F344317

General Info

Members Datasets Scaffolds Average Seq Length
231 116 229 152

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0148937|Ga0453684_0148937_1347_1880
Length 177
Sequence MQIPPPLRILVTTGIKGQFERCRQVKIAIGCDHAGFALKQEIRPILAGMEAEVVDCGTNNTESVDYPDFGGKVSEMVSSGAADRGILICGTGLGMSMVANKYPGVRAALCNDLFSAKMSRLHNDANVLVMGGRIIGRDLAAEIVKVWLTTSFEGARHLKRLDKIAKIEKELTENGTK

Samples

Sample ID Description Type Environment
1 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
2 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
66 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
70 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
71 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
83 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
84 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
85 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
86 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
87 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
88 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
89 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
90 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
91 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 4.33
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.3
Nodule 0
Rhizoplane 0.87
Rhizosphere 85.28
Stem 0
Stem Tuber 0
Unclassified 12.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10090385 3300005295 Bacteria 4150
2 Ga0070682_100170960 3300005337 Bacteria 1510
3 Ga0068868_100101021 3300005338 Bacteria 2334
4 Ga0070674_100599172 3300005356 Bacteria 931
5 Ga0070709_10499144 3300005434 Bacteria 924
6 Ga0070711_100019698 3300005439 Bacteria 4333
7 Ga0070708_100349177 3300005445 Bacteria 1394
8 Ga0070708_100868717 3300005445 Unclassified 847
9 Ga0068867_101195699 3300005459 Bacteria 698
10 Ga0070707_100003192 3300005468 Bacteria 15510
11 Ga0070698_100055932 3300005471 Bacteria 3999
12 Ga0070699_100065299 3300005518 Bacteria 3158
13 Ga0070699_100582183 3300005518 Bacteria 1020
14 Ga0070679_100051942 3300005530 Bacteria 4084
15 Ga0068853_100000892 3300005539 Bacteria 20758
16 Ga0070686_100048807 3300005544 Bacteria 2683
17 Ga0070695_100089312 3300005545 Bacteria 2054
18 Ga0070693_100249465 3300005547 Unclassified 1176
19 Ga0070704_100749053 3300005549 Unclassified 870
20 Ga0068855_100228444 3300005563 Bacteria 2085
21 Ga0068856_100095663 3300005614 Bacteria 2958
22 Ga0068852_100043466 3300005616 Bacteria 3811
23 Ga0068859_100006893 3300005617 Bacteria 11534
24 Ga0068863_101468217 3300005841 Bacteria 690
25 Ga0068860_100237591 3300005843 Bacteria 1772
26 Ga0075363_100173245 3300006048 Bacteria 1225
27 Ga0075428_100978061 3300006844 Bacteria 896
28 Ga0075433_10278884 3300006852 Bacteria 1481
29 Ga0075434_101460425 3300006871 Bacteria 693
30 Ga0075429_100660599 3300006880 Bacteria 916
31 Ga0075436_100000637 3300006914 Bacteria 23075
32 Ga0097620_100006893 3300006931 Bacteria 11534
33 Ga0075435_100131079 3300007076 Bacteria 2098
34 Ga0105240_10844602 3300009093 Bacteria 989
35 Ga0111539_11241815 3300009094 Unclassified 865
36 Ga0105241_10131384 3300009174 Bacteria 2028
37 Ga0105248_11805201 3300009177 Unclassified 694
38 Ga0105237_10053090 3300009545 Bacteria 4066
39 Ga0105237_10338850 3300009545 Bacteria 1508
40 Ga0105238_10006017 3300009551 Bacteria 12026
41 Ga0105238_11069885 3300009551 Bacteria 829
42 Ga0157372_10372036 3300013307 Unclassified 1665
43 Ga0157375_10916360 3300013308 Bacteria 1020
44 Ga0157380_10835755 3300014326 Bacteria 941
45 Ga0157379_10710823 3300014968 Unclassified 944
46 Ga0206356_10650996 3300020070 Unclassified 553
47 Ga0207699_10342415 3300025906 Bacteria 1054
48 Ga0207663_10185994 3300025916 Bacteria 1487
49 Ga0207652_10082972 3300025921 Bacteria 2806
50 Ga0207646_10124622 3300025922 Bacteria 2316
51 Ga0207646_10803131 3300025922 Bacteria 838
52 Ga0207694_10013127 3300025924 Bacteria 6237
53 Ga0207694_10842344 3300025924 Bacteria 775
54 Ga0207667_10093517 3300025949 Bacteria 3105
55 Ga0207667_10352897 3300025949 Bacteria 1500
56 Ga0207677_10078848 3300026023 Bacteria 2353
57 Ga0207639_10004156 3300026041 Bacteria 9745
58 Ga0207702_10763053 3300026078 Bacteria 955
59 Ga0207641_11219324 3300026088 Bacteria 752
60 Ga0207674_10351574 3300026116 Bacteria 1425
61 Ga0207428_10864501 3300027907 Unclassified 640
62 Ga0268264_10254232 3300028381 Bacteria 1634
63 Ga0265318_10065055 3300028577 Bacteria 1356
64 Ga0265336_10049778 3300028666 Bacteria 1268
65 Ga0265760_10172166 3300031090 Unclassified 719
66 Ga0307509_10275090 3300031507 Bacteria 1449
67 Ga0316575_10029834 3300031665 Bacteria 2131
68 Ga0316575_10113819 3300031665 Bacteria 1104
69 Ga0316575_10409516 3300031665 Bacteria 582
70 Ga0316579_10010414 3300031691 Bacteria 3932
71 Ga0316576_10003281 3300031727 Bacteria 9445
72 Ga0316576_10017891 3300031727 Bacteria 4827
73 Ga0316576_10025493 3300031727 Bacteria 4141
74 Ga0316576_10049310 3300031727 Bacteria 3058
75 Ga0316576_10063581 3300031727 Bacteria 2709
76 Ga0316576_10329844 3300031727 Bacteria 1137
77 Ga0316576_10581929 3300031727 Bacteria 818
78 Ga0316578_10073033 3300031728 Bacteria 2033
79 Ga0316578_10074734 3300031728 Bacteria 2010
80 Ga0316578_10183369 3300031728 Bacteria 1262
81 Ga0316578_10240344 3300031728 Bacteria 1087
82 Ga0316578_10241956 3300031728 Bacteria 1083
83 Ga0316577_10046439 3300031733 Bacteria 2426
84 Ga0307413_10488741 3300031824 Bacteria 986
85 Ga0307410_10466302 3300031852 Bacteria 1033
86 Ga0316583_10189614 3300032133 Unclassified 714
87 Ga0316585_10114355 3300032137 Bacteria 887
88 Ga0316593_10039384 3300032168 Bacteria 1568
89 Ga0316593_10138468 3300032168 Unclassified 881
90 Ga0316592_1076022 3300033524 Bacteria 762
91 Ga0316592_1151607 3300033524 Unclassified 547
92 Ga0316588_1082145 3300033528 Unclassified 799
93 Ga0316587_1014772 3300033529 Bacteria 1291
94 Ga0316596_1010441 3300033541 Bacteria 2247
95 Ga0316596_1047397 3300033541 Bacteria 1135
96 Ga0373954_0071449 3300035118 Bacteria 1650
97 Ga0373956_0114355 3300035119 Bacteria 1258
98 Ga0373955_0622736 3300035172 Bacteria 661
99 Ga0373955_1018169 3300035172 Bacteria 510
100 Ga0316574_0071466 3300035398 Bacteria 2192
101 Ga0316574_0076183 3300035398 Bacteria 2125
102 Ga0316574_0087316 3300035398 Bacteria 1986
103 Ga0316574_0192399 3300035398 Bacteria 1312
104 Ga0316574_0641937 3300035398 Bacteria 654
105 Ga0316582_0013843 3300036647 Bacteria 4555
106 Ga0316582_0115333 3300036647 Bacteria 1792
107 Ga0316582_0226116 3300036647 Bacteria 1280
108 Ga0316582_0913953 3300036647 Unclassified 600
109 Ga0316582_0993820 3300036647 Unclassified 573
110 Ga0316584_0102500 3300036712 Bacteria 2143
111 Ga0316584_0150538 3300036712 Bacteria 1732
112 Ga0316584_0278752 3300036712 Unclassified 1215
113 Ga0316584_0280946 3300036712 Bacteria 1210
114 Ga0316584_0583351 3300036712 Bacteria 777
115 Ga0316584_0944988 3300036712 Bacteria 578
116 Ga0316584_1044573 3300036712 Bacteria 544
117 Ga0316581_0205571 3300037588 Bacteria 606
118 Ga0400484_13384 3300038725 Bacteria 10500
119 Ga0400484_23664 3300038725 Bacteria 8141
120 Ga0400484_33223 3300038725 Bacteria 1017
121 Ga0400490_10874 3300038726 Bacteria 7104
122 Ga0400490_15682 3300038726 Bacteria 1654
123 Ga0400490_24432 3300038726 Bacteria 2227
124 Ga0400491_18726 3300038727 Bacteria 1197
125 Ga0400485_09470 3300038735 Bacteria 10279
126 Ga0400485_13152 3300038735 Bacteria 13350
127 Ga0400485_14718 3300038735 Bacteria 17871
128 Ga0400488_25715 3300038741 Bacteria 4447
129 Ga0400488_39001 3300038741 Bacteria 2656
130 Ga0400486_19811 3300038742 Bacteria 13224
131 Ga0400486_21551 3300038742 Bacteria 20589
132 Ga0400486_23897 3300038742 Bacteria 10824
133 Ga0400483_100156 3300039062 Bacteria 37225
134 Ga0400483_149052 3300039062 Bacteria 9549
135 Ga0400483_173151 3300039062 Bacteria 20816
136 Ga0400483_174434 3300039062 Bacteria 11116
137 Ga0400483_284523 3300039062 Bacteria 3429
138 Ga0400489_11028 3300039093 Unclassified 2239
139 Ga0400489_25682 3300039093 Bacteria 26714
140 Ga0400489_66494 3300039093 Bacteria 2914
141 Ga0400489_81674 3300039093 Bacteria 9733
142 Ga0400487_13874 3300039110 Bacteria 1299
143 Ga0436365_0655168 3300039437 Bacteria 2691
144 Ga0439445_0058491 3300042004 Bacteria 1051
145 Ga0451577_0000065 3300042876 Bacteria 260821
146 Ga0451577_0000508 3300042876 Bacteria 65407
147 Ga0451577_0004343 3300042876 Bacteria 15030
148 Ga0451577_0016819 3300042876 Bacteria 6764
149 Ga0451577_0044448 3300042876 Bacteria 3977
150 Ga0451577_0140608 3300042876 Bacteria 2169
151 Ga0451577_0157696 3300042876 Bacteria 2043
152 Ga0451577_0367355 3300042876 Bacteria 1305
153 Ga0451577_0385308 3300042876 Bacteria 1272
154 Ga0451577_0594318 3300042876 Bacteria 1004
155 Ga0451577_1204103 3300042876 Bacteria 675
156 Ga0453683_0000025 3300044673 Bacteria 255308
157 Ga0453683_0000036 3300044673 Bacteria 232009
158 Ga0453683_0000081 3300044673 Bacteria 144825
159 Ga0453683_0000165 3300044673 Bacteria 94483
160 Ga0453683_0000359 3300044673 Bacteria 55048
161 Ga0453683_0003857 3300044673 Bacteria 10875
162 Ga0453683_0012863 3300044673 Bacteria 5476
163 Ga0453683_0149425 3300044673 Bacteria 1476
164 Ga0453683_0151542 3300044673 Bacteria 1465
165 Ga0453683_0189704 3300044673 Bacteria 1304
166 Ga0453683_0242565 3300044673 Bacteria 1148
167 Ga0453683_0259834 3300044673 Bacteria 1108
168 Ga0453683_0439930 3300044673 Bacteria 843
169 Ga0453684_0000076 3300044712 Bacteria 437513
170 Ga0453684_0000349 3300044712 Bacteria 192484
171 Ga0453684_0000397 3300044712 Bacteria 179262
172 Ga0453684_0000883 3300044712 Bacteria 100160
173 Ga0453684_0001689 3300044712 Bacteria 59652
174 Ga0453684_0002445 3300044712 Bacteria 45127
175 Ga0453684_0002808 3300044712 Bacteria 41155
176 Ga0453684_0002909 3300044712 Bacteria 40137
177 Ga0453684_0005311 3300044712 Bacteria 25685
178 Ga0453684_0013754 3300044712 Bacteria 13086
179 Ga0453684_0020241 3300044712 Bacteria 10056
180 Ga0453684_0023280 3300044712 Bacteria 9136
181 Ga0453684_0025337 3300044712 Bacteria 8617
182 Ga0453684_0031647 3300044712 Bacteria 7427
183 Ga0453684_0043394 3300044712 Bacteria 6044
184 Ga0453684_0044771 3300044712 Bacteria 5915
185 Ga0453684_0045371 3300044712 Bacteria 5864
186 Ga0453684_0057851 3300044712 Bacteria 5012
187 Ga0453684_0060059 3300044712 Bacteria 4895
188 Ga0453684_0064831 3300044712 Bacteria 4663
189 Ga0453684_0068973 3300044712 Bacteria 4487
190 Ga0453684_0148937 3300044712 Bacteria 2784
191 Ga0453684_0217034 3300044712 Bacteria 2218
192 Ga0453684_0243903 3300044712 Bacteria 2067
193 Ga0453684_0255095 3300044712 Bacteria 2012
194 Ga0453684_0325996 3300044712 Bacteria 1738
195 Ga0453684_0741351 3300044712 Bacteria 1064
196 Ga0453684_0836316 3300044712 Bacteria 990
197 Ga0451576_0000069 3300045051 Bacteria 259862
198 Ga0451576_0039912 3300045051 Bacteria 4969
199 Ga0451576_0057678 3300045051 Bacteria 4059
200 Ga0451576_0143544 3300045051 Bacteria 2489
201 Ga0451576_0241838 3300045051 Bacteria 1886
202 Ga0451576_0298057 3300045051 Bacteria 1686
203 Ga0451576_0463505 3300045051 Bacteria 1331
204 Ga0451576_0501113 3300045051 Bacteria 1276
205 Ga0451576_0564077 3300045051 Bacteria 1196
206 Ga0451576_0692126 3300045051 Bacteria 1071
207 Ga0451576_1830945 3300045051 Bacteria 627
208 Ga0495651_0344238 3300046462 Bacteria 987
209 Ga0495653_0480086 3300046463 Bacteria 778
210 Ga0495580_0097928 3300046472 Bacteria 2040
211 Ga0495580_0103615 3300046472 Bacteria 1978
212 Ga0495628_0438391 3300046516 Unclassified 950
213 Ga0495630_0133079 3300046517 Bacteria 1889
214 Ga0495630_0715532 3300046517 Unclassified 766
215 Ga0495646_0630524 3300046680 Bacteria 543
216 Ga0495604_0623392 3300047317 Bacteria 690
217 Ga0496104_0652454 3300048907 Unclassified 961
218 Ga0496110_0002609 3300048913 Bacteria 13561
219 Ga0501032_0113449 3300049569 Bacteria 1793
220 Ga0501041_0736437 3300049577 Bacteria 631
221 Ga0501043_1072394 3300049579 Bacteria 570
222 Ga0501047_0124580 3300049581 Bacteria 2458
223 Ga0501044_0519800 3300049823 Bacteria 1090
224 nmdc:mga03n38_35355_c2 3300050490 Bacteria 1328
225 nmdc:mga03n38_774651_c1 3300050490 Bacteria 557
226 nmdc:mga09592_490731_c1 3300050508 Bacteria 1058
227 nmdc:mga08y16_950001_c1 3300050511 Unclassified 843
228 nmdc:mga08x19_5206_c1 3300050514 Bacteria 7692
229 Ga0501084_0433026 3300054114 Bacteria 1112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10844602 Ga0105240_108446022 133
2 3300048913 Ga0496110_0002609 Ga0496110_0002609_8441_8911 134
3 3300033529 Ga0316587_1014772 Ga0316587_10147723 141
4 3300036647 Ga0316582_0226116 Ga0316582_0226116_167_619 141
5 3300036712 Ga0316584_0150538 Ga0316584_0150538_854_1306 141
6 3300037588 Ga0316581_0205571 Ga0316581_0205571_123_575 141
7 3300039093 Ga0400489_11028 Ga0400489_11028_41_469 141
8 3300031665 Ga0316575_10029834 Ga0316575_100298342 142
9 3300031733 Ga0316577_10046439 Ga0316577_100464393 142
10 3300033524 Ga0316592_1076022 Ga0316592_10760222 142
11 3300033524 Ga0316592_1151607 Ga0316592_11516071 142
12 3300035398 Ga0316574_0192399 Ga0316574_0192399_22_459 142
13 3300036647 Ga0316582_0993820 Ga0316582_0993820_83_514 142
14 3300036712 Ga0316584_0280946 Ga0316584_0280946_414_866 142
15 3300036712 Ga0316584_1044573 Ga0316584_1044573_57_488 142
16 3300038725 Ga0400484_33223 Ga0400484_33223_164_616 142
17 iso_pu_bacteria 2740891818 2740993181 142
18 3300031727 Ga0316576_10329844 Ga0316576_103298442 143
19 3300031728 Ga0316578_10241956 Ga0316578_102419562 143
20 3300032137 Ga0316585_10114355 Ga0316585_101143551 143
21 3300033541 Ga0316596_1010441 Ga0316596_10104412 143
22 3300035398 Ga0316574_0076183 Ga0316574_0076183_1000_1449 143
23 3300036647 Ga0316582_0115333 Ga0316582_0115333_635_1084 143
24 3300036647 Ga0316582_0913953 Ga0316582_0913953_94_543 143
25 3300038726 Ga0400490_15682 Ga0400490_15682_549_992 143
26 3300038726 Ga0400490_24432 Ga0400490_24432_1482_1925 143
27 3300038727 Ga0400491_18726 Ga0400491_18726_320_763 143
28 3300038741 Ga0400488_39001 Ga0400488_39001_249_692 143
29 3300031727 Ga0316576_10017891 Ga0316576_100178912 144
30 3300031727 Ga0316576_10063581 Ga0316576_100635812 144
31 3300032168 Ga0316593_10138468 Ga0316593_101384681 144
32 3300035172 Ga0373955_1018169 Ga0373955_1018169_46_483 144
33 3300038725 Ga0400484_23664 Ga0400484_23664_2673_3119 144
34 3300038735 Ga0400485_09470 Ga0400485_09470_6011_6475 144
35 3300038735 Ga0400485_13152 Ga0400485_13152_5643_6107 144
36 3300038735 Ga0400485_14718 Ga0400485_14718_4706_5152 144
37 3300038741 Ga0400488_25715 Ga0400488_25715_1157_1603 144
38 3300038742 Ga0400486_19811 Ga0400486_19811_5529_5993 144
39 3300038742 Ga0400486_21551 Ga0400486_21551_7341_7787 144
40 3300038742 Ga0400486_23897 Ga0400486_23897_4422_4886 144
41 3300039062 Ga0400483_100156 Ga0400483_100156_32359_32796 144
42 3300039062 Ga0400483_173151 Ga0400483_173151_7574_8011 144
43 3300039093 Ga0400489_25682 Ga0400489_25682_3515_3961 144
44 3300039110 Ga0400487_13874 Ga0400487_13874_313_771 144
45 3300046463 Ga0495653_0480086 Ga0495653_0480086_69_506 144
46 3300046680 Ga0495646_0630524 Ga0495646_0630524_18_455 144
47 3300031691 Ga0316579_10010414 Ga0316579_100104145 145
48 3300031727 Ga0316576_10003281 Ga0316576_100032817 145
49 3300031728 Ga0316578_10240344 Ga0316578_102403441 145
50 3300031824 Ga0307413_10488741 Ga0307413_104887412 145
51 3300038726 Ga0400490_10874 Ga0400490_10874_6121_6588 145
52 3300039062 Ga0400483_149052 Ga0400483_149052_495_962 145
53 3300039062 Ga0400483_284523 Ga0400483_284523_2125_2580 145
54 iso_pu_bacteria 2684623219 2687238637 145
55 3300009177 Ga0105248_11805201 Ga0105248_118052011 146
56 3300014968 Ga0157379_10710823 Ga0157379_107108232 146
57 3300031665 Ga0316575_10113819 Ga0316575_101138192 146
58 3300031727 Ga0316576_10049310 Ga0316576_100493102 146
59 3300031728 Ga0316578_10073033 Ga0316578_100730332 146
60 3300032133 Ga0316583_10189614 Ga0316583_101896141 146
61 3300033528 Ga0316588_1082145 Ga0316588_10821451 146
62 3300033541 Ga0316596_1047397 Ga0316596_10473971 146
63 3300036647 Ga0316582_0013843 Ga0316582_0013843_948_1418 146
64 3300036712 Ga0316584_0102500 Ga0316584_0102500_1339_1797 146
65 3300036712 Ga0316584_0278752 Ga0316584_0278752_593_1063 146
66 3300038725 Ga0400484_13384 Ga0400484_13384_3308_3820 146
67 3300039062 Ga0400483_174434 Ga0400483_174434_7335_7823 146
68 3300046517 Ga0495630_0133079 Ga0495630_0133079_1336_1797 146
69 3300014326 Ga0157380_10835755 Ga0157380_108357552 147
70 3300028577 Ga0265318_10065055 Ga0265318_100650552 147
71 3300031507 Ga0307509_10275090 Ga0307509_102750902 147
72 3300031727 Ga0316576_10581929 Ga0316576_105819292 147
73 3300035119 Ga0373956_0114355 Ga0373956_0114355_222_671 147
74 3300039093 Ga0400489_81674 Ga0400489_81674_5063_5518 147
75 3300042876 Ga0451577_0157696 Ga0451577_0157696_167_613 147
76 3300044673 Ga0453683_0151542 Ga0453683_0151542_688_1137 147
77 3300044712 Ga0453684_0044771 Ga0453684_0044771_3128_3571 147
78 3300044712 Ga0453684_0068973 Ga0453684_0068973_1843_2292 147
79 3300045051 Ga0451576_0564077 Ga0451576_0564077_518_961 147
80 3300048907 Ga0496104_0652454 Ga0496104_0652454_254_700 147
81 3300049577 Ga0501041_0736437 Ga0501041_0736437_20_466 147
82 3300005295 Ga0065707_10090385 Ga0065707_100903856 148
83 3300005337 Ga0070682_100170960 Ga0070682_1001709602 148
84 3300005338 Ga0068868_100101021 Ga0068868_1001010213 148
85 3300005356 Ga0070674_100599172 Ga0070674_1005991722 148
86 3300005434 Ga0070709_10499144 Ga0070709_104991441 148
87 3300005439 Ga0070711_100019698 Ga0070711_1000196984 148
88 3300005445 Ga0070708_100349177 Ga0070708_1003491771 148
89 3300005445 Ga0070708_100868717 Ga0070708_1008687172 148
90 3300005459 Ga0068867_101195699 Ga0068867_1011956991 148
91 3300005468 Ga0070707_100003192 Ga0070707_1000031929 148
92 3300005471 Ga0070698_100055932 Ga0070698_1000559324 148
93 3300005518 Ga0070699_100065299 Ga0070699_1000652993 148
94 3300005518 Ga0070699_100582183 Ga0070699_1005821832 148
95 3300005530 Ga0070679_100051942 Ga0070679_1000519423 148
96 3300005539 Ga0068853_100000892 Ga0068853_1000008927 148
97 3300005544 Ga0070686_100048807 Ga0070686_1000488072 148
98 3300005545 Ga0070695_100089312 Ga0070695_1000893123 148
99 3300005547 Ga0070693_100249465 Ga0070693_1002494651 148
100 3300005549 Ga0070704_100749053 Ga0070704_1007490531 148
101 3300005563 Ga0068855_100228444 Ga0068855_1002284442 148
102 3300005614 Ga0068856_100095663 Ga0068856_1000956632 148
103 3300005616 Ga0068852_100043466 Ga0068852_1000434664 148
104 3300005617 Ga0068859_100006893 Ga0068859_1000068933 148
105 3300005841 Ga0068863_101468217 Ga0068863_1014682172 148
106 3300005843 Ga0068860_100237591 Ga0068860_1002375912 148
107 3300006048 Ga0075363_100173245 Ga0075363_1001732452 148
108 3300006844 Ga0075428_100978061 Ga0075428_1009780612 148
109 3300006852 Ga0075433_10278884 Ga0075433_102788842 148
110 3300006871 Ga0075434_101460425 Ga0075434_1014604251 148
111 3300006880 Ga0075429_100660599 Ga0075429_1006605992 148
112 3300006914 Ga0075436_100000637 Ga0075436_10000063715 148
113 3300006931 Ga0097620_100006893 Ga0097620_1000068933 148
114 3300007076 Ga0075435_100131079 Ga0075435_1001310793 148
115 3300009094 Ga0111539_11241815 Ga0111539_112418152 148
116 3300009174 Ga0105241_10131384 Ga0105241_101313843 148
117 3300009545 Ga0105237_10053090 Ga0105237_100530903 148
118 3300009545 Ga0105237_10338850 Ga0105237_103388502 148
119 3300009551 Ga0105238_10006017 Ga0105238_100060173 148
120 3300009551 Ga0105238_11069885 Ga0105238_110698852 148
121 3300013307 Ga0157372_10372036 Ga0157372_103720362 148
122 3300013308 Ga0157375_10916360 Ga0157375_109163602 148
123 3300020070 Ga0206356_10650996 Ga0206356_106509961 148
124 3300025906 Ga0207699_10342415 Ga0207699_103424151 148
125 3300025916 Ga0207663_10185994 Ga0207663_101859942 148
126 3300025921 Ga0207652_10082972 Ga0207652_100829723 148
127 3300025922 Ga0207646_10124622 Ga0207646_101246223 148
128 3300025922 Ga0207646_10803131 Ga0207646_108031312 148
129 3300025924 Ga0207694_10013127 Ga0207694_100131273 148
130 3300025924 Ga0207694_10842344 Ga0207694_108423442 148
131 3300025949 Ga0207667_10093517 Ga0207667_100935173 148
132 3300025949 Ga0207667_10352897 Ga0207667_103528972 148
133 3300026023 Ga0207677_10078848 Ga0207677_100788483 148
134 3300026041 Ga0207639_10004156 Ga0207639_100041562 148
135 3300026078 Ga0207702_10763053 Ga0207702_107630532 148
136 3300026088 Ga0207641_11219324 Ga0207641_112193242 148
137 3300026116 Ga0207674_10351574 Ga0207674_103515741 148
138 3300027907 Ga0207428_10864501 Ga0207428_108645011 148
139 3300028381 Ga0268264_10254232 Ga0268264_102542322 148
140 3300028666 Ga0265336_10049778 Ga0265336_100497782 148
141 3300031090 Ga0265760_10172166 Ga0265760_101721661 148
142 3300031665 Ga0316575_10409516 Ga0316575_104095161 148
143 3300031727 Ga0316576_10025493 Ga0316576_100254934 148
144 3300031728 Ga0316578_10074734 Ga0316578_100747342 148
145 3300031728 Ga0316578_10183369 Ga0316578_101833691 148
146 3300031852 Ga0307410_10466302 Ga0307410_104663022 148
147 3300032168 Ga0316593_10039384 Ga0316593_100393842 148
148 3300035118 Ga0373954_0071449 Ga0373954_0071449_1057_1521 148
149 3300035172 Ga0373955_0622736 Ga0373955_0622736_64_528 148
150 3300035398 Ga0316574_0071466 Ga0316574_0071466_494_979 148
151 3300035398 Ga0316574_0087316 Ga0316574_0087316_757_1239 148
152 3300035398 Ga0316574_0641937 Ga0316574_0641937_141_596 148
153 3300036712 Ga0316584_0583351 Ga0316584_0583351_156_617 148
154 3300036712 Ga0316584_0944988 Ga0316584_0944988_37_489 148
155 3300039093 Ga0400489_66494 Ga0400489_66494_2268_2729 148
156 3300039437 Ga0436365_0655168 Ga0436365_0655168_631_1092 148
157 3300042004 Ga0439445_0058491 Ga0439445_0058491_210_659 148
158 3300042876 Ga0451577_0000065 Ga0451577_0000065_145108_145554 148
159 3300042876 Ga0451577_0000508 Ga0451577_0000508_54610_55071 148
160 3300042876 Ga0451577_0004343 Ga0451577_0004343_7238_7693 148
161 3300042876 Ga0451577_0016819 Ga0451577_0016819_1604_2050 148
162 3300042876 Ga0451577_0044448 Ga0451577_0044448_1301_1780 148
163 3300042876 Ga0451577_0140608 Ga0451577_0140608_203_649 148
164 3300042876 Ga0451577_0367355 Ga0451577_0367355_399_845 148
165 3300042876 Ga0451577_0385308 Ga0451577_0385308_682_1143 148
166 3300042876 Ga0451577_0594318 Ga0451577_0594318_368_817 148
167 3300042876 Ga0451577_1204103 Ga0451577_1204103_158_613 148
168 3300044673 Ga0453683_0000025 Ga0453683_0000025_92309_92755 148
169 3300044673 Ga0453683_0000036 Ga0453683_0000036_27583_28029 148
170 3300044673 Ga0453683_0000081 Ga0453683_0000081_37728_38180 148
171 3300044673 Ga0453683_0000165 Ga0453683_0000165_7623_8102 148
172 3300044673 Ga0453683_0000359 Ga0453683_0000359_17633_18079 148
173 3300044673 Ga0453683_0003857 Ga0453683_0003857_4146_4592 148
174 3300044673 Ga0453683_0012863 Ga0453683_0012863_2187_2633 148
175 3300044673 Ga0453683_0149425 Ga0453683_0149425_70_516 148
176 3300044673 Ga0453683_0189704 Ga0453683_0189704_775_1221 148
177 3300044673 Ga0453683_0242565 Ga0453683_0242565_535_981 148
178 3300044673 Ga0453683_0259834 Ga0453683_0259834_486_935 148
179 3300044673 Ga0453683_0439930 Ga0453683_0439930_278_724 148
180 3300044712 Ga0453684_0000076 Ga0453684_0000076_387710_388171 148
181 3300044712 Ga0453684_0000349 Ga0453684_0000349_1816_2271 148
182 3300044712 Ga0453684_0000397 Ga0453684_0000397_108861_109334 148
183 3300044712 Ga0453684_0000883 Ga0453684_0000883_80752_81201 148
184 3300044712 Ga0453684_0001689 Ga0453684_0001689_591_1055 148
185 3300044712 Ga0453684_0002445 Ga0453684_0002445_31834_32280 148
186 3300044712 Ga0453684_0002808 Ga0453684_0002808_16686_17132 148
187 3300044712 Ga0453684_0002909 Ga0453684_0002909_36783_37262 148
188 3300044712 Ga0453684_0005311 Ga0453684_0005311_23696_24142 148
189 3300044712 Ga0453684_0013754 Ga0453684_0013754_12051_12515 148
190 3300044712 Ga0453684_0020241 Ga0453684_0020241_5101_5565 148
191 3300044712 Ga0453684_0023280 Ga0453684_0023280_5379_5840 148
192 3300044712 Ga0453684_0025337 Ga0453684_0025337_7206_7658 148
193 3300044712 Ga0453684_0031647 Ga0453684_0031647_5091_5540 148
194 3300044712 Ga0453684_0043394 Ga0453684_0043394_3375_3836 148
195 3300044712 Ga0453684_0045371 Ga0453684_0045371_332_781 148
196 3300044712 Ga0453684_0057851 Ga0453684_0057851_3429_3878 148
197 3300044712 Ga0453684_0060059 Ga0453684_0060059_672_1133 148
198 3300044712 Ga0453684_0064831 Ga0453684_0064831_2439_2900 148
199 3300044712 Ga0453684_0148937 Ga0453684_0148937_1347_1880 148
200 3300044712 Ga0453684_0217034 Ga0453684_0217034_1483_1944 148
201 3300044712 Ga0453684_0243903 Ga0453684_0243903_667_1137 148
202 3300044712 Ga0453684_0255095 Ga0453684_0255095_1295_1750 148
203 3300044712 Ga0453684_0325996 Ga0453684_0325996_1224_1709 148
204 3300044712 Ga0453684_0741351 Ga0453684_0741351_554_1012 148
205 3300044712 Ga0453684_0836316 Ga0453684_0836316_29_481 148
206 3300045051 Ga0451576_0000069 Ga0451576_0000069_56125_56571 148
207 3300045051 Ga0451576_0039912 Ga0451576_0039912_1653_2114 148
208 3300045051 Ga0451576_0057678 Ga0451576_0057678_2811_3260 148
209 3300045051 Ga0451576_0143544 Ga0451576_0143544_1339_1785 148
210 3300045051 Ga0451576_0241838 Ga0451576_0241838_318_767 148
211 3300045051 Ga0451576_0298057 Ga0451576_0298057_448_894 148
212 3300045051 Ga0451576_0463505 Ga0451576_0463505_859_1308 148
213 3300045051 Ga0451576_0501113 Ga0451576_0501113_374_829 148
214 3300045051 Ga0451576_0692126 Ga0451576_0692126_294_758 148
215 3300045051 Ga0451576_1830945 Ga0451576_1830945_90_536 148
216 3300046462 Ga0495651_0344238 Ga0495651_0344238_80_544 148
217 3300046472 Ga0495580_0097928 Ga0495580_0097928_392_856 148
218 3300046472 Ga0495580_0103615 Ga0495580_0103615_892_1356 148
219 3300046516 Ga0495628_0438391 Ga0495628_0438391_227_718 148
220 3300046517 Ga0495630_0715532 Ga0495630_0715532_223_687 148
221 3300047317 Ga0495604_0623392 Ga0495604_0623392_109_573 148
222 3300049569 Ga0501032_0113449 Ga0501032_0113449_270_749 148
223 3300049579 Ga0501043_1072394 Ga0501043_1072394_24_503 148
224 3300049581 Ga0501047_0124580 Ga0501047_0124580_457_924 148
225 3300049823 Ga0501044_0519800 Ga0501044_0519800_546_1028 148
226 3300050490 nmdc:mga03n38_35355_c2 nmdc:mga03n38_35355_c2_149_607 148
227 3300050490 nmdc:mga03n38_774651_c1 nmdc:mga03n38_774651_c1_26_508 148
228 3300050508 nmdc:mga09592_490731_c1 nmdc:mga09592_490731_c1_206_679 148
229 3300050511 nmdc:mga08y16_950001_c1 nmdc:mga08y16_950001_c1_235_699 148
230 3300050514 nmdc:mga08x19_5206_c1 nmdc:mga08x19_5206_c1_543_1007 148
231 3300054114 Ga0501084_0433026 Ga0501084_0433026_449_904 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

27

164

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9808 2 146
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.977 2 144
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9767 2 143
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9712 2 141
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9651 2 140
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9756 2 144 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9683 2 141 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9651 2 140 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9583 2 144 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9551 2 128 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A0D5NC82-F1-model_v4 deleted 0.9989 1 148
AF-A0A2J6IYP1-F1-model_v4 Ribose 5-phosphate isomerase B 0.9973 2 147 GO:0004751
GO:0009052
GO:0019316
AF-A0A352B2H7-F1-model_v4 Ribose 5-phosphate isomerase B 0.9965 1 145 GO:0005975
GO:0016861
AF-A0A2U3QEZ4-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.995 2 148 GO:0004751
GO:0009052
GO:0019316
AF-A0A349A6K2-F1-model_v4 Ribose 5-phosphate isomerase B 0.9938 2 145 GO:0004751
GO:0009052
GO:0019316

Feature Viewer

pLDDT pTM Quality
97.6 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map