F345176

General Info

Members Datasets Scaffolds Average Seq Length
232 163 464 284

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1019577|Ga0265319_10195772
Length 328
Sequence VRLCGKEVRECPPGLSSNPFACKKAVVRINPDLPVSHQLLPGGVMALIMDGNAVSKAVLATIAKNMEGLPSGGPRPGLAVVLVGDDPASAIYVGRKKKACESLGYYSEEHRLPAQTSEAELLALIDSLNTNPKVHGILVQLPLPKPLNPQKTIEAIDPEKDVDGMHPFSLGKLVAGLPGPRSCTPAGVMVLLEHYQLPVAGKRAVVIGRSIMVGKPMAQLLVEANATVTICHSKTENIGEVIKTADLIVAAIGKPKFVKADMVKEGAVVVDVGINRTPEGKLVGDVDFEAVAPKASAITPVPGGVGPMTIALLMRNTFDAFLQQSKNR

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
73 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
74 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
75 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
76 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
147 2501939600 Micromonospora sp. L5 Isolate Unclassified
148 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
149 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
150 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
151 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
152 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
153 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
154 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
155 2855683550 Micromonospora sp. RP3T Isolate Unclassified
156 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
157 2857472729 Cohnella sp. R-74144 Isolate Unclassified
158 2858868258 Micromonospora sp. MH33 Isolate Unclassified
159 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
160 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
161 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
162 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
163 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.81
Metatranscriptomes 0.86
Isolates 7.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.43
Rhizoplane 5.6
Rhizosphere 80.17
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1019577 3300028563 Bacteria 2523
2 JGI25407J50210_10000634 3300003373 Bacteria 7217
3 JGI25407J50210_10001888 3300003373 Bacteria 4860
4 JGI25407J50210_10012231 3300003373 Bacteria 2199
5 JGI25407J50210_10027733 3300003373 Bacteria 1469
6 Ga0070660_100105651 3300005339 Bacteria 2235
7 Ga0070668_100013349 3300005347 Bacteria 6129
8 Ga0070668_100124146 3300005347 Bacteria 2067
9 Ga0070659_100184178 3300005366 Bacteria 1714
10 Ga0070700_100001103 3300005441 Bacteria 13357
11 Ga0070662_100006158 3300005457 Bacteria 7714
12 Ga0070707_100128189 3300005468 Bacteria 2466
13 Ga0070679_100050656 3300005530 Bacteria 4136
14 Ga0070697_100157953 3300005536 Bacteria 1915
15 Ga0070696_100013992 3300005546 Bacteria 5387
16 Ga0070665_100002938 3300005548 Bacteria 18409
17 Ga0068857_100020828 3300005577 Bacteria 5769
18 Ga0068864_100152898 3300005618 Bacteria 2092
19 Ga0068863_100004925 3300005841 Bacteria 13163
20 Ga0068858_100000075 3300005842 Bacteria 104349
21 Ga0068860_100100938 3300005843 Bacteria 2753
22 Ga0068862_100012673 3300005844 Bacteria 6977
23 Ga0081538_10000150 3300005981 Bacteria 72682
24 Ga0081538_10000188 3300005981 Bacteria 67825
25 Ga0081538_10000235 3300005981 Bacteria 62346
26 Ga0081538_10006339 3300005981 Bacteria 10442
27 Ga0081538_10008465 3300005981 Bacteria 8723
28 Ga0081538_10009971 3300005981 Bacteria 7841
29 Ga0081538_10012362 3300005981 Bacteria 6842
30 Ga0081538_10015541 3300005981 Bacteria 5885
31 Ga0081538_10015649 3300005981 Bacteria 5861
32 Ga0081538_10015676 3300005981 Bacteria 5854
33 Ga0081538_10024148 3300005981 Bacteria 4339
34 Ga0081538_10031033 3300005981 Bacteria 3614
35 Ga0081538_10054740 3300005981 Bacteria 2356
36 Ga0081538_10067386 3300005981 Bacteria 1999
37 Ga0081540_1050266 3300005983 Bacteria 2072
38 Ga0081539_10001076 3300005985 Bacteria 49708
39 Ga0075428_100001174 3300006844 Bacteria 28045
40 Ga0075428_100022250 3300006844 Bacteria 7019
41 Ga0075428_100084368 3300006844 Bacteria 3466
42 Ga0075428_100099973 3300006844 Bacteria 3163
43 Ga0075428_100464651 3300006844 Bacteria 1355
44 Ga0075430_100002610 3300006846 Bacteria 15047
45 Ga0075431_100002784 3300006847 Bacteria 16937
46 Ga0075431_100003518 3300006847 Bacteria 15176
47 Ga0075431_100700397 3300006847 Bacteria 991
48 Ga0075433_10305023 3300006852 Bacteria 1410
49 Ga0075429_100010424 3300006880 Bacteria 8041
50 Ga0111539_10244865 3300009094 Bacteria 2087
51 Ga0111539_10494182 3300009094 Bacteria 1425
52 Ga0105245_10001289 3300009098 Bacteria 22604
53 Ga0114129_10002247 3300009147 Bacteria 26671
54 Ga0114129_10004160 3300009147 Bacteria 20444
55 Ga0114129_10136882 3300009147 Bacteria 3360
56 Ga0105249_10002695 3300009553 Bacteria 15354
57 Ga0105239_10348804 3300010375 Bacteria 1671
58 Ga0157373_10097467 3300013100 Bacteria 2070
59 Ga0157370_10001872 3300013104 Bacteria 25939
60 Ga0163162_10119417 3300013306 Bacteria 2739
61 Ga0157372_10353970 3300013307 Bacteria 1711
62 Ga0157379_10011175 3300014968 Bacteria 7825
63 Ga0163161_10246726 3300017792 Bacteria 1391
64 Ga0206353_10187823 3300020082 Bacteria 2538
65 Ga0213875_10002862 3300021388 Bacteria 10112
66 Ga0207688_10056054 3300025901 Bacteria 2213
67 Ga0207657_10015547 3300025919 Bacteria 7369
68 Ga0207652_10070807 3300025921 Bacteria 3029
69 Ga0207687_10057987 3300025927 Bacteria 2722
70 Ga0207706_10002564 3300025933 Bacteria 17721
71 Ga0207686_10000356 3300025934 Bacteria 32614
72 Ga0207686_10005799 3300025934 Bacteria 6624
73 Ga0207679_10138369 3300025945 Bacteria 1964
74 Ga0207712_10007588 3300025961 Bacteria 6854
75 Ga0207668_10010223 3300025972 Bacteria 5664
76 Ga0207658_10047378 3300025986 Bacteria 3146
77 Ga0207703_10000088 3300026035 Bacteria 106080
78 Ga0207708_10003403 3300026075 Bacteria 11722
79 Ga0207676_10178765 3300026095 Bacteria 1856
80 Ga0207675_100024040 3300026118 Bacteria 5664
81 Ga0268266_10071110 3300028379 Bacteria 3015
82 Ga0268265_10122472 3300028380 Bacteria 2145
83 Ga0268264_10826759 3300028381 Bacteria 927
84 Ga0265326_10034585 3300028558 Bacteria 1437
85 Ga0265326_10036876 3300028558 Bacteria 1390
86 Ga0265319_1000465 3300028563 Bacteria 28714
87 Ga0265318_10010654 3300028577 Bacteria 3994
88 Ga0265336_10063298 3300028666 Bacteria 1108
89 Ga0265338_10001147 3300028800 Bacteria 43762
90 Ga0265338_10224112 3300028800 Bacteria 1403
91 Ga0265320_10084461 3300031240 Unclassified 1478
92 Ga0265320_10168255 3300031240 Bacteria 985
93 Ga0307513_10227032 3300031456 Bacteria 1683
94 Ga0307408_100124092 3300031548 Bacteria 2005
95 Ga0265313_10008890 3300031595 Bacteria 6606
96 Ga0265313_10077718 3300031595 Bacteria 1515
97 Ga0307410_10052157 3300031852 Bacteria 2761
98 Ga0307406_10261204 3300031901 Bacteria 1310
99 Ga0307407_10151831 3300031903 Bacteria 1506
100 Ga0307409_100043262 3300031995 Bacteria 3380
101 Ga0307409_100084785 3300031995 Bacteria 2574
102 Ga0307409_100345900 3300031995 Bacteria 1401
103 Ga0307409_100476626 3300031995 Bacteria 1210
104 Ga0307416_100043491 3300032002 Bacteria 3517
105 Ga0307416_100237066 3300032002 Bacteria 1764
106 Ga0307415_100299795 3300032126 Bacteria 1331
107 Ga0316593_10022383 3300032168 Bacteria 1985
108 Ga0373930_0003972 3300034816 Bacteria 2379
109 Ga0373951_0000140 3300035091 Bacteria 26938
110 Ga0373932_0062191 3300035112 Bacteria 1138
111 Ga0373932_0065698 3300035112 Bacteria 1113
112 Ga0373939_0045136 3300035114 Bacteria 1344
113 Ga0373942_0021179 3300035207 Bacteria 1638
114 Ga0373931_0006335 3300035691 Bacteria 5523
115 Ga0373931_0014640 3300035691 Bacteria 3837
116 Ga0373937_0076994 3300036401 Bacteria 3082
117 Ga0316582_0112861 3300036647 Bacteria 1811
118 Ga0395898_0319617 3300037466 Bacteria 1481
119 Ga0436364_0106367 3300037853 Bacteria 2917
120 Ga0436364_1224858 3300037853 Bacteria 2356
121 Ga0395901_0242212 3300038443 Bacteria 1881
122 Ga0395901_0564247 3300038443 Bacteria 1152
123 Ga0436365_0709720 3300039437 Bacteria 12307
124 Ga0436365_0780910 3300039437 Bacteria 2438
125 Ga0436362_0967576 3300039453 Bacteria 2355
126 Ga0451797_0177568 3300041453 Bacteria 1723
127 Ga0439449_0120799 3300042007 Bacteria 973
128 Ga0451577_0621412 3300042876 Bacteria 980
129 Ga0439440_0021969 3300042993 Bacteria 1443
130 Ga0439440_0062260 3300042993 Bacteria 955
131 Ga0466969_0017383 3300044656 Bacteria 3754
132 Ga0466969_0230460 3300044656 Bacteria 841
133 Ga0466966_0242441 3300044684 Bacteria 1087
134 Ga0466961_0087397 3300044693 Bacteria 1970
135 Ga0466961_0192676 3300044693 Bacteria 1263
136 Ga0466968_0003157 3300044735 Bacteria 6081
137 Ga0466970_0002522 3300044765 Bacteria 8832
138 Ga0466960_0006171 3300044901 Bacteria 4797
139 Ga0466959_0022619 3300045049 Bacteria 4648
140 Ga0466958_0364567 3300045836 Unclassified 931
141 Ga0466967_0167570 3300045976 Bacteria 2065
142 Ga0495596_0128952 3300046500 Bacteria 982
143 Ga0495628_0276570 3300046516 Bacteria 1248
144 Ga0495609_0176000 3300046538 Bacteria 902
145 Ga0495645_0155359 3300046543 Bacteria 1586
146 Ga0495667_0075028 3300046559 Bacteria 2201
147 Ga0495588_0215982 3300046674 Bacteria 1012
148 Ga0496100_0010291 3300048903 Bacteria 5291
149 Ga0496101_0005808 3300048904 Bacteria 7893
150 Ga0496102_0000286 3300048905 Bacteria 64518
151 Ga0496103_0000520 3300048906 Bacteria 31686
152 Ga0496105_0000098 3300048908 Bacteria 59301
153 Ga0496105_0155787 3300048908 Bacteria 1876
154 Ga0496107_0001538 3300048910 Bacteria 14328
155 Ga0496107_0044956 3300048910 Bacteria 3176
156 Ga0496108_0135801 3300048911 Bacteria 2116
157 Ga0496109_0597185 3300048912 Bacteria 1040
158 Ga0496109_0813280 3300048912 Bacteria 872
159 Ga0496112_0251563 3300048915 Bacteria 1718
160 Ga0496116_0000241 3300048919 Bacteria 100186
161 Ga0496116_0015210 3300048919 Bacteria 6095
162 Ga0496116_0019541 3300048919 Bacteria 5185
163 Ga0496117_0000529 3300048920 Bacteria 62772
164 Ga0496118_0002948 3300048921 Bacteria 22105
165 Ga0496119_0001983 3300048922 Bacteria 23230
166 Ga0496120_0057331 3300048923 Bacteria 2193
167 Ga0496121_0000654 3300048924 Bacteria 64945
168 Ga0496121_0016856 3300048924 Bacteria 7513
169 Ga0496122_0016192 3300048925 Bacteria 7080
170 Ga0496123_0014005 3300048926 Bacteria 6676
171 Ga0496124_0000470 3300048927 Bacteria 69660
172 Ga0496125_0015624 3300048928 Bacteria 7326
173 Ga0496126_0000649 3300048929 Bacteria 64480
174 Ga0496126_0059537 3300048929 Bacteria 3439
175 Ga0501031_0028316 3300049568 Bacteria 3652
176 Ga0501033_0515242 3300049570 Bacteria 826
177 Ga0501034_0198859 3300049571 Bacteria 1963
178 Ga0501036_0016754 3300049572 Bacteria 6122
179 Ga0501036_0303524 3300049572 Bacteria 1335
180 Ga0501041_0028036 3300049577 Bacteria 3396
181 Ga0501048_0090521 3300049582 Bacteria 2158
182 Ga0501068_0165901 3300049584 Bacteria 1393
183 Ga0501071_0078359 3300049587 Bacteria 2415
184 Ga0501072_0076521 3300049588 Bacteria 2648
185 Ga0501072_0101818 3300049588 Bacteria 2283
186 Ga0501072_0144117 3300049588 Bacteria 1900
187 Ga0501076_0446099 3300049592 Bacteria 1065
188 Ga0501079_0272381 3300049741 Bacteria 1323
189 Ga0501081_0089403 3300049743 Bacteria 2165
190 Ga0501035_0133463 3300049822 Bacteria 2163
191 Ga0501035_0160644 3300049822 Bacteria 1945
192 Ga0501045_0072140 3300049824 Bacteria 2542
193 Ga0501045_0075521 3300049824 Bacteria 2482
194 Ga0501045_0169532 3300049824 Bacteria 1626
195 nmdc:mga05p37_13310_c1 3300050507 Bacteria 9853
196 nmdc:mga05p37_14892_c1 3300050507 Bacteria 9339
197 nmdc:mga05p37_198939_c1 3300050507 Bacteria 2428
198 nmdc:mga05p37_464153_c1 3300050507 Bacteria 1462
199 nmdc:mga05p37_571518_c1 3300050507 Bacteria 1282
200 nmdc:mga09592_209_c1 3300050508 Bacteria 28502
201 nmdc:mga09592_27664_c1 3300050508 Bacteria 4707
202 nmdc:mga0qj67_18634_c1 3300050509 Bacteria 5292
203 nmdc:mga0qj67_1_c3 3300050509 Bacteria 28034
204 nmdc:mga0qj67_81185_c1 3300050509 Bacteria 2599
205 nmdc:mga0qj67_942_c1 3300050509 Bacteria 20015
206 nmdc:mga06r32_261_c1 3300050510 Bacteria 43581
207 nmdc:mga06r32_88439_c1 3300050510 Bacteria 3024
208 nmdc:mga08y16_116180_c1 3300050511 Bacteria 2785
209 nmdc:mga08y16_503185_c1 3300050511 Bacteria 1231
210 nmdc:mga08y16_511060_c1 3300050511 Bacteria 1219
211 nmdc:mga08y16_96740_c1 3300050511 Bacteria 3074
212 nmdc:mga0a205_479109_c1 3300050515 Bacteria 1103
213 Ga0495619_0000008 3300053085 Bacteria 305999
214 Ga0501084_0238085 3300054114 Bacteria 1536
215 Ga0530510_0119769 3300061734 Bacteria 1931
216 2501942036 2501939600 Bacteria 6907073
217 2515719455 2515154129 Bacteria 5584369
218 2516083793 2515154202 Bacteria 5471270
219 2587739112 2585428059 Bacteria 8696589
220 2623589344 2622736626 Bacteria 7181580
221 2644427610 2643221676 Bacteria 8119172
222 2793186803 2791355222 Bacteria 5898266
223 2831936936 2831935698 Bacteria 5963223
224 2855685378 2855683550 Bacteria 7134265
225 2856862896 2856858025 Bacteria 7255264
226 2857474482 2857472729 Bacteria 6568124
227 2858873027 2858868258 Bacteria 7683772
228 2858907144 2858902515 Bacteria 7086037
229 2870788057 2870782633 Bacteria 9624083
230 2904694033 2904690495 Bacteria 9412302
231 2937854238 2937848649 Bacteria 6983481
232 649815329 649633069 Bacteria 6962533
233 Ga0265319_1019577
234 JGI25407J50210_10000634
235 JGI25407J50210_10001888
236 JGI25407J50210_10012231
237 JGI25407J50210_10027733
238 Ga0070660_100105651
239 Ga0070668_100013349
240 Ga0070668_100124146
241 Ga0070659_100184178
242 Ga0070700_100001103
243 Ga0070662_100006158
244 Ga0070707_100128189
245 Ga0070679_100050656
246 Ga0070697_100157953
247 Ga0070696_100013992
248 Ga0070665_100002938
249 Ga0068857_100020828
250 Ga0068864_100152898
251 Ga0068863_100004925
252 Ga0068858_100000075
253 Ga0068860_100100938
254 Ga0068862_100012673
255 Ga0081538_10000150
256 Ga0081538_10000188
257 Ga0081538_10000235
258 Ga0081538_10006339
259 Ga0081538_10008465
260 Ga0081538_10009971
261 Ga0081538_10012362
262 Ga0081538_10015541
263 Ga0081538_10015649
264 Ga0081538_10015676
265 Ga0081538_10024148
266 Ga0081538_10031033
267 Ga0081538_10054740
268 Ga0081538_10067386
269 Ga0081540_1050266
270 Ga0081539_10001076
271 Ga0075428_100001174
272 Ga0075428_100022250
273 Ga0075428_100084368
274 Ga0075428_100099973
275 Ga0075428_100464651
276 Ga0075430_100002610
277 Ga0075431_100002784
278 Ga0075431_100003518
279 Ga0075431_100700397
280 Ga0075433_10305023
281 Ga0075429_100010424
282 Ga0111539_10244865
283 Ga0111539_10494182
284 Ga0105245_10001289
285 Ga0114129_10002247
286 Ga0114129_10004160
287 Ga0114129_10136882
288 Ga0105249_10002695
289 Ga0105239_10348804
290 Ga0157373_10097467
291 Ga0157370_10001872
292 Ga0163162_10119417
293 Ga0157372_10353970
294 Ga0157379_10011175
295 Ga0163161_10246726
296 Ga0206353_10187823
297 Ga0213875_10002862
298 Ga0207688_10056054
299 Ga0207657_10015547
300 Ga0207652_10070807
301 Ga0207687_10057987
302 Ga0207706_10002564
303 Ga0207686_10000356
304 Ga0207686_10005799
305 Ga0207679_10138369
306 Ga0207712_10007588
307 Ga0207668_10010223
308 Ga0207658_10047378
309 Ga0207703_10000088
310 Ga0207708_10003403
311 Ga0207676_10178765
312 Ga0207675_100024040
313 Ga0268266_10071110
314 Ga0268265_10122472
315 Ga0268264_10826759
316 Ga0265326_10034585
317 Ga0265326_10036876
318 Ga0265319_1000465
319 Ga0265318_10010654
320 Ga0265336_10063298
321 Ga0265338_10001147
322 Ga0265338_10224112
323 Ga0265320_10084461
324 Ga0265320_10168255
325 Ga0307513_10227032
326 Ga0307408_100124092
327 Ga0265313_10008890
328 Ga0265313_10077718
329 Ga0307410_10052157
330 Ga0307406_10261204
331 Ga0307407_10151831
332 Ga0307409_100043262
333 Ga0307409_100084785
334 Ga0307409_100345900
335 Ga0307409_100476626
336 Ga0307416_100043491
337 Ga0307416_100237066
338 Ga0307415_100299795
339 Ga0316593_10022383
340 Ga0373930_0003972
341 Ga0373951_0000140
342 Ga0373932_0062191
343 Ga0373932_0065698
344 Ga0373939_0045136
345 Ga0373942_0021179
346 Ga0373931_0006335
347 Ga0373931_0014640
348 Ga0373937_0076994
349 Ga0316582_0112861
350 Ga0395898_0319617
351 Ga0436364_0106367
352 Ga0436364_1224858
353 Ga0395901_0242212
354 Ga0395901_0564247
355 Ga0436365_0709720
356 Ga0436365_0780910
357 Ga0436362_0967576
358 Ga0451797_0177568
359 Ga0439449_0120799
360 Ga0451577_0621412
361 Ga0439440_0021969
362 Ga0439440_0062260
363 Ga0466969_0017383
364 Ga0466969_0230460
365 Ga0466966_0242441
366 Ga0466961_0087397
367 Ga0466961_0192676
368 Ga0466968_0003157
369 Ga0466970_0002522
370 Ga0466960_0006171
371 Ga0466959_0022619
372 Ga0466958_0364567
373 Ga0466967_0167570
374 Ga0495596_0128952
375 Ga0495628_0276570
376 Ga0495609_0176000
377 Ga0495645_0155359
378 Ga0495667_0075028
379 Ga0495588_0215982
380 Ga0496100_0010291
381 Ga0496101_0005808
382 Ga0496102_0000286
383 Ga0496103_0000520
384 Ga0496105_0000098
385 Ga0496105_0155787
386 Ga0496107_0001538
387 Ga0496107_0044956
388 Ga0496108_0135801
389 Ga0496109_0597185
390 Ga0496109_0813280
391 Ga0496112_0251563
392 Ga0496116_0000241
393 Ga0496116_0015210
394 Ga0496116_0019541
395 Ga0496117_0000529
396 Ga0496118_0002948
397 Ga0496119_0001983
398 Ga0496120_0057331
399 Ga0496121_0000654
400 Ga0496121_0016856
401 Ga0496122_0016192
402 Ga0496123_0014005
403 Ga0496124_0000470
404 Ga0496125_0015624
405 Ga0496126_0000649
406 Ga0496126_0059537
407 Ga0501031_0028316
408 Ga0501033_0515242
409 Ga0501034_0198859
410 Ga0501036_0016754
411 Ga0501036_0303524
412 Ga0501041_0028036
413 Ga0501048_0090521
414 Ga0501068_0165901
415 Ga0501071_0078359
416 Ga0501072_0076521
417 Ga0501072_0101818
418 Ga0501072_0144117
419 Ga0501076_0446099
420 Ga0501079_0272381
421 Ga0501081_0089403
422 Ga0501035_0133463
423 Ga0501035_0160644
424 Ga0501045_0072140
425 Ga0501045_0075521
426 Ga0501045_0169532
427 nmdc:mga05p37_13310_c1
428 nmdc:mga05p37_14892_c1
429 nmdc:mga05p37_198939_c1
430 nmdc:mga05p37_464153_c1
431 nmdc:mga05p37_571518_c1
432 nmdc:mga09592_209_c1
433 nmdc:mga09592_27664_c1
434 nmdc:mga0qj67_18634_c1
435 nmdc:mga0qj67_1_c3
436 nmdc:mga0qj67_81185_c1
437 nmdc:mga0qj67_942_c1
438 nmdc:mga06r32_261_c1
439 nmdc:mga06r32_88439_c1
440 nmdc:mga08y16_116180_c1
441 nmdc:mga08y16_503185_c1
442 nmdc:mga08y16_511060_c1
443 nmdc:mga08y16_96740_c1
444 nmdc:mga0a205_479109_c1
445 Ga0495619_0000008
446 Ga0501084_0238085
447 Ga0530510_0119769
448 2501942036
449 2515719455
450 2516083793
451 2587739112
452 2623589344
453 2644427610
454 2793186803
455 2831936936
456 2855685378
457 2856862896
458 2857474482
459 2858873027
460 2858907144
461 2870788057
462 2904694033
463 2937854238
464 649815329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

49

163

0.99

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

166

325

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v6y-assembly1.cif.gz_A-2 crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) 0.9824 1 277
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9799 2 278
5tc4-assembly1.cif.gz_A-2 crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors 0.9753 3 277
6jid-assembly1.cif.gz_A human mthfd2 in complex with compound 1 0.9739 3 277
6s4e-assembly1.cif.gz_A-2 structure of human mthfd2 in complex with th7299 0.9735 1 277
ID Description Score Start End Superfamily
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9902 30 110 3.40.50.10860
af_P9WG81_7_102_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9871 7 99 3.40.50.1220
4cjxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9836 28 111 3.40.50.10860
4a5oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9802 28 111 3.40.50.10860
af_Q54RI8_148_271_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9795 138 259 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W4LMK6-F1-model_v4 deleted 0.99 151 280
AF-A0A2E6S7S0-F1-model_v4 Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase 0.9897 5 177 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A353C7M6-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 0.9894 1 175 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A2J6X9G4-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9888 160 277 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-A0A351V733-F1-model_v4 methylenetetrahydrofolate dehydrogenase (NADP(+)) (EC 1.5.1.5) 0.9886 44 151 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Map