F344023

General Info

Members Datasets Scaffolds Average Seq Length
231 187 462 142

Family's Representative Sequence

Representative Sequence 3300012512|Ga0157327_1083686|Ga0157327_10836861
Length 136
Sequence VSQAAGIPASTLRYYEDKGLIAPVGRHGLRRVYASDVLERLALVALGRAAGFSLDQIALVFADGSARIDRRLLAGKADELDRTIARLTAMRDGLRHAAACRAPSHMQCPTFRRLLRAAATGAIGARRRRAPQPPGD

Samples

Sample ID Description Type Environment
1 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
84 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
85 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
86 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
87 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
88 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
89 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
90 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
91 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
92 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
93 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
94 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
95 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
96 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
97 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
98 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
99 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
100 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
101 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
102 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
108 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
163 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
168 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
169 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
170 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
171 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
172 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
173 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
174 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
175 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
176 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
177 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
178 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
179 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
180 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
181 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
182 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
183 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
184 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
185 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
186 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
187 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.36
Nodule 6.93
Rhizoplane 3.9
Rhizosphere 77.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157327_1083686 3300012512 Bacteria 518
2 rootH1_10096852 3300003316 Bacteria 1234
3 Ga0068868_101148082 3300005338 Bacteria 716
4 Ga0070660_101694115 3300005339 Bacteria 538
5 Ga0070660_101909323 3300005339 Bacteria 506
6 Ga0070689_100071380 3300005340 Bacteria 2712
7 Ga0070669_100136103 3300005353 Bacteria 1890
8 Ga0070685_10119323 3300005466 Bacteria 1636
9 Ga0070679_100061734 3300005530 Bacteria 3736
10 Ga0070665_100092153 3300005548 Bacteria 3035
11 Ga0068855_100000686 3300005563 Bacteria 41326
12 Ga0068855_100760863 3300005563 Bacteria 1032
13 Ga0068855_101344146 3300005563 Bacteria 738
14 Ga0068855_102036953 3300005563 Bacteria 579
15 Ga0070664_101333232 3300005564 Bacteria 678
16 Ga0068857_100080553 3300005577 Bacteria 2907
17 Ga0068857_101396364 3300005577 Bacteria 681
18 Ga0068852_100034033 3300005616 Bacteria 4238
19 Ga0068859_100208522 3300005617 Bacteria 2040
20 Ga0081539_10166919 3300005985 Bacteria 1044
21 Ga0070717_10132925 3300006028 Bacteria 2141
22 Ga0075368_10002242 3300006042 Bacteria 6287
23 Ga0075363_100016981 3300006048 Bacteria 3603
24 Ga0075367_10000046 3300006178 Bacteria 28270
25 Ga0075367_10800830 3300006178 Bacteria 600
26 Ga0075366_10196881 3300006195 Bacteria 1225
27 Ga0075430_100016358 3300006846 Bacteria 6316
28 Ga0075431_100167107 3300006847 Bacteria 2261
29 Ga0075429_100122201 3300006880 Bacteria 2276
30 Ga0075429_100134869 3300006880 Bacteria 2160
31 Ga0097620_100208521 3300006931 Bacteria 2040
32 Ga0099826_10139676 3300006948 Bacteria 1401
33 Ga0105240_10000495 3300009093 Bacteria 72639
34 Ga0105240_10489575 3300009093 Bacteria 1369
35 Ga0111539_10047577 3300009094 Bacteria 5126
36 Ga0114129_10436281 3300009147 Bacteria 1720
37 Ga0105241_11791515 3300009174 Bacteria 599
38 Ga0105242_10544069 3300009176 Bacteria 1112
39 Ga0105238_10045998 3300009551 Bacteria 4407
40 Ga0105239_10143885 3300010375 Bacteria 2658
41 Ga0157372_10311516 3300013307 Bacteria 1832
42 Ga0183367_1012 3300015688 Bacteria 347438
43 Ga0207692_10192816 3300025898 Bacteria 1194
44 Ga0207705_10035886 3300025909 Bacteria 3548
45 Ga0207695_10061593 3300025913 Bacteria 3877
46 Ga0207671_10071702 3300025914 Bacteria 2584
47 Ga0207663_10017100 3300025916 Bacteria 4034
48 Ga0207663_10132291 3300025916 Bacteria 1725
49 Ga0207652_10071348 3300025921 Bacteria 3018
50 Ga0207694_10020490 3300025924 Bacteria 5003
51 Ga0207700_10318600 3300025928 Bacteria 1347
52 Ga0207644_10001831 3300025931 Bacteria 13810
53 Ga0207686_10577848 3300025934 Bacteria 882
54 Ga0207670_10017224 3300025936 Bacteria 4364
55 Ga0207691_10285368 3300025940 Bacteria 1420
56 Ga0207689_10127815 3300025942 Bacteria 2090
57 Ga0207679_11392911 3300025945 Bacteria 643
58 Ga0207667_10002853 3300025949 Bacteria 21441
59 Ga0207667_11201457 3300025949 Bacteria 738
60 Ga0207677_11080099 3300026023 Bacteria 731
61 Ga0207677_11170615 3300026023 Bacteria 703
62 Ga0207639_10030890 3300026041 Bacteria 3933
63 Ga0207674_10092480 3300026116 Bacteria 3014
64 Ga0207674_10518468 3300026116 Bacteria 1151
65 Ga0207674_11642524 3300026116 Bacteria 611
66 Ga0207698_10007527 3300026142 Bacteria 6824
67 Ga0207698_10180430 3300026142 Bacteria 1870
68 Ga0209981_1029446 3300027378 Bacteria 803
69 Ga0209996_1021298 3300027395 Bacteria 912
70 Ga0210000_1027137 3300027462 Bacteria 889
71 Ga0209999_1043963 3300027543 Bacteria 839
72 Ga0209983_1019598 3300027665 Bacteria 1407
73 Ga0209971_1003929 3300027682 Bacteria 3515
74 Ga0209966_1002601 3300027695 Bacteria 3013
75 Ga0209813_10003661 3300027866 Bacteria 3613
76 Ga0207428_10086207 3300027907 Bacteria 2444
77 Ga0268266_10044980 3300028379 Bacteria 3775
78 Ga0307512_10011801 3300030522 Bacteria 8261
79 Ga0307512_10030317 3300030522 Bacteria 4707
80 Ga0307408_100185461 3300031548 Bacteria 1672
81 Ga0265313_10147453 3300031595 Bacteria 1008
82 Ga0307508_10002311 3300031616 Bacteria 20242
83 Ga0307514_10067112 3300031649 Bacteria 2709
84 Ga0307514_10146853 3300031649 Bacteria 1591
85 Ga0265314_10045002 3300031711 Bacteria 3123
86 Ga0265342_10182116 3300031712 Bacteria 1150
87 Ga0307405_10011334 3300031731 Bacteria 4666
88 Ga0307413_10167773 3300031824 Bacteria 1550
89 Ga0307406_10013188 3300031901 Bacteria 4730
90 Ga0307406_10220331 3300031901 Bacteria 1410
91 Ga0307412_10077305 3300031911 Bacteria 2289
92 Ga0307409_100683620 3300031995 Bacteria 1024
93 Ga0307409_101251826 3300031995 Bacteria 766
94 Ga0307414_10065464 3300032004 Bacteria 2593
95 Ga0307414_10171565 3300032004 Bacteria 1735
96 Ga0307411_10096706 3300032005 Bacteria 2076
97 Ga0307411_10922488 3300032005 Bacteria 777
98 Ga0307507_10214881 3300033179 Bacteria 1304
99 Ga0373936_0240871 3300035113 Bacteria 806
100 Ga0373931_0235539 3300035691 Bacteria 1108
101 Ga0395905_0231085 3300037471 Bacteria 1729
102 Ga0395901_0000003 3300038443 Bacteria 701538
103 Ga0439436_0023493 3300041404 Bacteria 1823
104 Ga0439438_024519 3300041405 Bacteria 1650
105 Ga0439447_004263 3300041407 Bacteria 4957
106 Ga0439447_041250 3300041407 Bacteria 1124
107 Ga0439461_0083300 3300041410 Bacteria 757
108 Ga0439466_0008040 3300041411 Bacteria 3976
109 Ga0439466_0011321 3300041411 Bacteria 3301
110 Ga0451797_0291844 3300041453 Bacteria 1657
111 Ga0451798_0318620 3300041458 Bacteria 621
112 Ga0451807_0301182 3300041486 Bacteria 3230
113 Ga0451807_0462406 3300041486 Bacteria 547
114 Ga0439431_0026659 3300041997 Bacteria 1417
115 Ga0439441_008945 3300042001 Bacteria 1647
116 Ga0439442_008878 3300042002 Bacteria 2031
117 Ga0439443_001558 3300042003 Bacteria 2564
118 Ga0439445_0020341 3300042004 Bacteria 1661
119 Ga0439452_010129 3300042010 Bacteria 2753
120 Ga0439463_147522 3300042016 Bacteria 610
121 Ga0450911_024362 3300042115 Bacteria 786
122 Ga0450921_004433 3300042123 Bacteria 1024
123 Ga0450894_008759 3300042131 Bacteria 1309
124 Ga0450896_028046 3300042133 Bacteria 844
125 Ga0450898_005569 3300042134 Bacteria 1908
126 Ga0450906_004173 3300042145 Bacteria 3050
127 Ga0439446_0081154 3300042156 Bacteria 1004
128 Ga0450908_004780 3300042184 Bacteria 2606
129 Ga0439434_0001130 3300042435 Bacteria 7713
130 Ga0439434_0126676 3300042435 Bacteria 836
131 Ga0439435_0059238 3300042436 Bacteria 1112
132 Ga0439444_0080332 3300042437 Bacteria 713
133 Ga0439460_0172248 3300042461 Bacteria 729
134 Ga0450918_000976 3300042531 Bacteria 5973
135 Ga0466968_0080506 3300044735 Bacteria 1430
136 Ga0466967_0289637 3300045976 Bacteria 1573
137 Ga0495638_0049476 3300046460 Bacteria 2628
138 Ga0495616_0051677 3300046513 Bacteria 2049
139 Ga0495616_0109527 3300046513 Bacteria 1284
140 Ga0495642_0007705 3300046528 Bacteria 4126
141 Ga0495625_0008633 3300046660 Bacteria 8667
142 Ga0495625_0071839 3300046660 Bacteria 2428
143 Ga0495649_0202294 3300046694 Bacteria 1031
144 Ga0495602_0524889 3300048088 Bacteria 824
145 Ga0496101_0100093 3300048904 Bacteria 2168
146 Ga0496108_0372029 3300048911 Bacteria 1247
147 Ga0496109_0017677 3300048912 Bacteria 6255
148 Ga0496112_0102183 3300048915 Bacteria 2836
149 Ga0496113_0088125 3300048916 Bacteria 2387
150 Ga0496120_0001785 3300048923 Bacteria 24196
151 Ga0501031_0008882 3300049568 Bacteria 6532
152 Ga0501032_0004019 3300049569 Bacteria 11148
153 Ga0501032_0073550 3300049569 Bacteria 2277
154 Ga0501033_0005113 3300049570 Bacteria 10430
155 Ga0501033_0252097 3300049570 Bacteria 1250
156 Ga0501034_0000305 3300049571 Bacteria 87329
157 Ga0501034_0037934 3300049571 Bacteria 4880
158 Ga0501034_0112545 3300049571 Bacteria 2712
159 Ga0501036_0071755 3300049572 Bacteria 2928
160 Ga0501037_0001867 3300049573 Bacteria 15292
161 Ga0501038_0012583 3300049574 Bacteria 7732
162 Ga0501039_0006788 3300049575 Bacteria 8704
163 Ga0501039_0348505 3300049575 Bacteria 1164
164 Ga0501039_0536060 3300049575 Bacteria 919
165 Ga0501040_0028196 3300049576 Bacteria 3784
166 Ga0501042_0374393 3300049578 Bacteria 1031
167 Ga0501043_0016861 3300049579 Bacteria 5725
168 Ga0501043_0200632 3300049579 Bacteria 1548
169 Ga0501046_0046415 3300049580 Bacteria 3448
170 Ga0501046_0147503 3300049580 Bacteria 1776
171 Ga0501047_0010917 3300049581 Bacteria 8590
172 Ga0501047_0046890 3300049581 Bacteria 4175
173 Ga0501048_0009365 3300049582 Bacteria 7353
174 Ga0501067_0001516 3300049583 Bacteria 12649
175 Ga0501069_0001242 3300049585 Bacteria 12479
176 Ga0501070_0045741 3300049586 Bacteria 3639
177 Ga0501072_0023799 3300049588 Bacteria 4758
178 Ga0501072_0059734 3300049588 Bacteria 3006
179 Ga0501073_0006336 3300049589 Bacteria 8808
180 Ga0501074_0000988 3300049590 Bacteria 18460
181 Ga0501074_0598465 3300049590 Bacteria 780
182 Ga0501079_0003401 3300049741 Bacteria 11678
183 Ga0501079_1202507 3300049741 Bacteria 597
184 Ga0501080_0077098 3300049742 Bacteria 3099
185 Ga0501083_0002031 3300049744 Bacteria 13926
186 Ga0501035_0008159 3300049822 Bacteria 9759
187 Ga0501035_0136607 3300049822 Bacteria 2134
188 Ga0501044_0063264 3300049823 Bacteria 3780
189 Ga0501044_0090274 3300049823 Bacteria 3091
190 Ga0501045_0014170 3300049824 Bacteria 5647
191 nmdc:mga03n38_34594_c1 3300050490 Bacteria 2159
192 nmdc:mga0k408_115611_c1 3300050493 Bacteria 1299
193 nmdc:mga0k408_305468_c1 3300050493 Bacteria 949
194 nmdc:mga06z11_309_c1 3300050494 Bacteria 18563
195 nmdc:mga06z11_639448_c1 3300050494 Bacteria 647
196 nmdc:mga06z11_740453_c1 3300050494 Bacteria 599
197 nmdc:mga04h51_3646_c1 3300050495 Bacteria 3764
198 nmdc:mga07m45_165456_c1 3300050496 Bacteria 1284
199 nmdc:mga09592_167477_c1 3300050508 Bacteria 1900
200 nmdc:mga0qj67_130724_c1 3300050509 Bacteria 2034
201 nmdc:mga0qj67_3110_c1 3300050509 Bacteria 11937
202 nmdc:mga06r32_396449_c1 3300050510 Bacteria 1362
203 nmdc:mga08y16_4151_c1 3300050511 Bacteria 15125
204 Ga0500658_0323475 3300053134 Bacteria 709
205 Ga0500616_0043905 3300053153 Bacteria 2387
206 Ga0500627_0040771 3300053158 Bacteria 1993
207 Ga0590071_015464 3300059421 Bacteria 1789
208 Ga0590077_006982 3300059426 Bacteria 2313
209 Ga0501082_0008119 3300060353 Bacteria 9056
210 Ga0466962_0541069 3300061719 Bacteria 591
211 2510248595 2510065045 Bacteria 7761063
212 2644162513 2643221628 Bacteria 5745828
213 2719642978 2718217991 Bacteria 7829542
214 2812360877 2811994879 Bacteria 9313447
215 2874596829 2874590934 Bacteria 8299676
216 2874648634 2874645413 Bacteria 8214782
217 2876777293 2876771140 Bacteria 8287509
218 2876825375 2876818435 Bacteria 8274608
219 2879077624 2879074833 Bacteria 8279565
220 2879130767 2879127579 Bacteria 8294491
221 2879146073 2879142872 Bacteria 8267021
222 2935977914 2935975950 Bacteria 8347125
223 2945948554 2945945610 Bacteria 5951079
224 2945977828 2945972063 Bacteria 6086495
225 2946064992 2946064051 Bacteria 8957905
226 2947232438 2947224130 Bacteria 9938529
227 8006968323 8006964411 Bacteria 8966052
228 8019640048 8019638758 Bacteria 9062356
229 8019667391 8019659431 Bacteria 8577854
230 8019677164 8019668869 Bacteria 8791617
231 8019678820 8019678201 Bacteria 8863603
232 Ga0157327_1083686
233 rootH1_10096852
234 Ga0068868_101148082
235 Ga0070660_101694115
236 Ga0070660_101909323
237 Ga0070689_100071380
238 Ga0070669_100136103
239 Ga0070685_10119323
240 Ga0070679_100061734
241 Ga0070665_100092153
242 Ga0068855_100000686
243 Ga0068855_100760863
244 Ga0068855_101344146
245 Ga0068855_102036953
246 Ga0070664_101333232
247 Ga0068857_100080553
248 Ga0068857_101396364
249 Ga0068852_100034033
250 Ga0068859_100208522
251 Ga0081539_10166919
252 Ga0070717_10132925
253 Ga0075368_10002242
254 Ga0075363_100016981
255 Ga0075367_10000046
256 Ga0075367_10800830
257 Ga0075366_10196881
258 Ga0075430_100016358
259 Ga0075431_100167107
260 Ga0075429_100122201
261 Ga0075429_100134869
262 Ga0097620_100208521
263 Ga0099826_10139676
264 Ga0105240_10000495
265 Ga0105240_10489575
266 Ga0111539_10047577
267 Ga0114129_10436281
268 Ga0105241_11791515
269 Ga0105242_10544069
270 Ga0105238_10045998
271 Ga0105239_10143885
272 Ga0157372_10311516
273 Ga0183367_1012
274 Ga0207692_10192816
275 Ga0207705_10035886
276 Ga0207695_10061593
277 Ga0207671_10071702
278 Ga0207663_10017100
279 Ga0207663_10132291
280 Ga0207652_10071348
281 Ga0207694_10020490
282 Ga0207700_10318600
283 Ga0207644_10001831
284 Ga0207686_10577848
285 Ga0207670_10017224
286 Ga0207691_10285368
287 Ga0207689_10127815
288 Ga0207679_11392911
289 Ga0207667_10002853
290 Ga0207667_11201457
291 Ga0207677_11080099
292 Ga0207677_11170615
293 Ga0207639_10030890
294 Ga0207674_10092480
295 Ga0207674_10518468
296 Ga0207674_11642524
297 Ga0207698_10007527
298 Ga0207698_10180430
299 Ga0209981_1029446
300 Ga0209996_1021298
301 Ga0210000_1027137
302 Ga0209999_1043963
303 Ga0209983_1019598
304 Ga0209971_1003929
305 Ga0209966_1002601
306 Ga0209813_10003661
307 Ga0207428_10086207
308 Ga0268266_10044980
309 Ga0307512_10011801
310 Ga0307512_10030317
311 Ga0307408_100185461
312 Ga0265313_10147453
313 Ga0307508_10002311
314 Ga0307514_10067112
315 Ga0307514_10146853
316 Ga0265314_10045002
317 Ga0265342_10182116
318 Ga0307405_10011334
319 Ga0307413_10167773
320 Ga0307406_10013188
321 Ga0307406_10220331
322 Ga0307412_10077305
323 Ga0307409_100683620
324 Ga0307409_101251826
325 Ga0307414_10065464
326 Ga0307414_10171565
327 Ga0307411_10096706
328 Ga0307411_10922488
329 Ga0307507_10214881
330 Ga0373936_0240871
331 Ga0373931_0235539
332 Ga0395905_0231085
333 Ga0395901_0000003
334 Ga0439436_0023493
335 Ga0439438_024519
336 Ga0439447_004263
337 Ga0439447_041250
338 Ga0439461_0083300
339 Ga0439466_0008040
340 Ga0439466_0011321
341 Ga0451797_0291844
342 Ga0451798_0318620
343 Ga0451807_0301182
344 Ga0451807_0462406
345 Ga0439431_0026659
346 Ga0439441_008945
347 Ga0439442_008878
348 Ga0439443_001558
349 Ga0439445_0020341
350 Ga0439452_010129
351 Ga0439463_147522
352 Ga0450911_024362
353 Ga0450921_004433
354 Ga0450894_008759
355 Ga0450896_028046
356 Ga0450898_005569
357 Ga0450906_004173
358 Ga0439446_0081154
359 Ga0450908_004780
360 Ga0439434_0001130
361 Ga0439434_0126676
362 Ga0439435_0059238
363 Ga0439444_0080332
364 Ga0439460_0172248
365 Ga0450918_000976
366 Ga0466968_0080506
367 Ga0466967_0289637
368 Ga0495638_0049476
369 Ga0495616_0051677
370 Ga0495616_0109527
371 Ga0495642_0007705
372 Ga0495625_0008633
373 Ga0495625_0071839
374 Ga0495649_0202294
375 Ga0495602_0524889
376 Ga0496101_0100093
377 Ga0496108_0372029
378 Ga0496109_0017677
379 Ga0496112_0102183
380 Ga0496113_0088125
381 Ga0496120_0001785
382 Ga0501031_0008882
383 Ga0501032_0004019
384 Ga0501032_0073550
385 Ga0501033_0005113
386 Ga0501033_0252097
387 Ga0501034_0000305
388 Ga0501034_0037934
389 Ga0501034_0112545
390 Ga0501036_0071755
391 Ga0501037_0001867
392 Ga0501038_0012583
393 Ga0501039_0006788
394 Ga0501039_0348505
395 Ga0501039_0536060
396 Ga0501040_0028196
397 Ga0501042_0374393
398 Ga0501043_0016861
399 Ga0501043_0200632
400 Ga0501046_0046415
401 Ga0501046_0147503
402 Ga0501047_0010917
403 Ga0501047_0046890
404 Ga0501048_0009365
405 Ga0501067_0001516
406 Ga0501069_0001242
407 Ga0501070_0045741
408 Ga0501072_0023799
409 Ga0501072_0059734
410 Ga0501073_0006336
411 Ga0501074_0000988
412 Ga0501074_0598465
413 Ga0501079_0003401
414 Ga0501079_1202507
415 Ga0501080_0077098
416 Ga0501083_0002031
417 Ga0501035_0008159
418 Ga0501035_0136607
419 Ga0501044_0063264
420 Ga0501044_0090274
421 Ga0501045_0014170
422 nmdc:mga03n38_34594_c1
423 nmdc:mga0k408_115611_c1
424 nmdc:mga0k408_305468_c1
425 nmdc:mga06z11_309_c1
426 nmdc:mga06z11_639448_c1
427 nmdc:mga06z11_740453_c1
428 nmdc:mga04h51_3646_c1
429 nmdc:mga07m45_165456_c1
430 nmdc:mga09592_167477_c1
431 nmdc:mga0qj67_130724_c1
432 nmdc:mga0qj67_3110_c1
433 nmdc:mga06r32_396449_c1
434 nmdc:mga08y16_4151_c1
435 Ga0500658_0323475
436 Ga0500616_0043905
437 Ga0500627_0040771
438 Ga0590071_015464
439 Ga0590077_006982
440 Ga0501082_0008119
441 Ga0466962_0541069
442 2510248595
443 2644162513
444 2719642978
445 2812360877
446 2874596829
447 2874648634
448 2876777293
449 2876825375
450 2879077624
451 2879130767
452 2879146073
453 2935977914
454 2945948554
455 2945977828
456 2946064992
457 2947232438
458 8006968323
459 8019640048
460 8019667391
461 8019677164
462 8019678820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

1

33

0.96

PF13411

MerR_1

MerR HTH family regulatory protein

1

63

0.94

PF09278

MerR-DNA-bind

MerR, DNA binding

38

97

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.897 1 67
4r4e-assembly1.cif.gz_A structure of glnr-dna complex 0.8653 1 67
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.8651 1 67
5i44-assembly1.cif.gz_D structure of raca-dna complex; p21 form 0.8457 1 65
5i44-assembly4.cif.gz_F-2 structure of raca-dna complex; p21 form 0.8398 1 65
ID Description Score Start End Superfamily
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.904 2 69 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9021 1 67 1.10.1660.10
1exjA02 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9016 1 67 1.10.1660.10
3hh0D01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.901 2 67 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8917 2 67 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A101Q7H8-F1-model_v4 deleted 0.9919 1 129
AF-A0A0M6ZJX8-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9911 1 125 GO:0003677
GO:0003700
AF-A0A1W9I6X2-F1-model_v4 MerR family transcriptional regulator 0.9824 2 128 GO:0003677
GO:0003700
AF-A0A227JBP4-F1-model_v4 MerR family transcriptional regulator 0.9806 2 68 GO:0003677
GO:0003700
AF-A0A1I5EG00-F1-model_v4 DNA-binding transcriptional regulator, MerR family 0.9757 1 127 GO:0003677
GO:0003700

Map