 8058
76 Ga0157378_10088052 3300013297 Bacteria 2817
77 Ga0157378_10232924 3300013297 Bacteria 1756
78 Ga0157372_10593791 3300013307 Bacteria 1291
79 Ga0157376_10584548 3300014969 Bacteria 1109
80 Ga0213872_10029500 3300021361 Bacteria 2515
81 Ga0209233_1017809 3300025261 Bacteria 1926
82 Ga0209455_1000697 3300025272 Bacteria 19724
83 Ga0207688_10005502 3300025901 Bacteria 6888
84 Ga0207645_10009683 3300025907 Bacteria 6656
85 Ga0207654_10115330 3300025911 Unclassified 1678
86 Ga0207707_10454265 3300025912 Unclassified 1096
87 Ga0207695_10019280 3300025913 Bacteria 7855
88 Ga0207695_10025591 3300025913 Bacteria 6603
89 Ga0207695_10075005 3300025913 Bacteria 3442
90 Ga0207695_10075445 3300025913 Unclassified 3431
91 Ga0207671_10008940 3300025914 Bacteria 8428
92 Ga0207660_10135088 3300025917 Bacteria 1881
93 Ga0207649_10202664 3300025920 Bacteria 1403
94 Ga0207649_10699179 3300025920 Bacteria 786
95 Ga0207694_10467806 3300025924 Bacteria 1054
96 Ga0207659_10295200 3300025926 Bacteria 1329
97 Ga0207700_10906936 3300025928 Bacteria 789
98 Ga0207664_10011090 3300025929 Bacteria 6387
99 Ga0207706_10055766 3300025933 Bacteria 3484
100 Ga0207670_10462742 3300025936 Bacteria 1024
101 Ga0207691_10009816 3300025940 Bacteria 9191
102 Ga0207661_10001527 3300025944 Bacteria 15708
103 Ga0207661_10018584 3300025944 Bacteria 5166
104 Ga0207679_10080762 3300025945 Bacteria 2484
105 Ga0207679_10377382 3300025945 Bacteria 1242
106 Ga0207667_10186948 3300025949 Bacteria 2126
107 Ga0207667_10509350 3300025949 Bacteria 1220
108 Ga0207703_10854100 3300026035 Bacteria 870
109 Ga0207703_11221082 3300026035 Bacteria 723
110 Ga0207639_10052558 3300026041 Bacteria 3105
111 Ga0207702_10001130 3300026078 Bacteria 27269
112 Ga0207702_10002905 3300026078 Bacteria 16041
113 Ga0207641_10016517 3300026088 Bacteria 6045
114 Ga0207641_10189280 3300026088 Unclassified 1890
115 Ga0207641_10645836 3300026088 Bacteria 1039
116 Ga0207674_10064386 3300026116 Bacteria 3698
117 Ga0207674_10275759 3300026116 Bacteria 1629
118 Ga0207674_10948871 3300026116 Unclassified 829
119 Ga0207675_100180702 3300026118 Bacteria 2020
120 Ga0209995_1003325 3300027471 Bacteria 2563
121 Ga0209968_1025873 3300027526 Bacteria 968
122 Ga0268264_10020021 3300028381 Bacteria 5466
123 Ga0265337_1001121 3300028556 Bacteria 13705
124 Ga0265337_1005069 3300028556 Bacteria 5318
125 Ga0265326_10004743 3300028558 Bacteria 4324
126 Ga0265326_10040276 3300028558 Bacteria 1327
127 Ga0265319_1002417 3300028563 Bacteria 10237
128 Ga0265319_1024342 3300028563 Bacteria 2180
129 Ga0265322_10033315 3300028654 Bacteria 1469
130 Ga0265336_10015615 3300028666 Unclassified 2493
131 Ga0307515_10320411 3300028794 Unclassified 1217
132 Ga0265338_10001724 3300028800 Bacteria 34657
133 Ga0265338_10008409 3300028800 Bacteria 12533
134 Ga0265338_10039348 3300028800 Bacteria 4462
135 Ga0265338_10089341 3300028800 Bacteria 2553
136 Ga0265338_10143881 3300028800 Bacteria 1863
137 Ga0265324_10000359 3300029957 Bacteria 33009
138 Ga0265324_10006932 3300029957 Bacteria 4664
139 Ga0265324_10012343 3300029957 Bacteria 3223
140 Ga0265320_10000071 3300031240 Bacteria 89794
141 Ga0265320_10000925 3300031240 Bacteria 21940
142 Ga0265320_10001040 3300031240 Bacteria 20589
143 Ga0265320_10019961 3300031240 Bacteria 3647
144 Ga0265320_10038216 3300031240 Bacteria 2410
145 Ga0265325_10084107 3300031241 Bacteria 1577
146 Ga0265339_10007592 3300031249 Bacteria 6989
147 Ga0265327_10000520 3300031251 Bacteria 66490
148 Ga0265327_10013644 3300031251 Bacteria 5383
149 Ga0265316_10001457 3300031344 Bacteria 25402
150 Ga0265316_10016719 3300031344 Bacteria 6356
151 Ga0307509_10020912 3300031507 Bacteria 7417
152 Ga0265313_10000350 3300031595 Bacteria 50178
153 Ga0265313_10003278 3300031595 Bacteria 13295
154 Ga0265313_10005816 3300031595 Bacteria 8953
155 Ga0265314_10001713 3300031711 Bacteria 23798
156 Ga0265342_10058308 3300031712 Bacteria 2282
157 Ga0265342_10064541 3300031712 Bacteria 2148
158 Ga0307413_10491932 3300031824 Bacteria 983
159 Ga0307409_101225898 3300031995 Bacteria 774
160 Ga0307414_10243604 3300032004 Bacteria 1490
161 Ga0373948_0093801 3300034817 Unclassified 699
162 Ga0373950_0001161 3300034818 Bacteria 3385
163 Ga0373928_0000040 3300035084 Bacteria 22037
164 Ga0373929_0000353 3300035085 Bacteria 8570
165 Ga0373944_0000214 3300035089 Bacteria 12433
166 Ga0373949_0001509 3300035090 Bacteria 6605
167 Ga0373951_0002578 3300035091 Bacteria 4554
168 Ga0373951_0006849 3300035091 Bacteria 2604
169 Ga0373932_0000006 3300035112 Bacteria 208547
170 Ga0373945_0008649 3300035116 Bacteria 3320
171 Ga0373945_0047993 3300035116 Unclassified 1563
172 Ga0373943_0022960 3300035170 Unclassified 2897
173 Ga0373962_0000031 3300035242 Bacteria 36127
174 Ga0373931_0000009 3300035691 Bacteria 349854
175 Ga0373935_0091778 3300035692 Unclassified 1989
176 Ga0373927_0004929 3300035695 Bacteria 9260
177 Ga0373927_0006395 3300035695 Bacteria 8024
178 Ga0373947_0024986 3300035725 Unclassified 3483
179 Ga0373947_0156246 3300035725 Bacteria 1472
180 Ga0373937_0309111 3300036401 Unclassified 1495
181 Ga0373925_0000235 3300037068 Bacteria 58451
182 Ga0373925_0006052 3300037068 Bacteria 8950
183 Ga0373925_1157587 3300037068 Bacteria 636
184 Ga0395899_0031708 3300037312 Bacteria 3971
185 Ga0395898_0003129 3300037466 Bacteria 18683
186 Ga0395901_0024188 3300038443 Bacteria 6232
187 Ga0436361_0635236 3300039447 Bacteria 6435
188 Ga0451577_0040661 3300042876 Bacteria 4174
189 Ga0451577_0143001 3300042876 Unclassified 2150
190 Ga0453683_0002026 3300044673 Bacteria 16321
191 Ga0453683_0544477 3300044673 Bacteria 755
192 Ga0466961_0200515 3300044693 Unclassified 1234
193 Ga0453684_0000001 3300044712 Bacteria 2623166
194 Ga0453684_0017450 3300044712 Unclassified 11118
195 Ga0453684_0055790 3300044712 Bacteria 5133
196 Ga0453684_0321806 3300044712 Unclassified 1751
197 Ga0451576_0016198 3300045051 Bacteria 8235
198 Ga0495580_0026216 3300046472 Bacteria 4252
199 Ga0495662_0291712 3300046476 Bacteria 803
200 Ga0495630_0022225 3300046517 Unclassified 4687
201 Ga0495630_0282028 3300046517 Bacteria 1269
202 Ga0495666_0025424 3300046526 Unclassified 2923
203 Ga0495586_0147837 3300046535 Unclassified 1321
204 Ga0501300_028106 3300049523 Bacteria 827
205 Ga0501031_0002189 3300049568 Bacteria 12346
206 Ga0501032_0000220 3300049569 Bacteria 47403
207 Ga0501032_0036273 3300049569 Bacteria 3366
208 Ga0501032_0058494 3300049569 Bacteria 2588
209 Ga0501033_0004321 3300049570 Bacteria 11408
210 Ga0501034_0002741 3300049571 Bacteria 20734
211 Ga0501036_0143755 3300049572 Unclassified 2012
212 Ga0501037_0121755 3300049573 Bacteria 1875
213 Ga0501039_0197436 3300049575 Bacteria 1582
214 Ga0501043_0008247 3300049579 Bacteria 8206
215 Ga0501043_0313272 3300049579 Bacteria 1197
216 Ga0501046_0001579 3300049580 Bacteria 21786
217 Ga0501047_0001380 3300049581 Bacteria 23860
218 Ga0501047_0052191 3300049581 Bacteria 3952
219 Ga0501071_0631107 3300049587 Bacteria 824
220 Ga0501035_0011217 3300049822 Bacteria 8301
221 Ga0501035_0529298 3300049822 Bacteria 967
222 Ga0501044_0000402 3300049823 Bacteria 53402
223 Ga0501044_0012809 3300049823 Bacteria 9081
224 Ga0501044_0052053 3300049823 Bacteria 4221
225 nmdc:mga05p37_1009455_c1 3300050507 Bacteria 883
226 nmdc:mga09592_135856_c1 3300050508 Bacteria 2118
227 nmdc:mga06r32_691421_c1 3300050510 Bacteria 986
228 nmdc:mga08y16_173199_c1 3300050511 Bacteria 2241
229 Ga0500559_0009577 3300053136 Bacteria 4185
230 Ga0500616_0012241 3300053153 Bacteria 5022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2738541302 2738854190 182
2 3300005841 Ga0068863_100190676 Ga0068863_1001906762 183
3 3300009551 Ga0105238_10079828 Ga0105238_100798282 183
4 3300025261 Ga0209233_1017809 Ga0209233_10178094 183
5 3300026088 Ga0207641_10189280 Ga0207641_101892802 183
6 3300029957 Ga0265324_10006932 Ga0265324_100069324 183
7 3300031240 Ga0265320_10001040 Ga0265320_1000104015 183
8 3300031251 Ga0265327_10013644 Ga0265327_100136443 183
9 3300044673 Ga0453683_0544477 Ga0453683_0544477_116_667 183
10 3300046476 Ga0495662_0291712 Ga0495662_0291712_95_646 183
11 3300049523 Ga0501300_028106 Ga0501300_028106_90_641 183
12 3300005843 Ga0068860_100042793 Ga0068860_1000427936 185
13 3300009093 Ga0105240_10000702 Ga0105240_1000070217 185
14 3300009093 Ga0105240_10158428 Ga0105240_101584284 185
15 3300009545 Ga0105237_10000895 Ga0105237_1000089514 185
16 3300009551 Ga0105238_10121527 Ga0105238_101215273 185
17 3300010375 Ga0105239_10081225 Ga0105239_100812253 185
18 3300025913 Ga0207695_10025591 Ga0207695_100255917 185
19 3300025913 Ga0207695_10075445 Ga0207695_100754452 185
20 3300025914 Ga0207671_10008940 Ga0207671_100089406 185
21 3300025924 Ga0207694_10467806 Ga0207694_104678062 185
22 3300028381 Ga0268264_10020021 Ga0268264_100200214 185
23 3300049568 Ga0501031_0002189 Ga0501031_0002189_6516_7073 185
24 3300049569 Ga0501032_0036273 Ga0501032_0036273_856_1413 185
25 3300049570 Ga0501033_0004321 Ga0501033_0004321_3249_3806 185
26 3300049822 Ga0501035_0011217 Ga0501035_0011217_811_1368 185
27 3300049823 Ga0501044_0012809 Ga0501044_0012809_7453_8010 185
28 3300053153 Ga0500616_0012241 Ga0500616_0012241_4418_4975 185
29 3300005290 Ga0065712_10261050 Ga0065712_102610501 186
30 3300005327 Ga0070658_10130117 Ga0070658_101301171 186
31 3300005329 Ga0070683_100459174 Ga0070683_1004591741 186
32 3300005330 Ga0070690_100784740 Ga0070690_1007847401 186
33 3300005336 Ga0070680_100102073 Ga0070680_1001020732 186
34 3300005339 Ga0070660_100028280 Ga0070660_1000282802 186
35 3300005355 Ga0070671_100160418 Ga0070671_1001604183 186
36 3300005364 Ga0070673_100080495 Ga0070673_1000804952 186
37 3300005366 Ga0070659_100075513 Ga0070659_1000755132 186
38 3300005457 Ga0070662_100169937 Ga0070662_1001699373 186
39 3300005535 Ga0070684_100232462 Ga0070684_1002324622 186
40 3300005539 Ga0068853_100043254 Ga0068853_1000432544 186
41 3300005547 Ga0070693_100048932 Ga0070693_1000489322 186
42 3300005563 Ga0068855_100097472 Ga0068855_1000974723 186
43 3300005564 Ga0070664_100090308 Ga0070664_1000903082 186
44 3300005577 Ga0068857_100070984 Ga0068857_1000709843 186
45 3300005614 Ga0068856_100049987 Ga0068856_1000499872 186
46 3300005616 Ga0068852_100734887 Ga0068852_1007348871 186
47 3300005834 Ga0068851_10082246 Ga0068851_100822462 186
48 3300005842 Ga0068858_100598201 Ga0068858_1005982011 186
49 3300013100 Ga0157373_10049805 Ga0157373_100498053 186
50 3300013104 Ga0157370_10104829 Ga0157370_101048293 186
51 3300013105 Ga0157369_10045672 Ga0157369_100456722 186
52 3300013297 Ga0157378_10088052 Ga0157378_100880523 186
53 3300013307 Ga0157372_10593791 Ga0157372_105937912 186
54 3300014969 Ga0157376_10584548 Ga0157376_105845481 186
55 3300025917 Ga0207660_10135088 Ga0207660_101350882 186
56 3300025920 Ga0207649_10699179 Ga0207649_106991791 186
57 3300025926 Ga0207659_10295200 Ga0207659_102952002 186
58 3300025933 Ga0207706_10055766 Ga0207706_100557663 186
59 3300025945 Ga0207679_10377382 Ga0207679_103773822 186
60 3300026035 Ga0207703_11221082 Ga0207703_112210821 186
61 3300026116 Ga0207674_10275759 Ga0207674_102757592 186
62 3300031824 Ga0307413_10491932 Ga0307413_104919321 186
63 3300032004 Ga0307414_10243604 Ga0307414_102436042 186
64 3300046472 Ga0495580_0026216 Ga0495580_0026216_2681_3241 186
65 3300009098 Ga0105245_10910383 Ga0105245_109103832 187
66 3300009553 Ga0105249_11770085 Ga0105249_117700851 187
67 3300021361 Ga0213872_10029500 Ga0213872_100295001 187
68 iso_pu_bacteria 2842722452 2842726729 187
69 iso_pu_bacteria 2842909656 2842911568 187
70 3300005336 Ga0070680_100269226 Ga0070680_1002692262 188
71 3300005547 Ga0070693_100018106 Ga0070693_1000181062 188
72 3300005563 Ga0068855_100114722 Ga0068855_1001147224 188
73 3300005577 Ga0068857_100950026 Ga0068857_1009500261 188
74 3300005614 Ga0068856_100000067 Ga0068856_10000006781 188
75 3300009093 Ga0105240_10067682 Ga0105240_100676826 188
76 3300009174 Ga0105241_10098565 Ga0105241_100985652 188
77 3300013100 Ga0157373_10009686 Ga0157373_100096866 188
78 3300013297 Ga0157378_10232924 Ga0157378_102329243 188
79 3300025272 Ga0209455_1000697 Ga0209455_100069712 188
80 3300025911 Ga0207654_10115330 Ga0207654_101153303 188
81 3300025913 Ga0207695_10019280 Ga0207695_100192805 188
82 3300025913 Ga0207695_10075005 Ga0207695_100750052 188
83 3300025949 Ga0207667_10509350 Ga0207667_105093502 188
84 3300026041 Ga0207639_10052558 Ga0207639_100525583 188
85 3300026078 Ga0207702_10002905 Ga0207702_100029052 188
86 3300026116 Ga0207674_10948871 Ga0207674_109488712 188
87 3300027471 Ga0209995_1003325 Ga0209995_10033253 188
88 3300027526 Ga0209968_1025873 Ga0209968_10258731 188
89 3300028800 Ga0265338_10089341 Ga0265338_100893414 188
90 3300031507 Ga0307509_10020912 Ga0307509_100209128 188
91 3300034817 Ga0373948_0093801 Ga0373948_0093801_118_687 188
92 3300034818 Ga0373950_0001161 Ga0373950_0001161_1298_1897 188
93 3300035084 Ga0373928_0000040 Ga0373928_0000040_16480_17079 188
94 3300035085 Ga0373929_0000353 Ga0373929_0000353_1358_1957 188
95 3300035089 Ga0373944_0000214 Ga0373944_0000214_2364_2963 188
96 3300035090 Ga0373949_0001509 Ga0373949_0001509_159_758 188
97 3300035091 Ga0373951_0002578 Ga0373951_0002578_396_995 188
98 3300035112 Ga0373932_0000006 Ga0373932_0000006_160693_161292 188
99 3300035116 Ga0373945_0008649 Ga0373945_0008649_1281_1880 188
100 3300035242 Ga0373962_0000031 Ga0373962_0000031_18945_19544 188
101 3300035691 Ga0373931_0000009 Ga0373931_0000009_159008_159607 188
102 3300035695 Ga0373927_0006395 Ga0373927_0006395_1017_1616 188
103 3300036401 Ga0373937_0309111 Ga0373937_0309111_637_1206 188
104 3300037068 Ga0373925_0000235 Ga0373925_0000235_57776_58375 188
105 3300037068 Ga0373925_1157587 Ga0373925_1157587_35_604 188
106 3300046517 Ga0495630_0282028 Ga0495630_0282028_371_940 188
107 3300046535 Ga0495586_0147837 Ga0495586_0147837_423_992 188
108 3300005355 Ga0070671_100928209 Ga0070671_1009282092 189
109 3300003322 rootL2_10264976 rootL2_102649762 190
110 3300003323 rootH1_10139375 rootH1_101393756 190
111 3300003323 rootH1_10320401 rootH1_103204012 190
112 3300005293 Ga0065715_10000846 Ga0065715_100008465 190
113 3300005329 Ga0070683_100003235 Ga0070683_10000323511 190
114 3300005329 Ga0070683_100025931 Ga0070683_1000259313 190
115 3300005330 Ga0070690_100043407 Ga0070690_1000434072 190
116 3300005343 Ga0070687_100041599 Ga0070687_1000415993 190
117 3300005344 Ga0070661_100069214 Ga0070661_1000692142 190
118 3300005345 Ga0070692_10249224 Ga0070692_102492241 190
119 3300005354 Ga0070675_100231906 Ga0070675_1002319061 190
120 3300005436 Ga0070713_100094839 Ga0070713_1000948393 190
121 3300005458 Ga0070681_10527411 Ga0070681_105274111 190
122 3300005530 Ga0070679_100493095 Ga0070679_1004930952 190
123 3300005543 Ga0070672_100014325 Ga0070672_1000143255 190
124 3300005547 Ga0070693_100367890 Ga0070693_1003678901 190
125 3300005564 Ga0070664_100001016 Ga0070664_10000101610 190
126 3300005577 Ga0068857_100095404 Ga0068857_1000954044 190
127 3300005614 Ga0068856_100005677 Ga0068856_10000567710 190
128 3300005719 Ga0068861_100399647 Ga0068861_1003996472 190
129 3300005841 Ga0068863_100755759 Ga0068863_1007557591 190
130 3300006028 Ga0070717_10822275 Ga0070717_108222751 190
131 3300006173 Ga0070716_100572823 Ga0070716_1005728231 190
132 3300006844 Ga0075428_100113718 Ga0075428_1001137182 190
133 3300006880 Ga0075429_100123366 Ga0075429_1001233662 190
134 3300009093 Ga0105240_10871177 Ga0105240_108711772 190
135 3300009094 Ga0111539_10282786 Ga0111539_102827862 190
136 3300009147 Ga0114129_10049971 Ga0114129_100499712 190
137 3300009176 Ga0105242_10866092 Ga0105242_108660922 190
138 3300013105 Ga0157369_10013414 Ga0157369_100134142 190
139 3300013105 Ga0157369_10442142 Ga0157369_104421421 190
140 3300013296 Ga0157374_10077678 Ga0157374_100776782 190
141 3300013297 Ga0157378_10010592 Ga0157378_1001059210 190
142 3300025901 Ga0207688_10005502 Ga0207688_100055028 190
143 3300025907 Ga0207645_10009683 Ga0207645_100096839 190
144 3300025912 Ga0207707_10454265 Ga0207707_104542652 190
145 3300025920 Ga0207649_10202664 Ga0207649_102026642 190
146 3300025928 Ga0207700_10906936 Ga0207700_109069362 190
147 3300025929 Ga0207664_10011090 Ga0207664_100110904 190
148 3300025936 Ga0207670_10462742 Ga0207670_104627422 190
149 3300025940 Ga0207691_10009816 Ga0207691_1000981611 190
150 3300025944 Ga0207661_10001527 Ga0207661_100015271 190
151 3300025944 Ga0207661_10018584 Ga0207661_100185843 190
152 3300025945 Ga0207679_10080762 Ga0207679_100807621 190
153 3300025949 Ga0207667_10186948 Ga0207667_101869483 190
154 3300026035 Ga0207703_10854100 Ga0207703_108541001 190
155 3300026078 Ga0207702_10001130 Ga0207702_1000113015 190
156 3300026088 Ga0207641_10016517 Ga0207641_100165172 190
157 3300026088 Ga0207641_10645836 Ga0207641_106458362 190
158 3300026116 Ga0207674_10064386 Ga0207674_100643864 190
159 3300026118 Ga0207675_100180702 Ga0207675_1001807023 190
160 3300028556 Ga0265337_1001121 Ga0265337_100112114 190
161 3300028556 Ga0265337_1005069 Ga0265337_10050696 190
162 3300028558 Ga0265326_10004743 Ga0265326_100047434 190
163 3300028558 Ga0265326_10040276 Ga0265326_100402762 190
164 3300028563 Ga0265319_1002417 Ga0265319_10024177 190
165 3300028563 Ga0265319_1024342 Ga0265319_10243422 190
166 3300028654 Ga0265322_10033315 Ga0265322_100333151 190
167 3300028666 Ga0265336_10015615 Ga0265336_100156151 190
168 3300028794 Ga0307515_10320411 Ga0307515_103204112 190
169 3300028800 Ga0265338_10001724 Ga0265338_1000172423 190
170 3300028800 Ga0265338_10008409 Ga0265338_100084096 190
171 3300028800 Ga0265338_10039348 Ga0265338_100393486 190
172 3300028800 Ga0265338_10143881 Ga0265338_101438811 190
173 3300029957 Ga0265324_10000359 Ga0265324_1000035910 190
174 3300029957 Ga0265324_10012343 Ga0265324_100123433 190
175 3300031240 Ga0265320_10000071 Ga0265320_1000007169 190
176 3300031240 Ga0265320_10000925 Ga0265320_100009259 190
177 3300031240 Ga0265320_10019961 Ga0265320_100199613 190
178 3300031240 Ga0265320_10038216 Ga0265320_100382162 190
179 3300031241 Ga0265325_10084107 Ga0265325_100841073 190
180 3300031249 Ga0265339_10007592 Ga0265339_100075926 190
181 3300031251 Ga0265327_10000520 Ga0265327_100005207 190
182 3300031344 Ga0265316_10001457 Ga0265316_100014577 190
183 3300031344 Ga0265316_10016719 Ga0265316_100167196 190
184 3300031595 Ga0265313_10000350 Ga0265313_1000035041 190
185 3300031595 Ga0265313_10003278 Ga0265313_100032787 190
186 3300031595 Ga0265313_10005816 Ga0265313_100058163 190
187 3300031711 Ga0265314_10001713 Ga0265314_100017134 190
188 3300031712 Ga0265342_10058308 Ga0265342_100583083 190
189 3300031712 Ga0265342_10064541 Ga0265342_100645412 190
190 3300031995 Ga0307409_101225898 Ga0307409_1012258981 190
191 3300035091 Ga0373951_0006849 Ga0373951_0006849_330_902 190
192 3300035116 Ga0373945_0047993 Ga0373945_0047993_532_1113 190
193 3300035170 Ga0373943_0022960 Ga0373943_0022960_1385_1966 190
194 3300035692 Ga0373935_0091778 Ga0373935_0091778_669_1250 190
195 3300035695 Ga0373927_0004929 Ga0373927_0004929_1187_1768 190
196 3300035725 Ga0373947_0024986 Ga0373947_0024986_42_623 190
197 3300035725 Ga0373947_0156246 Ga0373947_0156246_419_991 190
198 3300037068 Ga0373925_0006052 Ga0373925_0006052_6895_7476 190
199 3300037312 Ga0395899_0031708 Ga0395899_0031708_3163_3744 190
200 3300037466 Ga0395898_0003129 Ga0395898_0003129_6036_6617 190
201 3300038443 Ga0395901_0024188 Ga0395901_0024188_117_698 190
202 3300039447 Ga0436361_0635236 Ga0436361_0635236_4388_4960 190
203 3300042876 Ga0451577_0040661 Ga0451577_0040661_700_1347 190
204 3300042876 Ga0451577_0143001 Ga0451577_0143001_374_949 190
205 3300044673 Ga0453683_0002026 Ga0453683_0002026_8857_9429 190
206 3300044693 Ga0466961_0200515 Ga0466961_0200515_636_1208 190
207 3300044712 Ga0453684_0000001 Ga0453684_0000001_190591_191238 190
208 3300044712 Ga0453684_0017450 Ga0453684_0017450_8924_9499 190
209 3300044712 Ga0453684_0055790 Ga0453684_0055790_1822_2394 190
210 3300044712 Ga0453684_0321806 Ga0453684_0321806_681_1253 190
211 3300045051 Ga0451576_0016198 Ga0451576_0016198_7261_7833 190
212 3300046517 Ga0495630_0022225 Ga0495630_0022225_2920_3501 190
213 3300046526 Ga0495666_0025424 Ga0495666_0025424_226_807 190
214 3300049569 Ga0501032_0000220 Ga0501032_0000220_22625_23197 190
215 3300049569 Ga0501032_0058494 Ga0501032_0058494_848_1432 190
216 3300049571 Ga0501034_0002741 Ga0501034_0002741_19138_19722 190
217 3300049572 Ga0501036_0143755 Ga0501036_0143755_1217_1789 190
218 3300049573 Ga0501037_0121755 Ga0501037_0121755_717_1301 190
219 3300049575 Ga0501039_0197436 Ga0501039_0197436_636_1220 190
220 3300049579 Ga0501043_0008247 Ga0501043_0008247_3026_3598 190
221 3300049579 Ga0501043_0313272 Ga0501043_0313272_145_729 190
222 3300049580 Ga0501046_0001579 Ga0501046_0001579_5161_5733 190
223 3300049581 Ga0501047_0001380 Ga0501047_0001380_15182_15793 190
224 3300049581 Ga0501047_0052191 Ga0501047_0052191_3042_3626 190
225 3300049587 Ga0501071_0631107 Ga0501071_0631107_87_659 190
226 3300049822 Ga0501035_0529298 Ga0501035_0529298_201_773 190
227 3300049823 Ga0501044_0000402 Ga0501044_0000402_24_596 190
228 3300049823 Ga0501044_0052053 Ga0501044_0052053_759_1343 190
229 3300050507 nmdc:mga05p37_1009455_c1 nmdc:mga05p37_1009455_c1_148_765 190
230 3300050508 nmdc:mga09592_135856_c1 nmdc:mga09592_135856_c1_617_1234 190
231 3300050510 nmdc:mga06r32_691421_c1 nmdc:mga06r32_691421_c1_48_665 190
232 3300050511 nmdc:mga08y16_173199_c1 nmdc:mga08y16_173199_c1_601_1218 190
233 3300053136 Ga0500559_0009577 Ga0500559_0009577_1838_2413 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14066

DUF4256

Protein of unknown function (DUF4256)

54

226

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y4j-assembly1.cif.gz_A crystal structure of the paralogue of the human formylglycine generating enzyme 0.7268 140 190
8oks-assembly1.cif.gz_A crystal structure of bdellovibrio bacteriovorus bd2740 c-terminal domain 0.7078 61 188
5aoh-assembly2.cif.gz_B crystal structure of carf 0.6993 135 190
7sa7-assembly2.cif.gz_B crystal structure of the apo sh2 domains of syk 0.6802 123 172
8oks-assembly1.cif.gz_A crystal structure of bdellovibrio bacteriovorus bd2740 c-terminal domain 0.6689 61 188
ID Description Score Start End Superfamily
af_Q22625_36_309_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7564 145 174 2.120.10.30
af_Q94AA3_277_328_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.7104 145 174 2.30.30.30
af_Q6IGS3_20_147_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.673 112 187 3.10.100.10
af_A0A0K3AS36_963_1030_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.6671 143 176 2.30.30.40
af_Q10BA7_272_328_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.6559 145 174 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A7X6SAK1-F1-model_v4 DUF4256 domain-containing protein 0.9981 52 190
AF-A0A6N7R535-F1-model_v4 GNAT family N-acetyltransferase 0.9974 8 190 GO:0016747
AF-A0A261QE04-F1-model_v4 YdhG-like domain-containing protein 0.9971 6 190
AF-A0A432K9I1-F1-model_v4 DUF4256 domain-containing protein 0.9971 22 190
AF-A0A0J7J108-F1-model_v4 DUF4256 domain-containing protein 0.9968 15 190

Feature Viewer

pLDDT pTM Quality
94.55 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map