F342941

General Info

Members Datasets Scaffolds Average Seq Length
230 163 225 221

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1003607|Ga0079104_10036076
Length 244
Sequence MIFSDTPGFETPGSETRHCCYIIHTMKILLVEDDFMLGETLQRGLTGGGHAVDWLRDGAMADSALHSQEFDIVLLDLSLPRRDGLSILRQLRARGKTVPVIILTARGDVSDRVTGLDLGADDYLPKPFALEELEARIRALTRRLDGRADPILHCGQLQLNPATKEVRFRGEVVTMASREYQLLAALIQRPGAILSKHQLTEQMYTWDFEVDSNAIEVHIHKLRQKLSPKLIRTVRGLGYQLVDE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
5 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
6 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
159 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.3
Nodule 0.87
Rhizoplane 2.61
Rhizosphere 81.74
Stem 0
Stem Tuber 0
Unclassified 13.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_550266 2162886007 Bacteria 3177
2 rootH2_10220263 3300003320 Bacteria 2544
3 rootL2_10029642 3300003322 Bacteria 5088
4 rootH1_10036123 3300003323 Bacteria 4247
5 Ga0065704_10076910 3300005289 Bacteria 4932
6 Ga0070670_100106936 3300005331 Bacteria 2411
7 Ga0070692_10038585 3300005345 Bacteria 2435
8 Ga0070671_100003081 3300005355 Bacteria 12968
9 Ga0070674_100000999 3300005356 Bacteria 14751
10 Ga0070659_100025994 3300005366 Bacteria 4503
11 Ga0070709_10007037 3300005434 Bacteria 6152
12 Ga0070713_100021688 3300005436 Bacteria 4948
13 Ga0070711_100287884 3300005439 Bacteria 1302
14 Ga0070708_100485652 3300005445 Bacteria 1165
15 Ga0070663_100250850 3300005455 Bacteria 1400
16 Ga0070681_10060743 3300005458 Bacteria 3755
17 Ga0070679_100029160 3300005530 Bacteria 5443
18 Ga0068853_100220604 3300005539 Bacteria 1731
19 Ga0070665_100014906 3300005548 Bacteria 7803
20 Ga0068855_100002184 3300005563 Bacteria 24191
21 Ga0068855_100007677 3300005563 Bacteria 13031
22 Ga0068855_100082522 3300005563 Bacteria 3725
23 Ga0068856_100083295 3300005614 Bacteria 3176
24 Ga0068852_100013921 3300005616 Bacteria 6168
25 Ga0068864_100024923 3300005618 Bacteria 5033
26 Ga0068863_100003178 3300005841 Bacteria 16248
27 Ga0068863_100037847 3300005841 Bacteria 4591
28 Ga0068858_100003249 3300005842 Bacteria 16197
29 Ga0068860_100000657 3300005843 Bacteria 40225
30 Ga0068860_100000904 3300005843 Bacteria 32892
31 Ga0068862_100114539 3300005844 Bacteria 2370
32 Ga0070715_10162317 3300006163 Bacteria 1105
33 Ga0075431_101030924 3300006847 Bacteria 789
34 Ga0075429_100188786 3300006880 Bacteria 1806
35 Ga0075429_100470057 3300006880 Bacteria 1102
36 Ga0079104_1003607 3300006946 Bacteria 7081
37 Ga0105240_10000018 3300009093 Bacteria 434461
38 Ga0105240_10015676 3300009093 Bacteria 10290
39 Ga0105240_10024997 3300009093 Bacteria 7861
40 Ga0105240_10107983 3300009093 Bacteria 3373
41 Ga0105240_10155792 3300009093 Bacteria 2717
42 Ga0105240_10156673 3300009093 Bacteria 2708
43 Ga0105240_10265383 3300009093 Bacteria 1979
44 Ga0111539_10000771 3300009094 Bacteria 41650
45 Ga0105247_10025812 3300009101 Bacteria 3546
46 Ga0105241_10004437 3300009174 Bacteria 10375
47 Ga0105237_10065140 3300009545 Bacteria 3640
48 Ga0105237_10070105 3300009545 Bacteria 3501
49 Ga0105237_10233936 3300009545 Bacteria 1838
50 Ga0105238_10012622 3300009551 Bacteria 8527
51 Ga0105238_10040019 3300009551 Bacteria 4751
52 Ga0105238_10307111 3300009551 Bacteria 1571
53 Ga0105249_10007566 3300009553 Bacteria 9476
54 Ga0105249_10109696 3300009553 Unclassified 2607
55 Ga0105239_10042949 3300010375 Bacteria 4953
56 Ga0105239_10113904 3300010375 Bacteria 2999
57 Ga0157369_10002941 3300013105 Bacteria 20371
58 Ga0157369_10002959 3300013105 Bacteria 20314
59 Ga0157374_10373697 3300013296 Bacteria 1419
60 Ga0157372_10004592 3300013307 Bacteria 14681
61 Ga0157372_10052503 3300013307 Bacteria 4540
62 Ga0157372_10278382 3300013307 Bacteria 1945
63 Ga0163163_10266786 3300014325 Bacteria 1763
64 Ga0157380_10389570 3300014326 Bacteria 1318
65 Ga0213876_10216636 3300021384 Bacteria 1018
66 Ga0213875_10010838 3300021388 Bacteria 4556
67 Ga0207647_10058515 3300025904 Bacteria 2360
68 Ga0207699_10042876 3300025906 Bacteria 2625
69 Ga0207654_10005979 3300025911 Bacteria 6123
70 Ga0207707_10134347 3300025912 Bacteria 2163
71 Ga0207707_10232593 3300025912 Bacteria 1603
72 Ga0207695_10000141 3300025913 Bacteria 215831
73 Ga0207695_10012344 3300025913 Bacteria 10264
74 Ga0207695_10020388 3300025913 Bacteria 7595
75 Ga0207695_10075977 3300025913 Bacteria 3416
76 Ga0207695_10174778 3300025913 Bacteria 2071
77 Ga0207695_10265062 3300025913 Bacteria 1615
78 Ga0207695_10303010 3300025913 Bacteria 1489
79 Ga0207671_10029146 3300025914 Bacteria 4124
80 Ga0207652_10275911 3300025921 Bacteria 1516
81 Ga0207694_10050105 3300025924 Bacteria 3233
82 Ga0207694_10755167 3300025924 Bacteria 821
83 Ga0207650_10019966 3300025925 Bacteria 4718
84 Ga0207700_10258872 3300025928 Bacteria 1489
85 Ga0207644_10000658 3300025931 Bacteria 21848
86 Ga0207690_10025414 3300025932 Bacteria 3718
87 Ga0207667_10002874 3300025949 Bacteria 21384
88 Ga0207667_10370614 3300025949 Bacteria 1459
89 Ga0207667_10490013 3300025949 Unclassified 1247
90 Ga0207667_10823481 3300025949 Bacteria 924
91 Ga0207651_10272719 3300025960 Bacteria 1394
92 Ga0207640_10198064 3300025981 Bacteria 1520
93 Ga0207703_10001727 3300026035 Bacteria 19642
94 Ga0207639_10080439 3300026041 Bacteria 2577
95 Ga0207678_10051606 3300026067 Bacteria 3551
96 Ga0207702_10107372 3300026078 Bacteria 2475
97 Ga0207702_10310901 3300026078 Bacteria 1498
98 Ga0207641_10000599 3300026088 Bacteria 39635
99 Ga0207676_10049405 3300026095 Bacteria 3272
100 Ga0207698_10012056 3300026142 Bacteria 5636
101 Ga0209281_1011394 3300027111 Unclassified 1994
102 Ga0268266_10001067 3300028379 Bacteria 34352
103 Ga0268265_10535488 3300028380 Bacteria 1109
104 Ga0268264_10000034 3300028381 Bacteria 401894
105 Ga0268264_10001061 3300028381 Bacteria 27289
106 Ga0307515_10000006 3300028794 Bacteria 725810
107 Ga0307515_10000645 3300028794 Bacteria 80548
108 Ga0265338_10000343 3300028800 Bacteria 84846
109 Ga0265338_10368899 3300028800 Bacteria 1028
110 Ga0265329_10046268 3300031242 Bacteria 1390
111 Ga0307408_100049808 3300031548 Bacteria 3010
112 Ga0307408_100475328 3300031548 Bacteria 1089
113 Ga0265314_10076564 3300031711 Bacteria 2222
114 Ga0316578_10266376 3300031728 Bacteria 1027
115 Ga0307516_10002063 3300031730 Bacteria 27367
116 Ga0307405_10008766 3300031731 Bacteria 5146
117 Ga0307413_10001784 3300031824 Bacteria 8423
118 Ga0307413_10101711 3300031824 Bacteria 1901
119 Ga0307413_10492130 3300031824 Bacteria 983
120 Ga0307410_10001279 3300031852 Bacteria 11192
121 Ga0307410_10333235 3300031852 Bacteria 1207
122 Ga0307406_10002136 3300031901 Bacteria 10766
123 Ga0307407_10148985 3300031903 Bacteria 1518
124 Ga0307412_10006403 3300031911 Bacteria 6657
125 Ga0307409_100234350 3300031995 Bacteria 1666
126 Ga0307416_100018440 3300032002 Bacteria 4916
127 Ga0307416_101261836 3300032002 Bacteria 845
128 Ga0307414_10007975 3300032004 Bacteria 5981
129 Ga0307414_10326771 3300032004 Bacteria 1308
130 Ga0307411_10004922 3300032005 Bacteria 6494
131 Ga0307411_10049254 3300032005 Bacteria 2737
132 Ga0307415_100003716 3300032126 Bacteria 7808
133 Ga0307510_10000005 3300033180 Bacteria 633068
134 Ga0307510_10035334 3300033180 Bacteria 5584
135 Ga0373923_0002790 3300035111 Bacteria 5468
136 Ga0373936_0009588 3300035113 Bacteria 3648
137 Ga0373954_0075793 3300035118 Bacteria 1602
138 Ga0373955_0016432 3300035172 Bacteria 3643
139 Ga0316574_0137300 3300035398 Bacteria 1574
140 Ga0373933_0013349 3300035724 Bacteria 4552
141 Ga0373937_0004233 3300036401 Bacteria 12164
142 Ga0316584_0043265 3300036712 Unclassified 3358
143 Ga0395899_0009458 3300037312 Bacteria 7481
144 Ga0395905_0414975 3300037471 Bacteria 1242
145 Ga0395905_0734800 3300037471 Bacteria 889
146 Ga0316581_0046858 3300037588 Bacteria 1322
147 Ga0436364_0498979 3300037853 Bacteria 13596
148 Ga0436365_0897382 3300039437 Bacteria 3514
149 Ga0436365_1224200 3300039437 Bacteria 1807
150 Ga0436363_1288003 3300039450 Bacteria 3894
151 Ga0450909_036584 3300042185 Bacteria 751
152 Ga0451577_0217264 3300042876 Bacteria 1727
153 Ga0466961_0027137 3300044693 Bacteria 3682
154 Ga0453684_0295103 3300044712 Bacteria 1844
155 Ga0451576_0533593 3300045051 Bacteria 1233
156 Ga0495609_0209803 3300046538 Bacteria 812
157 Ga0495649_0209640 3300046694 Bacteria 1010
158 Ga0495687_084890 3300047443 Bacteria 1229
159 Ga0496100_0731483 3300048903 Bacteria 773
160 Ga0496102_0047498 3300048905 Bacteria 3902
161 Ga0496102_0049502 3300048905 Bacteria 3823
162 Ga0496102_0830720 3300048905 Bacteria 846
163 Ga0496102_1234036 3300048905 Bacteria 667
164 Ga0496103_0298436 3300048906 Bacteria 1036
165 Ga0496117_0000012 3300048920 Bacteria 608530
166 Ga0496118_0000003 3300048921 Bacteria 773148
167 Ga0496119_0000196 3300048922 Bacteria 85266
168 Ga0496119_0005323 3300048922 Bacteria 12383
169 Ga0496119_0022197 3300048922 Bacteria 4555
170 Ga0496120_0000338 3300048923 Bacteria 78053
171 Ga0496120_0024863 3300048923 Bacteria 3727
172 Ga0496121_0029567 3300048924 Bacteria 5062
173 Ga0496124_0057742 3300048927 Bacteria 3268
174 Ga0496125_0000271 3300048928 Bacteria 105521
175 Ga0496125_0014522 3300048928 Bacteria 7667
176 Ga0496125_0144502 3300048928 Bacteria 1647
177 Ga0496126_0005913 3300048929 Bacteria 13798
178 Ga0496126_0090059 3300048929 Bacteria 2699
179 Ga0501031_0095469 3300049568 Bacteria 1940
180 Ga0501039_0065167 3300049575 Bacteria 2826
181 Ga0501039_0157782 3300049575 Bacteria 1783
182 Ga0501040_0036529 3300049576 Bacteria 3335
183 Ga0501046_0015120 3300049580 Bacteria 6489
184 Ga0501047_0013993 3300049581 Bacteria 7626
185 Ga0501047_0083438 3300049581 Bacteria 3071
186 Ga0501047_0300359 3300049581 Bacteria 1448
187 Ga0501048_0285590 3300049582 Bacteria 1173
188 Ga0501067_0126141 3300049583 Bacteria 1424
189 Ga0501068_0027919 3300049584 Bacteria 3335
190 Ga0501069_0025550 3300049585 Bacteria 3229
191 Ga0501069_0190400 3300049585 Bacteria 1187
192 Ga0501070_0005758 3300049586 Bacteria 10567
193 Ga0501071_0226692 3300049587 Bacteria 1407
194 Ga0501072_0005559 3300049588 Bacteria 9589
195 Ga0501072_0083214 3300049588 Bacteria 2537
196 Ga0501073_0006197 3300049589 Bacteria 8919
197 Ga0501073_0206965 3300049589 Bacteria 1356
198 Ga0501074_0007549 3300049590 Bacteria 7867
199 Ga0501074_0091632 3300049590 Bacteria 2177
200 Ga0501075_0472949 3300049591 Bacteria 956
201 Ga0501075_0510202 3300049591 Bacteria 917
202 Ga0501076_0031560 3300049592 Bacteria 4133
203 Ga0501077_0025482 3300049593 Bacteria 3757
204 Ga0501079_0001754 3300049741 Bacteria 15461
205 Ga0501079_0111885 3300049741 Bacteria 2122
206 Ga0501080_0006901 3300049742 Bacteria 10241
207 Ga0501080_0291751 3300049742 Bacteria 1481
208 Ga0501081_0071054 3300049743 Bacteria 2426
209 Ga0501083_0001415 3300049744 Bacteria 16344
210 Ga0501035_0725792 3300049822 Bacteria 799
211 Ga0501035_0982015 3300049822 Bacteria 665
212 Ga0501044_0010433 3300049823 Bacteria 10083
213 Ga0501045_0038980 3300049824 Bacteria 3457
214 nmdc:mga0yw44_324881_c1 3300050492 Bacteria 1033
215 nmdc:mga09592_180276_c1 3300050508 Bacteria 1827
216 nmdc:mga09592_309439_c1 3300050508 Bacteria 1369
217 nmdc:mga08y16_189337_c1 3300050511 Bacteria 2135
218 Ga0495619_0205259 3300053085 Bacteria 1364
219 Ga0500591_143140 3300053115 Bacteria 939
220 Ga0500595_012044 3300053119 Bacteria 3356
221 Ga0501084_0028099 3300054114 Bacteria 4701
222 Ga0590075_003683 3300059424 Bacteria 3637
223 Ga0501082_0003900 3300060353 Bacteria 13031
224 Ga0501082_0265575 3300060353 Bacteria 1493
225 Ga0530510_0410062 3300061734 Bacteria 1022

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042185 Ga0450909_036584 Ga0450909_036584_28_636 194
2 3300036712 Ga0316584_0043265 Ga0316584_0043265_2739_3347 195
3 3300046538 Ga0495609_0209803 Ga0495609_0209803_186_797 201
4 3300048905 Ga0496102_1234036 Ga0496102_1234036_12_623 201
5 3300014326 Ga0157380_10389570 Ga0157380_103895702 203
6 3300049568 Ga0501031_0095469 Ga0501031_0095469_355_1041 207
7 3300049575 Ga0501039_0065167 Ga0501039_0065167_468_1154 207
8 3300049576 Ga0501040_0036529 Ga0501040_0036529_350_1036 207
9 3300049580 Ga0501046_0015120 Ga0501046_0015120_354_1040 207
10 3300049582 Ga0501048_0285590 Ga0501048_0285590_417_1103 207
11 3300049585 Ga0501069_0190400 Ga0501069_0190400_362_1048 207
12 3300049587 Ga0501071_0226692 Ga0501071_0226692_465_1151 207
13 3300049588 Ga0501072_0005559 Ga0501072_0005559_2672_3358 207
14 3300049589 Ga0501073_0206965 Ga0501073_0206965_243_962 207
15 3300049590 Ga0501074_0091632 Ga0501074_0091632_142_828 207
16 3300049591 Ga0501075_0510202 Ga0501075_0510202_219_905 207
17 3300049592 Ga0501076_0031560 Ga0501076_0031560_1559_2245 207
18 3300049593 Ga0501077_0025482 Ga0501077_0025482_1240_1926 207
19 3300049741 Ga0501079_0111885 Ga0501079_0111885_773_1459 207
20 3300049742 Ga0501080_0291751 Ga0501080_0291751_82_768 207
21 3300049743 Ga0501081_0071054 Ga0501081_0071054_1463_2149 207
22 3300049824 Ga0501045_0038980 Ga0501045_0038980_453_1139 207
23 3300054114 Ga0501084_0028099 Ga0501084_0028099_4004_4690 207
24 3300060353 Ga0501082_0003900 Ga0501082_0003900_162_848 207
25 3300061734 Ga0530510_0410062 Ga0530510_0410062_314_1000 207
26 3300049575 Ga0501039_0157782 Ga0501039_0157782_111_773 208
27 3300005844 Ga0068862_100114539 Ga0068862_1001145393 210
28 3300006880 Ga0075429_100188786 Ga0075429_1001887862 210
29 3300025913 Ga0207695_10075977 Ga0207695_100759773 210
30 3300025949 Ga0207667_10823481 Ga0207667_108234812 210
31 3300031242 Ga0265329_10046268 Ga0265329_100462682 210
32 3300031711 Ga0265314_10076564 Ga0265314_100765642 210
33 3300033180 Ga0307510_10035334 Ga0307510_100353344 210
34 3300049822 Ga0501035_0982015 Ga0501035_0982015_16_648 210
35 3300013105 Ga0157369_10002941 Ga0157369_1000294114 214
36 3300005331 Ga0070670_100106936 Ga0070670_1001069362 216
37 iso_pu_bacteria 2515154189 2516023148 216
38 iso_pu_bacteria 2524023250 2524610353 216
39 iso_pu_bacteria 2883087390 2883093480 216
40 3300005843 Ga0068860_100000904 Ga0068860_10000090430 217
41 3300028381 Ga0268264_10001061 Ga0268264_1000106123 217
42 3300006880 Ga0075429_100470057 Ga0075429_1004700572 218
43 3300028800 Ga0265338_10368899 Ga0265338_103688991 218
44 3300048922 Ga0496119_0022197 Ga0496119_0022197_2384_3046 218
45 3300048928 Ga0496125_0144502 Ga0496125_0144502_892_1554 218
46 3300050508 nmdc:mga09592_309439_c1 nmdc:mga09592_309439_c1_570_1229 218
47 3300005355 Ga0070671_100003081 Ga0070671_1000030819 219
48 3300005366 Ga0070659_100025994 Ga0070659_1000259943 219
49 3300005439 Ga0070711_100287884 Ga0070711_1002878842 219
50 3300005563 Ga0068855_100007677 Ga0068855_1000076772 219
51 3300005614 Ga0068856_100083295 Ga0068856_1000832952 219
52 3300005616 Ga0068852_100013921 Ga0068852_1000139213 219
53 3300005841 Ga0068863_100037847 Ga0068863_1000378472 219
54 3300006163 Ga0070715_10162317 Ga0070715_101623172 219
55 3300006946 Ga0079104_1003607 Ga0079104_10036076 219
56 3300009093 Ga0105240_10024997 Ga0105240_100249975 219
57 3300009551 Ga0105238_10012622 Ga0105238_100126227 219
58 3300013105 Ga0157369_10002959 Ga0157369_100029592 219
59 3300013307 Ga0157372_10004592 Ga0157372_100045926 219
60 3300025913 Ga0207695_10020388 Ga0207695_100203882 219
61 3300025931 Ga0207644_10000658 Ga0207644_100006584 219
62 3300025932 Ga0207690_10025414 Ga0207690_100254142 219
63 3300026078 Ga0207702_10107372 Ga0207702_101073722 219
64 3300026142 Ga0207698_10012056 Ga0207698_100120563 219
65 3300027111 Ga0209281_1011394 Ga0209281_10113942 219
66 3300028800 Ga0265338_10000343 Ga0265338_1000034336 219
67 3300032002 Ga0307416_101261836 Ga0307416_1012618361 219
68 3300035111 Ga0373923_0002790 Ga0373923_0002790_4276_4950 219
69 3300035118 Ga0373954_0075793 Ga0373954_0075793_647_1321 219
70 3300035172 Ga0373955_0016432 Ga0373955_0016432_850_1524 219
71 3300035724 Ga0373933_0013349 Ga0373933_0013349_2823_3497 219
72 3300036401 Ga0373937_0004233 Ga0373937_0004233_9730_10404 219
73 3300044693 Ga0466961_0027137 Ga0466961_0027137_767_1426 219
74 3300053085 Ga0495619_0205259 Ga0495619_0205259_564_1238 219
75 3300053119 Ga0500595_012044 Ga0500595_012044_1791_2450 219
76 2162886007 SwRhRL2b_contig_550266 SwRhRL2b_0768.00000160 220
77 3300003320 rootH2_10220263 rootH2_102202632 220
78 3300003322 rootL2_10029642 rootL2_100296422 220
79 3300003323 rootH1_10036123 rootH1_100361232 220
80 3300005289 Ga0065704_10076910 Ga0065704_100769103 220
81 3300005345 Ga0070692_10038585 Ga0070692_100385852 220
82 3300005356 Ga0070674_100000999 Ga0070674_1000009998 220
83 3300005434 Ga0070709_10007037 Ga0070709_100070374 220
84 3300005436 Ga0070713_100021688 Ga0070713_1000216884 220
85 3300005445 Ga0070708_100485652 Ga0070708_1004856522 220
86 3300005455 Ga0070663_100250850 Ga0070663_1002508502 220
87 3300005458 Ga0070681_10060743 Ga0070681_100607432 220
88 3300005530 Ga0070679_100029160 Ga0070679_1000291602 220
89 3300005539 Ga0068853_100220604 Ga0068853_1002206042 220
90 3300005548 Ga0070665_100014906 Ga0070665_1000149068 220
91 3300005563 Ga0068855_100002184 Ga0068855_10000218417 220
92 3300005563 Ga0068855_100082522 Ga0068855_1000825223 220
93 3300005618 Ga0068864_100024923 Ga0068864_1000249235 220
94 3300005841 Ga0068863_100003178 Ga0068863_1000031788 220
95 3300005842 Ga0068858_100003249 Ga0068858_1000032499 220
96 3300005843 Ga0068860_100000657 Ga0068860_10000065729 220
97 3300006847 Ga0075431_101030924 Ga0075431_1010309241 220
98 3300009093 Ga0105240_10000018 Ga0105240_10000018182 220
99 3300009093 Ga0105240_10015676 Ga0105240_100156763 220
100 3300009093 Ga0105240_10107983 Ga0105240_101079833 220
101 3300009093 Ga0105240_10155792 Ga0105240_101557922 220
102 3300009093 Ga0105240_10156673 Ga0105240_101566732 220
103 3300009093 Ga0105240_10265383 Ga0105240_102653832 220
104 3300009094 Ga0111539_10000771 Ga0111539_1000077121 220
105 3300009101 Ga0105247_10025812 Ga0105247_100258122 220
106 3300009174 Ga0105241_10004437 Ga0105241_100044376 220
107 3300009545 Ga0105237_10065140 Ga0105237_100651401 220
108 3300009545 Ga0105237_10070105 Ga0105237_100701053 220
109 3300009545 Ga0105237_10233936 Ga0105237_102339362 220
110 3300009551 Ga0105238_10040019 Ga0105238_100400192 220
111 3300009551 Ga0105238_10307111 Ga0105238_103071112 220
112 3300009553 Ga0105249_10007566 Ga0105249_100075666 220
113 3300009553 Ga0105249_10109696 Ga0105249_101096962 220
114 3300010375 Ga0105239_10042949 Ga0105239_100429493 220
115 3300010375 Ga0105239_10113904 Ga0105239_101139042 220
116 3300013296 Ga0157374_10373697 Ga0157374_103736972 220
117 3300013307 Ga0157372_10052503 Ga0157372_100525032 220
118 3300013307 Ga0157372_10278382 Ga0157372_102783823 220
119 3300014325 Ga0163163_10266786 Ga0163163_102667862 220
120 3300021384 Ga0213876_10216636 Ga0213876_102166362 220
121 3300021388 Ga0213875_10010838 Ga0213875_100108382 220
122 3300025904 Ga0207647_10058515 Ga0207647_100585152 220
123 3300025906 Ga0207699_10042876 Ga0207699_100428763 220
124 3300025911 Ga0207654_10005979 Ga0207654_100059792 220
125 3300025912 Ga0207707_10134347 Ga0207707_101343472 220
126 3300025912 Ga0207707_10232593 Ga0207707_102325932 220
127 3300025913 Ga0207695_10000141 Ga0207695_10000141102 220
128 3300025913 Ga0207695_10012344 Ga0207695_100123447 220
129 3300025913 Ga0207695_10174778 Ga0207695_101747782 220
130 3300025913 Ga0207695_10265062 Ga0207695_102650622 220
131 3300025913 Ga0207695_10303010 Ga0207695_103030102 220
132 3300025914 Ga0207671_10029146 Ga0207671_100291465 220
133 3300025921 Ga0207652_10275911 Ga0207652_102759112 220
134 3300025924 Ga0207694_10050105 Ga0207694_100501052 220
135 3300025924 Ga0207694_10755167 Ga0207694_107551671 220
136 3300025925 Ga0207650_10019966 Ga0207650_100199662 220
137 3300025928 Ga0207700_10258872 Ga0207700_102588722 220
138 3300025949 Ga0207667_10002874 Ga0207667_1000287417 220
139 3300025949 Ga0207667_10370614 Ga0207667_103706142 220
140 3300025949 Ga0207667_10490013 Ga0207667_104900132 220
141 3300025960 Ga0207651_10272719 Ga0207651_102727192 220
142 3300025981 Ga0207640_10198064 Ga0207640_101980641 220
143 3300026035 Ga0207703_10001727 Ga0207703_1000172716 220
144 3300026041 Ga0207639_10080439 Ga0207639_100804392 220
145 3300026067 Ga0207678_10051606 Ga0207678_100516061 220
146 3300026078 Ga0207702_10310901 Ga0207702_103109012 220
147 3300026088 Ga0207641_10000599 Ga0207641_1000059932 220
148 3300026095 Ga0207676_10049405 Ga0207676_100494053 220
149 3300028379 Ga0268266_10001067 Ga0268266_1000106713 220
150 3300028380 Ga0268265_10535488 Ga0268265_105354882 220
151 3300028381 Ga0268264_10000034 Ga0268264_1000003456 220
152 3300028794 Ga0307515_10000006 Ga0307515_1000000692 220
153 3300028794 Ga0307515_10000645 Ga0307515_1000064539 220
154 3300031548 Ga0307408_100049808 Ga0307408_1000498082 220
155 3300031548 Ga0307408_100475328 Ga0307408_1004753282 220
156 3300031728 Ga0316578_10266376 Ga0316578_102663761 220
157 3300031730 Ga0307516_10002063 Ga0307516_100020639 220
158 3300031731 Ga0307405_10008766 Ga0307405_100087664 220
159 3300031824 Ga0307413_10001784 Ga0307413_100017846 220
160 3300031824 Ga0307413_10101711 Ga0307413_101017112 220
161 3300031824 Ga0307413_10492130 Ga0307413_104921302 220
162 3300031852 Ga0307410_10001279 Ga0307410_1000127912 220
163 3300031852 Ga0307410_10333235 Ga0307410_103332352 220
164 3300031901 Ga0307406_10002136 Ga0307406_1000213612 220
165 3300031903 Ga0307407_10148985 Ga0307407_101489852 220
166 3300031911 Ga0307412_10006403 Ga0307412_100064036 220
167 3300031995 Ga0307409_100234350 Ga0307409_1002343502 220
168 3300032002 Ga0307416_100018440 Ga0307416_1000184403 220
169 3300032004 Ga0307414_10007975 Ga0307414_100079753 220
170 3300032004 Ga0307414_10326771 Ga0307414_103267712 220
171 3300032005 Ga0307411_10004922 Ga0307411_100049226 220
172 3300032005 Ga0307411_10049254 Ga0307411_100492541 220
173 3300032126 Ga0307415_100003716 Ga0307415_1000037168 220
174 3300033180 Ga0307510_10000005 Ga0307510_10000005406 220
175 3300035113 Ga0373936_0009588 Ga0373936_0009588_198_866 220
176 3300035398 Ga0316574_0137300 Ga0316574_0137300_214_915 220
177 3300037312 Ga0395899_0009458 Ga0395899_0009458_5716_6426 220
178 3300037471 Ga0395905_0414975 Ga0395905_0414975_441_1127 220
179 3300037471 Ga0395905_0734800 Ga0395905_0734800_140_814 220
180 3300037588 Ga0316581_0046858 Ga0316581_0046858_460_1143 220
181 3300037853 Ga0436364_0498979 Ga0436364_0498979_5426_6133 220
182 3300039437 Ga0436365_0897382 Ga0436365_0897382_993_1661 220
183 3300039437 Ga0436365_1224200 Ga0436365_1224200_473_1135 220
184 3300039450 Ga0436363_1288003 Ga0436363_1288003_1061_1729 220
185 3300042876 Ga0451577_0217264 Ga0451577_0217264_18_707 220
186 3300044712 Ga0453684_0295103 Ga0453684_0295103_494_1183 220
187 3300045051 Ga0451576_0533593 Ga0451576_0533593_255_956 220
188 3300046694 Ga0495649_0209640 Ga0495649_0209640_27_695 220
189 3300047443 Ga0495687_084890 Ga0495687_084890_331_999 220
190 3300048903 Ga0496100_0731483 Ga0496100_0731483_23_691 220
191 3300048905 Ga0496102_0047498 Ga0496102_0047498_150_818 220
192 3300048905 Ga0496102_0049502 Ga0496102_0049502_925_1614 220
193 3300048905 Ga0496102_0830720 Ga0496102_0830720_18_704 220
194 3300048906 Ga0496103_0298436 Ga0496103_0298436_284_952 220
195 3300048920 Ga0496117_0000012 Ga0496117_0000012_190784_191452 220
196 3300048921 Ga0496118_0000003 Ga0496118_0000003_595176_595844 220
197 3300048922 Ga0496119_0000196 Ga0496119_0000196_59681_60349 220
198 3300048922 Ga0496119_0005323 Ga0496119_0005323_7065_7733 220
199 3300048923 Ga0496120_0000338 Ga0496120_0000338_24892_25560 220
200 3300048923 Ga0496120_0024863 Ga0496120_0024863_2384_3052 220
201 3300048924 Ga0496121_0029567 Ga0496121_0029567_994_1662 220
202 3300048927 Ga0496124_0057742 Ga0496124_0057742_2407_3075 220
203 3300048928 Ga0496125_0000271 Ga0496125_0000271_60491_61159 220
204 3300048928 Ga0496125_0014522 Ga0496125_0014522_908_1576 220
205 3300048929 Ga0496126_0005913 Ga0496126_0005913_12063_12731 220
206 3300048929 Ga0496126_0090059 Ga0496126_0090059_360_1028 220
207 3300049581 Ga0501047_0013993 Ga0501047_0013993_4605_5267 220
208 3300049581 Ga0501047_0083438 Ga0501047_0083438_1207_1869 220
209 3300049581 Ga0501047_0300359 Ga0501047_0300359_314_976 220
210 3300049583 Ga0501067_0126141 Ga0501067_0126141_211_873 220
211 3300049584 Ga0501068_0027919 Ga0501068_0027919_1175_1837 220
212 3300049585 Ga0501069_0025550 Ga0501069_0025550_197_859 220
213 3300049586 Ga0501070_0005758 Ga0501070_0005758_9341_10003 220
214 3300049588 Ga0501072_0083214 Ga0501072_0083214_747_1409 220
215 3300049589 Ga0501073_0006197 Ga0501073_0006197_7224_7886 220
216 3300049590 Ga0501074_0007549 Ga0501074_0007549_4527_5189 220
217 3300049591 Ga0501075_0472949 Ga0501075_0472949_253_921 220
218 3300049741 Ga0501079_0001754 Ga0501079_0001754_10623_11285 220
219 3300049742 Ga0501080_0006901 Ga0501080_0006901_3538_4200 220
220 3300049744 Ga0501083_0001415 Ga0501083_0001415_6133_6795 220
221 3300049822 Ga0501035_0725792 Ga0501035_0725792_19_693 220
222 3300049823 Ga0501044_0010433 Ga0501044_0010433_5972_6634 220
223 3300050492 nmdc:mga0yw44_324881_c1 nmdc:mga0yw44_324881_c1_21_707 220
224 3300050508 nmdc:mga09592_180276_c1 nmdc:mga09592_180276_c1_192_854 220
225 3300050511 nmdc:mga08y16_189337_c1 nmdc:mga08y16_189337_c1_1313_1975 220
226 3300053115 Ga0500591_143140 Ga0500591_143140_60_728 220
227 3300059424 Ga0590075_003683 Ga0590075_003683_243_986 220
228 3300060353 Ga0501082_0265575 Ga0501082_0265575_744_1406 220
229 iso_pu_bacteria 2501025502 2501079450 220
230 iso_pu_bacteria 2510917013 2511093810 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

28

138

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

170

241

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.964 2 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9601 1 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9589 1 118
3f7a-assembly1.cif.gz_A structure of orthorhombic crystal form of pseudomonas aeruginosa rssb 0.9542 2 120
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9538 2 117
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9779 1 83 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9734 1 80 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9733 1 80 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9723 1 80 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9704 1 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Z7ESV8-F1-model_v4 DNA-binding response regulator 0.8218 1 220 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7Z7ESV8-F1-model_v4 DNA-binding response regulator 0.8183 1 220 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1H3NKW3-F1-model_v4 Two-component system, OmpR family, response regulator BasR 0.8087 1 217 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4V6PXR8-F1-model_v4 Two-component system response regulator TctD 0.766 1 218 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4V6PXR8-F1-model_v4 Two-component system response regulator TctD 0.7572 1 218 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
93.18 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map