F344946

General Info

Members Datasets Scaffolds Average Seq Length
232 163 464 131

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_101168277|Ga0075429_1011682772
Length 153
Sequence MGSSAGSAGDLSPSSANAARDLESPPRLAPGLSARVQLTVTDADTAQALGSGDVPVLGTPRVLALAEAATVAATVARLEIGMSTVGVRVELDHKAAVPVGGAVVADATLTKVDGRRLLFEVMVRNGETVVAEGRIERVVVDRHRFMENAFGGV

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
154 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
155 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
156 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
157 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
158 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
159 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
160 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
161 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
162 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
163 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.98
Metatranscriptomes 1.29
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 1.72
Rhizosphere 85.78
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_101168277 3300006880 Bacteria 672
2 JGI25406J46586_10004463 3300003203 Bacteria 6513
3 JGI25406J46586_10036453 3300003203 Bacteria 1784
4 rootH1_10125114 3300003316 Bacteria 1279
5 rootH2_10301400 3300003320 Bacteria 1687
6 Ga0070658_10005545 3300005327 Bacteria 10242
7 Ga0070658_11644663 3300005327 Unclassified 556
8 Ga0070683_100040972 3300005329 Bacteria 4259
9 Ga0070683_100879132 3300005329 Bacteria 860
10 Ga0068869_100415592 3300005334 Bacteria 1109
11 Ga0070680_100174809 3300005336 Bacteria 1808
12 Ga0068868_100479381 3300005338 Bacteria 1086
13 Ga0070660_100347357 3300005339 Bacteria 1221
14 Ga0070661_100019431 3300005344 Bacteria 4842
15 Ga0070692_10227817 3300005345 Bacteria 1105
16 Ga0070668_100021547 3300005347 Bacteria 4869
17 Ga0070671_100551243 3300005355 Bacteria 994
18 Ga0070659_101038562 3300005366 Bacteria 720
19 Ga0070667_100457513 3300005367 Bacteria 1167
20 Ga0070667_101737324 3300005367 Bacteria 587
21 Ga0070709_10879618 3300005434 Bacteria 707
22 Ga0070714_100024093 3300005435 Bacteria 5008
23 Ga0070713_100119190 3300005436 Bacteria 2312
24 Ga0070708_100000318 3300005445 Bacteria 36350
25 Ga0070708_100000341 3300005445 Bacteria 35146
26 Ga0070662_100480843 3300005457 Bacteria 1034
27 Ga0070681_10036732 3300005458 Bacteria 4919
28 Ga0070706_100151323 3300005467 Bacteria 2166
29 Ga0070707_100019206 3300005468 Bacteria 6439
30 Ga0070707_100293169 3300005468 Bacteria 1581
31 Ga0070698_100146966 3300005471 Bacteria 2306
32 Ga0070679_100036740 3300005530 Bacteria 4861
33 Ga0070679_100050580 3300005530 Bacteria 4140
34 Ga0070684_100235930 3300005535 Bacteria 1671
35 Ga0070697_100073283 3300005536 Bacteria 2811
36 Ga0068853_100617862 3300005539 Bacteria 1030
37 Ga0068853_101144423 3300005539 Bacteria 751
38 Ga0070686_100841012 3300005544 Bacteria 743
39 Ga0070665_102188163 3300005548 Bacteria 557
40 Ga0068855_100592486 3300005563 Bacteria 1196
41 Ga0070664_100280199 3300005564 Bacteria 1503
42 Ga0070664_101501598 3300005564 Bacteria 638
43 Ga0068856_100860818 3300005614 Bacteria 926
44 Ga0068852_100411014 3300005616 Bacteria 1333
45 Ga0068863_100085167 3300005841 Bacteria 2996
46 Ga0068858_100057494 3300005842 Bacteria 3595
47 Ga0068860_100051486 3300005843 Bacteria 3919
48 Ga0068862_100052315 3300005844 Bacteria 3494
49 Ga0068862_100120340 3300005844 Bacteria 2313
50 Ga0081455_10213071 3300005937 Bacteria 1438
51 Ga0081455_10718714 3300005937 Unclassified 635
52 Ga0081540_1228112 3300005983 Bacteria 659
53 Ga0081539_10000031 3300005985 Bacteria 313232
54 Ga0081539_10000348 3300005985 Bacteria 101459
55 Ga0081539_10000981 3300005985 Bacteria 53166
56 Ga0081539_10038248 3300005985 Bacteria 2845
57 Ga0081539_10051435 3300005985 Bacteria 2322
58 Ga0070717_10511638 3300006028 Bacteria 1086
59 Ga0097621_100889640 3300006237 Bacteria 829
60 Ga0097621_100939091 3300006237 Bacteria 807
61 Ga0075428_100001262 3300006844 Bacteria 27005
62 Ga0075428_100019952 3300006844 Bacteria 7422
63 Ga0075428_100364887 3300006844 Bacteria 1549
64 Ga0075428_100681254 3300006844 Bacteria 1096
65 Ga0075430_100011193 3300006846 Bacteria 7606
66 Ga0075430_100188826 3300006846 Bacteria 1713
67 Ga0075431_100091865 3300006847 Bacteria 3132
68 Ga0075431_100251320 3300006847 Bacteria 1796
69 Ga0075431_100370964 3300006847 Bacteria 1436
70 Ga0075431_102110299 3300006847 Bacteria 518
71 Ga0075434_100968695 3300006871 Unclassified 865
72 Ga0075429_100007111 3300006880 Bacteria 9719
73 Ga0075429_100027105 3300006880 Bacteria 4974
74 Ga0075435_100013465 3300007076 Bacteria 6086
75 Ga0111539_12297261 3300009094 Bacteria 626
76 Ga0105245_11891072 3300009098 Bacteria 650
77 Ga0105247_10521368 3300009101 Bacteria 869
78 Ga0114129_10000016 3300009147 Bacteria 127415
79 Ga0114129_10000130 3300009147 Bacteria 77049
80 Ga0114129_10187621 3300009147 Bacteria 2809
81 Ga0114129_10888187 3300009147 Bacteria 1130
82 Ga0105237_11592631 3300009545 Bacteria 660
83 Ga0105239_10980357 3300010375 Bacteria 971
84 Ga0105239_11464451 3300010375 Bacteria 789
85 Ga0157370_11033346 3300013104 Bacteria 743
86 Ga0157369_10024153 3300013105 Bacteria 6766
87 Ga0157372_11475918 3300013307 Bacteria 783
88 Ga0163163_10108827 3300014325 Bacteria 2799
89 Ga0163163_11573506 3300014325 Bacteria 718
90 Ga0157380_12378312 3300014326 Bacteria 595
91 Ga0157379_10151573 3300014968 Bacteria 2091
92 Ga0206356_11335864 3300020070 Bacteria 1486
93 Ga0206349_1456984 3300020075 Bacteria 847
94 Ga0206353_11314762 3300020082 Bacteria 1814
95 Ga0207705_11317444 3300025909 Unclassified 551
96 Ga0207707_10007596 3300025912 Bacteria 9448
97 Ga0207660_10272334 3300025917 Bacteria 1341
98 Ga0207657_10565879 3300025919 Bacteria 888
99 Ga0207649_10086132 3300025920 Bacteria 2046
100 Ga0207649_10919782 3300025920 Bacteria 686
101 Ga0207652_10012294 3300025921 Bacteria 6915
102 Ga0207652_10897649 3300025921 Bacteria 783
103 Ga0207646_10017988 3300025922 Bacteria 6600
104 Ga0207646_10256114 3300025922 Bacteria 1582
105 Ga0207646_11896483 3300025922 Unclassified 508
106 Ga0207681_11276897 3300025923 Bacteria 617
107 Ga0207650_11377804 3300025925 Bacteria 600
108 Ga0207687_10774903 3300025927 Bacteria 817
109 Ga0207700_10553176 3300025928 Bacteria 1021
110 Ga0207664_10462027 3300025929 Bacteria 1134
111 Ga0207644_10976510 3300025931 Bacteria 711
112 Ga0207689_10367870 3300025942 Bacteria 1196
113 Ga0207661_10004452 3300025944 Bacteria 9841
114 Ga0207667_10449922 3300025949 Bacteria 1309
115 Ga0207668_10004948 3300025972 Bacteria 7839
116 Ga0207668_10031208 3300025972 Bacteria 3508
117 Ga0207640_11340350 3300025981 Bacteria 640
118 Ga0207658_10202168 3300025986 Bacteria 1659
119 Ga0207677_10132065 3300026023 Bacteria 1898
120 Ga0207677_10408724 3300026023 Bacteria 1153
121 Ga0207703_10079424 3300026035 Bacteria 2730
122 Ga0207639_10549934 3300026041 Bacteria 1060
123 Ga0207678_10498002 3300026067 Bacteria 1062
124 Ga0207678_10557681 3300026067 Bacteria 1002
125 Ga0207702_10208690 3300026078 Bacteria 1815
126 Ga0207641_10310438 3300026088 Bacteria 1492
127 Ga0207674_10018593 3300026116 Bacteria 7548
128 Ga0207683_10106129 3300026121 Bacteria 2511
129 Ga0268265_10028328 3300028380 Bacteria 4009
130 Ga0268265_10600784 3300028380 Bacteria 1051
131 Ga0268264_10053775 3300028381 Bacteria 3360
132 Ga0307515_10000890 3300028794 Bacteria 68786
133 Ga0307515_10004361 3300028794 Bacteria 29335
134 Ga0307515_10085228 3300028794 Bacteria 4046
135 Ga0307515_10479486 3300028794 Bacteria 856
136 Ga0307512_10047817 3300030522 Bacteria 3471
137 Ga0307513_10055987 3300031456 Bacteria 4215
138 Ga0307513_10227579 3300031456 Bacteria 1680
139 Ga0307509_10085323 3300031507 Bacteria 3250
140 Ga0307509_10284888 3300031507 Bacteria 1411
141 Ga0307509_10297023 3300031507 Bacteria 1366
142 Ga0307408_100023628 3300031548 Bacteria 4190
143 Ga0307508_10000287 3300031616 Bacteria 61945
144 Ga0307508_10073716 3300031616 Bacteria 2990
145 Ga0307508_10106851 3300031616 Bacteria 2397
146 Ga0307516_10038326 3300031730 Bacteria 4784
147 Ga0307516_10052139 3300031730 Bacteria 4007
148 Ga0307405_10054528 3300031731 Bacteria 2496
149 Ga0307405_10829424 3300031731 Bacteria 777
150 Ga0307406_10069147 3300031901 Bacteria 2308
151 Ga0307406_10694741 3300031901 Bacteria 849
152 Ga0307407_11305991 3300031903 Bacteria 569
153 Ga0307409_100134886 3300031995 Bacteria 2116
154 Ga0307416_100130614 3300032002 Bacteria 2260
155 Ga0307411_10205019 3300032005 Bacteria 1518
156 Ga0307415_100386377 3300032126 Bacteria 1190
157 Ga0307415_100569655 3300032126 Bacteria 1003
158 Ga0307415_101507160 3300032126 Bacteria 643
159 Ga0307507_10033066 3300033179 Bacteria 5379
160 Ga0307510_10158665 3300033180 Bacteria 1864
161 Ga0373938_0015217 3300034957 Bacteria 1487
162 Ga0373951_0000070 3300035091 Bacteria 40770
163 Ga0373960_0038749 3300035121 Bacteria 1368
164 Ga0373962_0002415 3300035242 Bacteria 4446
165 Ga0373935_0038264 3300035692 Bacteria 3003
166 Ga0395899_0037298 3300037312 Bacteria 3644
167 Ga0395900_0008630 3300037418 Bacteria 10472
168 Ga0395900_1471476 3300037418 Bacteria 593
169 Ga0395898_0014179 3300037466 Bacteria 8196
170 Ga0395898_0165887 3300037466 Bacteria 2112
171 Ga0395905_0008901 3300037471 Bacteria 9860
172 Ga0436364_0346312 3300037853 Bacteria 621
173 Ga0395901_0039049 3300038443 Bacteria 4911
174 Ga0466966_0446776 3300044684 Bacteria 777
175 Ga0466958_0875377 3300045836 Bacteria 586
176 Ga0495632_0030835 3300046519 Bacteria 2779
177 Ga0495632_0099326 3300046519 Bacteria 1373
178 Ga0495668_0000297 3300046616 Bacteria 68449
179 Ga0495625_0000743 3300046660 Bacteria 45494
180 Ga0495683_0045065 3300047323 Bacteria 2217
181 Ga0495626_0000090 3300048091 Bacteria 119019
182 Ga0496104_1389417 3300048907 Bacteria 605
183 Ga0496108_0000234 3300048911 Bacteria 49801
184 Ga0496112_0207207 3300048915 Bacteria 1918
185 Ga0496112_0663283 3300048915 Bacteria 972
186 Ga0496119_0463691 3300048922 Bacteria 595
187 Ga0501034_0434704 3300049571 Bacteria 1232
188 Ga0501036_0070687 3300049572 Bacteria 2952
189 Ga0501038_0015195 3300049574 Bacteria 7002
190 Ga0501039_0199992 3300049575 Bacteria 1571
191 Ga0501039_1389040 3300049575 Bacteria 541
192 Ga0501040_1235278 3300049576 Bacteria 542
193 Ga0501043_0377428 3300049579 Bacteria 1074
194 Ga0501043_0519803 3300049579 Bacteria 887
195 Ga0501046_0056845 3300049580 Bacteria 3069
196 Ga0501047_0046775 3300049581 Bacteria 4181
197 Ga0501047_0266619 3300049581 Bacteria 1559
198 Ga0501048_0444981 3300049582 Bacteria 928
199 Ga0501069_0336942 3300049585 Bacteria 888
200 Ga0501070_0445940 3300049586 Bacteria 1044
201 Ga0501072_0767086 3300049588 Bacteria 756
202 Ga0501074_0128516 3300049590 Bacteria 1813
203 Ga0501074_0712135 3300049590 Bacteria 708
204 Ga0501080_0472487 3300049742 Bacteria 1122
205 Ga0501080_1006684 3300049742 Bacteria 723
206 Ga0501044_0268714 3300049823 Bacteria 1642
207 Ga0501044_0471425 3300049823 Bacteria 1159
208 Ga0501044_0622793 3300049823 Bacteria 970
209 Ga0501044_1628821 3300049823 Bacteria 510
210 nmdc:mga05p37_413502_c1 3300050507 Bacteria 1572
211 nmdc:mga05p37_7146_c1 3300050507 Bacteria 13167
212 nmdc:mga05p37_767_c1 3300050507 Bacteria 35697
213 nmdc:mga09592_1_c1 3300050508 Bacteria 201102
214 nmdc:mga09592_216460_c1 3300050508 Bacteria 1660
215 nmdc:mga0qj67_123_c1 3300050509 Bacteria 51004
216 nmdc:mga0qj67_63580_c1 3300050509 Bacteria 2934
217 nmdc:mga06r32_1599015_c1 3300050510 Bacteria 590
218 nmdc:mga06r32_43358_c1 3300050510 Bacteria 4281
219 nmdc:mga06r32_7_c2 3300050510 Bacteria 19902
220 nmdc:mga0n895_630381_c1 3300050512 Unclassified 1072
221 nmdc:mga0rr50_24387_c1 3300050513 Bacteria 4188
222 Ga0500644_0412290 3300053088 Bacteria 590
223 Ga0500651_0218982 3300053093 Bacteria 1117
224 Ga0500560_216029 3300053107 Bacteria 613
225 Ga0500652_072301 3300053131 Bacteria 1431
226 Ga0500579_147072 3300053143 Bacteria 1042
227 Ga0500600_0058066 3300053149 Bacteria 2168
228 Ga0500630_026450 3300053159 Bacteria 2859
229 2516088365 2515154203 Bacteria 5458536
230 2623590614 2622736626 Bacteria 7181580
231 2867308446 2867302475 Bacteria 7087181
232 2887481355 2887478801 Bacteria 8972725
233 Ga0075429_101168277
234 JGI25406J46586_10004463
235 JGI25406J46586_10036453
236 rootH1_10125114
237 rootH2_10301400
238 Ga0070658_10005545
239 Ga0070658_11644663
240 Ga0070683_100040972
241 Ga0070683_100879132
242 Ga0068869_100415592
243 Ga0070680_100174809
244 Ga0068868_100479381
245 Ga0070660_100347357
246 Ga0070661_100019431
247 Ga0070692_10227817
248 Ga0070668_100021547
249 Ga0070671_100551243
250 Ga0070659_101038562
251 Ga0070667_100457513
252 Ga0070667_101737324
253 Ga0070709_10879618
254 Ga0070714_100024093
255 Ga0070713_100119190
256 Ga0070708_100000318
257 Ga0070708_100000341
258 Ga0070662_100480843
259 Ga0070681_10036732
260 Ga0070706_100151323
261 Ga0070707_100019206
262 Ga0070707_100293169
263 Ga0070698_100146966
264 Ga0070679_100036740
265 Ga0070679_100050580
266 Ga0070684_100235930
267 Ga0070697_100073283
268 Ga0068853_100617862
269 Ga0068853_101144423
270 Ga0070686_100841012
271 Ga0070665_102188163
272 Ga0068855_100592486
273 Ga0070664_100280199
274 Ga0070664_101501598
275 Ga0068856_100860818
276 Ga0068852_100411014
277 Ga0068863_100085167
278 Ga0068858_100057494
279 Ga0068860_100051486
280 Ga0068862_100052315
281 Ga0068862_100120340
282 Ga0081455_10213071
283 Ga0081455_10718714
284 Ga0081540_1228112
285 Ga0081539_10000031
286 Ga0081539_10000348
287 Ga0081539_10000981
288 Ga0081539_10038248
289 Ga0081539_10051435
290 Ga0070717_10511638
291 Ga0097621_100889640
292 Ga0097621_100939091
293 Ga0075428_100001262
294 Ga0075428_100019952
295 Ga0075428_100364887
296 Ga0075428_100681254
297 Ga0075430_100011193
298 Ga0075430_100188826
299 Ga0075431_100091865
300 Ga0075431_100251320
301 Ga0075431_100370964
302 Ga0075431_102110299
303 Ga0075434_100968695
304 Ga0075429_100007111
305 Ga0075429_100027105
306 Ga0075435_100013465
307 Ga0111539_12297261
308 Ga0105245_11891072
309 Ga0105247_10521368
310 Ga0114129_10000016
311 Ga0114129_10000130
312 Ga0114129_10187621
313 Ga0114129_10888187
314 Ga0105237_11592631
315 Ga0105239_10980357
316 Ga0105239_11464451
317 Ga0157370_11033346
318 Ga0157369_10024153
319 Ga0157372_11475918
320 Ga0163163_10108827
321 Ga0163163_11573506
322 Ga0157380_12378312
323 Ga0157379_10151573
324 Ga0206356_11335864
325 Ga0206349_1456984
326 Ga0206353_11314762
327 Ga0207705_11317444
328 Ga0207707_10007596
329 Ga0207660_10272334
330 Ga0207657_10565879
331 Ga0207649_10086132
332 Ga0207649_10919782
333 Ga0207652_10012294
334 Ga0207652_10897649
335 Ga0207646_10017988
336 Ga0207646_10256114
337 Ga0207646_11896483
338 Ga0207681_11276897
339 Ga0207650_11377804
340 Ga0207687_10774903
341 Ga0207700_10553176
342 Ga0207664_10462027
343 Ga0207644_10976510
344 Ga0207689_10367870
345 Ga0207661_10004452
346 Ga0207667_10449922
347 Ga0207668_10004948
348 Ga0207668_10031208
349 Ga0207640_11340350
350 Ga0207658_10202168
351 Ga0207677_10132065
352 Ga0207677_10408724
353 Ga0207703_10079424
354 Ga0207639_10549934
355 Ga0207678_10498002
356 Ga0207678_10557681
357 Ga0207702_10208690
358 Ga0207641_10310438
359 Ga0207674_10018593
360 Ga0207683_10106129
361 Ga0268265_10028328
362 Ga0268265_10600784
363 Ga0268264_10053775
364 Ga0307515_10000890
365 Ga0307515_10004361
366 Ga0307515_10085228
367 Ga0307515_10479486
368 Ga0307512_10047817
369 Ga0307513_10055987
370 Ga0307513_10227579
371 Ga0307509_10085323
372 Ga0307509_10284888
373 Ga0307509_10297023
374 Ga0307408_100023628
375 Ga0307508_10000287
376 Ga0307508_10073716
377 Ga0307508_10106851
378 Ga0307516_10038326
379 Ga0307516_10052139
380 Ga0307405_10054528
381 Ga0307405_10829424
382 Ga0307406_10069147
383 Ga0307406_10694741
384 Ga0307407_11305991
385 Ga0307409_100134886
386 Ga0307416_100130614
387 Ga0307411_10205019
388 Ga0307415_100386377
389 Ga0307415_100569655
390 Ga0307415_101507160
391 Ga0307507_10033066
392 Ga0307510_10158665
393 Ga0373938_0015217
394 Ga0373951_0000070
395 Ga0373960_0038749
396 Ga0373962_0002415
397 Ga0373935_0038264
398 Ga0395899_0037298
399 Ga0395900_0008630
400 Ga0395900_1471476
401 Ga0395898_0014179
402 Ga0395898_0165887
403 Ga0395905_0008901
404 Ga0436364_0346312
405 Ga0395901_0039049
406 Ga0466966_0446776
407 Ga0466958_0875377
408 Ga0495632_0030835
409 Ga0495632_0099326
410 Ga0495668_0000297
411 Ga0495625_0000743
412 Ga0495683_0045065
413 Ga0495626_0000090
414 Ga0496104_1389417
415 Ga0496108_0000234
416 Ga0496112_0207207
417 Ga0496112_0663283
418 Ga0496119_0463691
419 Ga0501034_0434704
420 Ga0501036_0070687
421 Ga0501038_0015195
422 Ga0501039_0199992
423 Ga0501039_1389040
424 Ga0501040_1235278
425 Ga0501043_0377428
426 Ga0501043_0519803
427 Ga0501046_0056845
428 Ga0501047_0046775
429 Ga0501047_0266619
430 Ga0501048_0444981
431 Ga0501069_0336942
432 Ga0501070_0445940
433 Ga0501072_0767086
434 Ga0501074_0128516
435 Ga0501074_0712135
436 Ga0501080_0472487
437 Ga0501080_1006684
438 Ga0501044_0268714
439 Ga0501044_0471425
440 Ga0501044_0622793
441 Ga0501044_1628821
442 nmdc:mga05p37_413502_c1
443 nmdc:mga05p37_7146_c1
444 nmdc:mga05p37_767_c1
445 nmdc:mga09592_1_c1
446 nmdc:mga09592_216460_c1
447 nmdc:mga0qj67_123_c1
448 nmdc:mga0qj67_63580_c1
449 nmdc:mga06r32_1599015_c1
450 nmdc:mga06r32_43358_c1
451 nmdc:mga06r32_7_c2
452 nmdc:mga0n895_630381_c1
453 nmdc:mga0rr50_24387_c1
454 Ga0500644_0412290
455 Ga0500651_0218982
456 Ga0500560_216029
457 Ga0500652_072301
458 Ga0500579_147072
459 Ga0500600_0058066
460 Ga0500630_026450
461 2516088365
462 2623590614
463 2867308446
464 2887481355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22636

FlK

Fluoroacetyl-CoA-specific thioesterase

40

143

0.96

PF03061

4HBT

Thioesterase superfamily

59

132

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kvu-assembly1.cif.gz_A structural basis of the activity and substrate specificity of the fluoroacetyl-coa flk - t42s mutant in complex with acetyl-coa 0.9226 10 131
2pim-assembly1.cif.gz_A crystal structure of a putative thioesterase, phenylacetic acid degradation-related protein (reut_b4779) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9148 13 120
3p3f-assembly2.cif.gz_D crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk 0.9129 10 132
2cwz-assembly2.cif.gz_D crystal structure of the thermus thermophilus hypothetical protein ttha0967, a thioesterase superfamily member 0.9129 11 132
4k4c-assembly1.cif.gz_D x-ray crystal structure of e. coli ybdb complexed with phenacyl-coa 0.9116 15 122
ID Description Score Start End Superfamily
af_Q54KW1_1_129_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9689 10 131 3.10.129.10
af_Q2FXM2_325_429_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.931 38 122 3.10.129.10
af_Q54KW1_1_129_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9106 10 131 3.10.129.10
2q78A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9057 12 131 3.10.129.10
af_Q9W440_48_153_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8984 38 122 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3D4X0P6-F1-model_v4 Thioesterase 0.9937 10 130
AF-A0A4P5RMP2-F1-model_v4 Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein 0.9907 12 131
AF-A0A7K1AJ72-F1-model_v4 Thioesterase 0.99 19 131
AF-A0A7W3QNV3-F1-model_v4 Putative thioesterase 0.9862 10 130
AF-A0A3B0SV55-F1-model_v4 Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein 0.9838 11 127

Map