F345587

General Info

Members Datasets Scaffolds Average Seq Length
232 152 464 118

Family's Representative Sequence

Representative Sequence 3300053142|Ga0500577_0005854|Ga0500577_0005854_1253_1669
Length 138
Sequence MSPPCHEEKVAMARYMLSVHSDKASEVREPVSEEAMRQSHARLGQIEQEMATTGAWVFSGRLHEPETATVVRVAGGEVLTTDGPFAESKDHLGGFYVIEAVDLDAALGWAAKVTACIDAAIEVRPFAGFADKPTDFPA

Samples

Sample ID Description Type Environment
1 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
95 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
99 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
100 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
151 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 2.59
Rhizosphere 92.67
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500577_0005854 3300053142 Bacteria 3346
2 Ga0070683_100775189 3300005329 Bacteria 919
3 Ga0070682_101342910 3300005337 Bacteria 609
4 Ga0070687_100207175 3300005343 Bacteria 1192
5 Ga0070675_101101833 3300005354 Bacteria 730
6 Ga0070674_101610825 3300005356 Bacteria 586
7 Ga0070674_101699960 3300005356 Bacteria 571
8 Ga0070673_101924795 3300005364 Bacteria 561
9 Ga0070688_101705180 3300005365 Bacteria 516
10 Ga0070659_100327671 3300005366 Bacteria 1281
11 Ga0070659_101517635 3300005366 Bacteria 597
12 Ga0070701_10931399 3300005438 Bacteria 602
13 Ga0070694_100114157 3300005444 Bacteria 1928
14 Ga0070708_100001061 3300005445 Bacteria 20977
15 Ga0070681_10560198 3300005458 Bacteria 1057
16 Ga0070681_11887113 3300005458 Bacteria 525
17 Ga0070706_100104970 3300005467 Bacteria 2629
18 Ga0070706_101009627 3300005467 Bacteria 767
19 Ga0070707_100171631 3300005468 Bacteria 2113
20 Ga0070698_100396807 3300005471 Unclassified 1312
21 Ga0070699_100337131 3300005518 Unclassified 1357
22 Ga0070679_100856101 3300005530 Bacteria 852
23 Ga0070684_100751778 3300005535 Bacteria 910
24 Ga0068853_100796141 3300005539 Bacteria 905
25 Ga0070695_100112709 3300005545 Bacteria 1848
26 Ga0070696_100023182 3300005546 Bacteria 4218
27 Ga0070696_100145934 3300005546 Bacteria 1733
28 Ga0070704_100200455 3300005549 Bacteria 1611
29 Ga0068852_101578266 3300005616 Bacteria 679
30 Ga0068852_102618200 3300005616 Unclassified 524
31 Ga0068870_10619021 3300005840 Bacteria 738
32 Ga0068860_100421994 3300005843 Bacteria 1322
33 Ga0081455_10018566 3300005937 Bacteria 6615
34 Ga0081455_10057310 3300005937 Bacteria 3302
35 Ga0081455_10363640 3300005937 Bacteria 1016
36 Ga0081538_10009360 3300005981 Bacteria 8186
37 Ga0081538_10040988 3300005981 Bacteria 2945
38 Ga0075428_100001090 3300006844 Bacteria 28871
39 Ga0075430_100074645 3300006846 Bacteria 2843
40 Ga0075430_100152564 3300006846 Bacteria 1924
41 Ga0075430_100152988 3300006846 Bacteria 1921
42 Ga0075430_100220993 3300006846 Bacteria 1572
43 Ga0075431_100057221 3300006847 Bacteria 4021
44 Ga0075431_100286156 3300006847 Bacteria 1668
45 Ga0075431_100591795 3300006847 Bacteria 1094
46 Ga0075431_100754244 3300006847 Bacteria 948
47 Ga0075433_10029318 3300006852 Bacteria 4686
48 Ga0075433_10289628 3300006852 Bacteria 1450
49 Ga0075433_11093786 3300006852 Bacteria 693
50 Ga0075434_100076199 3300006871 Bacteria 3349
51 Ga0075434_100476059 3300006871 Bacteria 1270
52 Ga0075429_100200061 3300006880 Bacteria 1750
53 Ga0075429_100441159 3300006880 Bacteria 1141
54 Ga0075429_100743516 3300006880 Bacteria 859
55 Ga0068865_101704316 3300006881 Bacteria 568
56 Ga0075435_100203799 3300007076 Bacteria 1676
57 Ga0075435_101438531 3300007076 Bacteria 604
58 Ga0105240_10076141 3300009093 Bacteria 4137
59 Ga0105245_10002498 3300009098 Bacteria 16585
60 Ga0105247_11158973 3300009101 Bacteria 613
61 Ga0114129_10217875 3300009147 Bacteria 2577
62 Ga0114129_10245513 3300009147 Bacteria 2405
63 Ga0114129_10810614 3300009147 Bacteria 1193
64 Ga0105243_10765907 3300009148 Bacteria 948
65 Ga0105249_12742093 3300009553 Bacteria 565
66 Ga0163162_11351085 3300013306 Bacteria 810
67 Ga0157375_10085837 3300013308 Bacteria 3198
68 Ga0157375_10368803 3300013308 Bacteria 1602
69 Ga0157375_11661569 3300013308 Bacteria 756
70 Ga0157380_11472588 3300014326 Bacteria 733
71 Ga0157379_10262526 3300014968 Bacteria 1569
72 Ga0157376_11127188 3300014969 Bacteria 811
73 Ga0207696_1074790 3300025711 Bacteria 939
74 Ga0207653_10098183 3300025885 Bacteria 1033
75 Ga0207705_10180605 3300025909 Bacteria 1592
76 Ga0207684_10058513 3300025910 Bacteria 3271
77 Ga0207684_10150822 3300025910 Bacteria 2000
78 Ga0207684_10258914 3300025910 Bacteria 1501
79 Ga0207684_10320340 3300025910 Bacteria 1336
80 Ga0207707_10483125 3300025912 Bacteria 1058
81 Ga0207695_10536268 3300025913 Bacteria 1052
82 Ga0207660_10705371 3300025917 Unclassified 823
83 Ga0207662_10277193 3300025918 Bacteria 1108
84 Ga0207662_10425884 3300025918 Bacteria 904
85 Ga0207662_10819422 3300025918 Bacteria 657
86 Ga0207657_11104437 3300025919 Bacteria 606
87 Ga0207652_10706293 3300025921 Bacteria 899
88 Ga0207646_10392170 3300025922 Bacteria 1254
89 Ga0207687_10009463 3300025927 Bacteria 6371
90 Ga0207687_10244660 3300025927 Bacteria 1423
91 Ga0207709_10799350 3300025935 Bacteria 761
92 Ga0207661_10334060 3300025944 Bacteria 1365
93 Ga0207679_10562963 3300025945 Bacteria 1024
94 Ga0207679_11567461 3300025945 Bacteria 604
95 Ga0207712_10164449 3300025961 Bacteria 1728
96 Ga0207640_11414785 3300025981 Bacteria 623
97 Ga0207708_11182870 3300026075 Bacteria 668
98 Ga0207683_10825894 3300026121 Bacteria 860
99 Ga0268266_11029387 3300028379 Bacteria 797
100 Ga0268264_11627977 3300028381 Bacteria 656
101 Ga0307512_10359293 3300030522 Bacteria 636
102 Ga0307513_10616183 3300031456 Bacteria 794
103 Ga0307408_100158509 3300031548 Bacteria 1795
104 Ga0307408_100742531 3300031548 Bacteria 886
105 Ga0307405_10091349 3300031731 Bacteria 2017
106 Ga0307405_12028966 3300031731 Bacteria 515
107 Ga0307413_10015391 3300031824 Bacteria 3918
108 Ga0307413_10154626 3300031824 Bacteria 1603
109 Ga0307410_10104358 3300031852 Bacteria 2038
110 Ga0307410_10427114 3300031852 Unclassified 1076
111 Ga0307410_10869996 3300031852 Bacteria 770
112 Ga0307407_10033701 3300031903 Bacteria 2797
113 Ga0307407_10621495 3300031903 Bacteria 806
114 Ga0307412_10909504 3300031911 Bacteria 772
115 Ga0307409_100021326 3300031995 Bacteria 4439
116 Ga0307409_100050883 3300031995 Bacteria 3167
117 Ga0307409_100076125 3300031995 Bacteria 2690
118 Ga0307409_100170480 3300031995 Bacteria 1915
119 Ga0307409_100975960 3300031995 Unclassified 864
120 Ga0307409_101058176 3300031995 Bacteria 831
121 Ga0307416_100412257 3300032002 Bacteria 1392
122 Ga0307416_100505993 3300032002 Bacteria 1273
123 Ga0307416_101168388 3300032002 Bacteria 875
124 Ga0307416_103636240 3300032002 Bacteria 516
125 Ga0307414_11858526 3300032004 Bacteria 562
126 Ga0307411_11081147 3300032005 Bacteria 722
127 Ga0307415_100015072 3300032126 Bacteria 4565
128 Ga0307415_100219194 3300032126 Bacteria 1524
129 Ga0307415_100386289 3300032126 Bacteria 1190
130 Ga0307415_100471745 3300032126 Bacteria 1090
131 Ga0307415_100830529 3300032126 Bacteria 846
132 Ga0307415_101505499 3300032126 Bacteria 644
133 Ga0307507_10000110 3300033179 Bacteria 135506
134 Ga0307507_10200262 3300033179 Bacteria 1383
135 Ga0307507_10382902 3300033179 Bacteria 809
136 Ga0373953_0300545 3300035117 Bacteria 700
137 Ga0373956_0043118 3300035119 Bacteria 2008
138 Ga0373957_0528251 3300035120 Bacteria 515
139 Ga0373925_0699521 3300037068 Bacteria 836
140 Ga0395899_0014066 3300037312 Bacteria 6108
141 Ga0395900_0022114 3300037418 Bacteria 6505
142 Ga0395898_0003443 3300037466 Bacteria 17693
143 Ga0395905_0005011 3300037471 Bacteria 13641
144 Ga0395901_0045806 3300038443 Bacteria 4540
145 Ga0395901_1804399 3300038443 Bacteria 561
146 Ga0436365_1540044 3300039437 Bacteria 985
147 Ga0436360_0114276 3300039438 Bacteria 1232
148 Ga0436360_0320984 3300039438 Bacteria 1173
149 Ga0451800_0779320 3300041459 Bacteria 543
150 Ga0451839_0450292 3300041496 Bacteria 719
151 Ga0451853_3255548 3300041512 Bacteria 611
152 Ga0439448_0103379 3300042005 Bacteria 970
153 Ga0439454_004192 3300042011 Bacteria 1647
154 Ga0439463_022582 3300042016 Bacteria 1575
155 Ga0439463_055253 3300042016 Bacteria 1014
156 Ga0439459_0010860 3300042438 Bacteria 1596
157 Ga0466965_0141865 3300044683 Bacteria 1251
158 Ga0466961_0013148 3300044693 Bacteria 5296
159 Ga0466971_0002978 3300044719 Bacteria 7190
160 Ga0466971_0250775 3300044719 Bacteria 843
161 Ga0466970_0892622 3300044765 Bacteria 523
162 Ga0466957_0400735 3300044842 Bacteria 938
163 Ga0466957_0547547 3300044842 Bacteria 806
164 Ga0466959_0000553 3300045049 Bacteria 21758
165 Ga0466959_0023455 3300045049 Bacteria 4565
166 Ga0466959_1015235 3300045049 Bacteria 552
167 Ga0466958_0511790 3300045836 Bacteria 779
168 Ga0495592_0063477 3300046454 Bacteria 2709
169 Ga0495653_0211192 3300046463 Bacteria 1311
170 Ga0495650_0000012 3300046471 Bacteria 613144
171 Ga0495608_0016545 3300046511 Bacteria 5103
172 Ga0495586_0060033 3300046535 Bacteria 2067
173 Ga0495680_0726154 3300047322 Bacteria 654
174 Ga0495675_0003543 3300047444 Bacteria 9408
175 Ga0495684_0047085 3300047471 Bacteria 3299
176 Ga0495602_0007147 3300048088 Bacteria 11695
177 Ga0496100_1620063 3300048903 Unclassified 512
178 Ga0496108_0847537 3300048911 Bacteria 787
179 Ga0496109_0484379 3300048912 Bacteria 1168
180 Ga0496114_0257185 3300048917 Bacteria 1537
181 Ga0496114_0860734 3300048917 Bacteria 787
182 Ga0501034_0008600 3300049571 Bacteria 10773
183 Ga0501034_0255199 3300049571 Bacteria 1697
184 Ga0501036_0586727 3300049572 Bacteria 925
185 Ga0501037_0666566 3300049573 Bacteria 694
186 Ga0501038_0491929 3300049574 Bacteria 939
187 Ga0501039_0892845 3300049575 Bacteria 692
188 Ga0501042_0391317 3300049578 Bacteria 1007
189 Ga0501043_0012010 3300049579 Bacteria 6775
190 Ga0501046_0026726 3300049580 Bacteria 4714
191 Ga0501047_0162705 3300049581 Bacteria 2103
192 Ga0501047_0184259 3300049581 Bacteria 1953
193 Ga0501047_0505484 3300049581 Bacteria 1035
194 Ga0501047_1309340 3300049581 Bacteria 539
195 Ga0501048_0427039 3300049582 Bacteria 948
196 Ga0501069_0583118 3300049585 Bacteria 670
197 Ga0501070_0084159 3300049586 Bacteria 2633
198 Ga0501070_0206102 3300049586 Bacteria 1614
199 Ga0501071_0076726 3300049587 Bacteria 2441
200 Ga0501073_0173458 3300049589 Bacteria 1493
201 Ga0501074_0052018 3300049590 Bacteria 2957
202 Ga0501074_0173006 3300049590 Bacteria 1541
203 Ga0501077_1057691 3300049593 Bacteria 522
204 Ga0501079_0743242 3300049741 Bacteria 772
205 Ga0501080_0028858 3300049742 Bacteria 5165
206 Ga0501080_0789501 3300049742 Bacteria 833
207 Ga0501083_0060548 3300049744 Bacteria 2529
208 Ga0501044_0132076 3300049823 Bacteria 2490
209 Ga0501044_0803568 3300049823 Bacteria 820
210 nmdc:mga0k408_576371_c1 3300050493 Unclassified 664
211 nmdc:mga05p37_289407_c1 3300050507 Bacteria 1950
212 nmdc:mga05p37_516746_c1 3300050507 Bacteria 1367
213 nmdc:mga05p37_590735_c1 3300050507 Bacteria 1255
214 nmdc:mga05p37_6158_c1 3300050507 Bacteria 14121
215 nmdc:mga09592_518405_c1 3300050508 Bacteria 1025
216 nmdc:mga0qj67_103443_c1 3300050509 Bacteria 2297
217 nmdc:mga0qj67_108567_c1 3300050509 Bacteria 2239
218 nmdc:mga0qj67_845003_c1 3300050509 Bacteria 723
219 nmdc:mga06r32_154774_c1 3300050510 Bacteria 2273
220 nmdc:mga06r32_298355_c1 3300050510 Bacteria 1598
221 nmdc:mga06r32_581743_c1 3300050510 Bacteria 1092
222 nmdc:mga06r32_930152_c1 3300050510 Bacteria 825
223 nmdc:mga0n895_139995_c1 3300050512 Bacteria 2447
224 nmdc:mga0n895_56307_c1 3300050512 Bacteria 3873
225 nmdc:mga0rr50_513976_c1 3300050513 Bacteria 1019
226 nmdc:mga0rr50_609128_c1 3300050513 Bacteria 931
227 nmdc:mga0a205_327485_c1 3300050515 Bacteria 1402
228 nmdc:mga0a205_731329_c1 3300050515 Bacteria 839
229 Ga0495601_0084485 3300053077 Bacteria 2039
230 Ga0500583_0118114 3300053092 Bacteria 1311
231 Ga0590075_086356 3300059424 Bacteria 814
232 Ga0466962_0030136 3300061719 Bacteria 2597
233 Ga0500577_0005854
234 Ga0070683_100775189
235 Ga0070682_101342910
236 Ga0070687_100207175
237 Ga0070675_101101833
238 Ga0070674_101610825
239 Ga0070674_101699960
240 Ga0070673_101924795
241 Ga0070688_101705180
242 Ga0070659_100327671
243 Ga0070659_101517635
244 Ga0070701_10931399
245 Ga0070694_100114157
246 Ga0070708_100001061
247 Ga0070681_10560198
248 Ga0070681_11887113
249 Ga0070706_100104970
250 Ga0070706_101009627
251 Ga0070707_100171631
252 Ga0070698_100396807
253 Ga0070699_100337131
254 Ga0070679_100856101
255 Ga0070684_100751778
256 Ga0068853_100796141
257 Ga0070695_100112709
258 Ga0070696_100023182
259 Ga0070696_100145934
260 Ga0070704_100200455
261 Ga0068852_101578266
262 Ga0068852_102618200
263 Ga0068870_10619021
264 Ga0068860_100421994
265 Ga0081455_10018566
266 Ga0081455_10057310
267 Ga0081455_10363640
268 Ga0081538_10009360
269 Ga0081538_10040988
270 Ga0075428_100001090
271 Ga0075430_100074645
272 Ga0075430_100152564
273 Ga0075430_100152988
274 Ga0075430_100220993
275 Ga0075431_100057221
276 Ga0075431_100286156
277 Ga0075431_100591795
278 Ga0075431_100754244
279 Ga0075433_10029318
280 Ga0075433_10289628
281 Ga0075433_11093786
282 Ga0075434_100076199
283 Ga0075434_100476059
284 Ga0075429_100200061
285 Ga0075429_100441159
286 Ga0075429_100743516
287 Ga0068865_101704316
288 Ga0075435_100203799
289 Ga0075435_101438531
290 Ga0105240_10076141
291 Ga0105245_10002498
292 Ga0105247_11158973
293 Ga0114129_10217875
294 Ga0114129_10245513
295 Ga0114129_10810614
296 Ga0105243_10765907
297 Ga0105249_12742093
298 Ga0163162_11351085
299 Ga0157375_10085837
300 Ga0157375_10368803
301 Ga0157375_11661569
302 Ga0157380_11472588
303 Ga0157379_10262526
304 Ga0157376_11127188
305 Ga0207696_1074790
306 Ga0207653_10098183
307 Ga0207705_10180605
308 Ga0207684_10058513
309 Ga0207684_10150822
310 Ga0207684_10258914
311 Ga0207684_10320340
312 Ga0207707_10483125
313 Ga0207695_10536268
314 Ga0207660_10705371
315 Ga0207662_10277193
316 Ga0207662_10425884
317 Ga0207662_10819422
318 Ga0207657_11104437
319 Ga0207652_10706293
320 Ga0207646_10392170
321 Ga0207687_10009463
322 Ga0207687_10244660
323 Ga0207709_10799350
324 Ga0207661_10334060
325 Ga0207679_10562963
326 Ga0207679_11567461
327 Ga0207712_10164449
328 Ga0207640_11414785
329 Ga0207708_11182870
330 Ga0207683_10825894
331 Ga0268266_11029387
332 Ga0268264_11627977
333 Ga0307512_10359293
334 Ga0307513_10616183
335 Ga0307408_100158509
336 Ga0307408_100742531
337 Ga0307405_10091349
338 Ga0307405_12028966
339 Ga0307413_10015391
340 Ga0307413_10154626
341 Ga0307410_10104358
342 Ga0307410_10427114
343 Ga0307410_10869996
344 Ga0307407_10033701
345 Ga0307407_10621495
346 Ga0307412_10909504
347 Ga0307409_100021326
348 Ga0307409_100050883
349 Ga0307409_100076125
350 Ga0307409_100170480
351 Ga0307409_100975960
352 Ga0307409_101058176
353 Ga0307416_100412257
354 Ga0307416_100505993
355 Ga0307416_101168388
356 Ga0307416_103636240
357 Ga0307414_11858526
358 Ga0307411_11081147
359 Ga0307415_100015072
360 Ga0307415_100219194
361 Ga0307415_100386289
362 Ga0307415_100471745
363 Ga0307415_100830529
364 Ga0307415_101505499
365 Ga0307507_10000110
366 Ga0307507_10200262
367 Ga0307507_10382902
368 Ga0373953_0300545
369 Ga0373956_0043118
370 Ga0373957_0528251
371 Ga0373925_0699521
372 Ga0395899_0014066
373 Ga0395900_0022114
374 Ga0395898_0003443
375 Ga0395905_0005011
376 Ga0395901_0045806
377 Ga0395901_1804399
378 Ga0436365_1540044
379 Ga0436360_0114276
380 Ga0436360_0320984
381 Ga0451800_0779320
382 Ga0451839_0450292
383 Ga0451853_3255548
384 Ga0439448_0103379
385 Ga0439454_004192
386 Ga0439463_022582
387 Ga0439463_055253
388 Ga0439459_0010860
389 Ga0466965_0141865
390 Ga0466961_0013148
391 Ga0466971_0002978
392 Ga0466971_0250775
393 Ga0466970_0892622
394 Ga0466957_0400735
395 Ga0466957_0547547
396 Ga0466959_0000553
397 Ga0466959_0023455
398 Ga0466959_1015235
399 Ga0466958_0511790
400 Ga0495592_0063477
401 Ga0495653_0211192
402 Ga0495650_0000012
403 Ga0495608_0016545
404 Ga0495586_0060033
405 Ga0495680_0726154
406 Ga0495675_0003543
407 Ga0495684_0047085
408 Ga0495602_0007147
409 Ga0496100_1620063
410 Ga0496108_0847537
411 Ga0496109_0484379
412 Ga0496114_0257185
413 Ga0496114_0860734
414 Ga0501034_0008600
415 Ga0501034_0255199
416 Ga0501036_0586727
417 Ga0501037_0666566
418 Ga0501038_0491929
419 Ga0501039_0892845
420 Ga0501042_0391317
421 Ga0501043_0012010
422 Ga0501046_0026726
423 Ga0501047_0162705
424 Ga0501047_0184259
425 Ga0501047_0505484
426 Ga0501047_1309340
427 Ga0501048_0427039
428 Ga0501069_0583118
429 Ga0501070_0084159
430 Ga0501070_0206102
431 Ga0501071_0076726
432 Ga0501073_0173458
433 Ga0501074_0052018
434 Ga0501074_0173006
435 Ga0501077_1057691
436 Ga0501079_0743242
437 Ga0501080_0028858
438 Ga0501080_0789501
439 Ga0501083_0060548
440 Ga0501044_0132076
441 Ga0501044_0803568
442 nmdc:mga0k408_576371_c1
443 nmdc:mga05p37_289407_c1
444 nmdc:mga05p37_516746_c1
445 nmdc:mga05p37_590735_c1
446 nmdc:mga05p37_6158_c1
447 nmdc:mga09592_518405_c1
448 nmdc:mga0qj67_103443_c1
449 nmdc:mga0qj67_108567_c1
450 nmdc:mga0qj67_845003_c1
451 nmdc:mga06r32_154774_c1
452 nmdc:mga06r32_298355_c1
453 nmdc:mga06r32_581743_c1
454 nmdc:mga06r32_930152_c1
455 nmdc:mga0n895_139995_c1
456 nmdc:mga0n895_56307_c1
457 nmdc:mga0rr50_513976_c1
458 nmdc:mga0rr50_609128_c1
459 nmdc:mga0a205_327485_c1
460 nmdc:mga0a205_731329_c1
461 Ga0495601_0084485
462 Ga0500583_0118114
463 Ga0590075_086356
464 Ga0466962_0030136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

13

130

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9194 1 112
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9042 1 112
1yfb-assembly1.cif.gz_A the solution structure of the n-domain of the transcription factor abrb 0.798 51 68
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7769 1 113
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7375 1 113
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9194 1 112 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9042 1 112 3.30.70.1060
1yfbA00 Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; 0.798 51 68 2.10.260.10
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7532 1 113 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7231 1 112 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A1M5N4X0-F1-model_v4 Uncharacterized conserved protein 0.9832 25 113
AF-A0A7V9BEA4-F1-model_v4 YCII-related domain-containing protein 0.9828 22 113
AF-A0A536EA00-F1-model_v4 YciI family protein 0.9749 27 110
AF-A0A536UVW5-F1-model_v4 YciI family protein 0.9639 17 110
AF-A0A7W9JEQ3-F1-model_v4 YCII-related domain-containing protein 0.9614 21 112

Map