F342941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 230 | 163 | 225 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300006946|Ga0079104_1003607|Ga0079104_10036076 |
| Length | 244 |
| Sequence | MIFSDTPGFETPGSETRHCCYIIHTMKILLVEDDFMLGETLQRGLTGGGHAVDWLRDGAMADSALHSQEFDIVLLDLSLPRRDGLSILRQLRARGKTVPVIILTARGDVSDRVTGLDLGADDYLPKPFALEELEARIRALTRRLDGRADPILHCGQLQLNPATKEVRFRGEVVTMASREYQLLAALIQRPGAILSKHQLTEQMYTWDFEVDSNAIEVHIHKLRQKLSPKLIRTVRGLGYQLVDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 5 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 6 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 35 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 36 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 51 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 52 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 81 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 82 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 83 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 84 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 85 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 86 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 87 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 88 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 89 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 90 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 91 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 92 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 93 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 94 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 95 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 96 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 97 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 98 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 99 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 100 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 101 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 102 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 103 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 105 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 108 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 109 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 110 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 111 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 112 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 113 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 114 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 115 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 116 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 121 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 122 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 123 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 124 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 125 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 126 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 127 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 128 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 129 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 130 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 155 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 159 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 160 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 162 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.83 |
| Metatranscriptomes | 0 |
| Isolates | 2.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.3 |
| Nodule | 0.87 |
| Rhizoplane | 2.61 |
| Rhizosphere | 81.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_550266 | 2162886007 | Bacteria | 3177 |
| 2 | rootH2_10220263 | 3300003320 | Bacteria | 2544 |
| 3 | rootL2_10029642 | 3300003322 | Bacteria | 5088 |
| 4 | rootH1_10036123 | 3300003323 | Bacteria | 4247 |
| 5 | Ga0065704_10076910 | 3300005289 | Bacteria | 4932 |
| 6 | Ga0070670_100106936 | 3300005331 | Bacteria | 2411 |
| 7 | Ga0070692_10038585 | 3300005345 | Bacteria | 2435 |
| 8 | Ga0070671_100003081 | 3300005355 | Bacteria | 12968 |
| 9 | Ga0070674_100000999 | 3300005356 | Bacteria | 14751 |
| 10 | Ga0070659_100025994 | 3300005366 | Bacteria | 4503 |
| 11 | Ga0070709_10007037 | 3300005434 | Bacteria | 6152 |
| 12 | Ga0070713_100021688 | 3300005436 | Bacteria | 4948 |
| 13 | Ga0070711_100287884 | 3300005439 | Bacteria | 1302 |
| 14 | Ga0070708_100485652 | 3300005445 | Bacteria | 1165 |
| 15 | Ga0070663_100250850 | 3300005455 | Bacteria | 1400 |
| 16 | Ga0070681_10060743 | 3300005458 | Bacteria | 3755 |
| 17 | Ga0070679_100029160 | 3300005530 | Bacteria | 5443 |
| 18 | Ga0068853_100220604 | 3300005539 | Bacteria | 1731 |
| 19 | Ga0070665_100014906 | 3300005548 | Bacteria | 7803 |
| 20 | Ga0068855_100002184 | 3300005563 | Bacteria | 24191 |
| 21 | Ga0068855_100007677 | 3300005563 | Bacteria | 13031 |
| 22 | Ga0068855_100082522 | 3300005563 | Bacteria | 3725 |
| 23 | Ga0068856_100083295 | 3300005614 | Bacteria | 3176 |
| 24 | Ga0068852_100013921 | 3300005616 | Bacteria | 6168 |
| 25 | Ga0068864_100024923 | 3300005618 | Bacteria | 5033 |
| 26 | Ga0068863_100003178 | 3300005841 | Bacteria | 16248 |
| 27 | Ga0068863_100037847 | 3300005841 | Bacteria | 4591 |
| 28 | Ga0068858_100003249 | 3300005842 | Bacteria | 16197 |
| 29 | Ga0068860_100000657 | 3300005843 | Bacteria | 40225 |
| 30 | Ga0068860_100000904 | 3300005843 | Bacteria | 32892 |
| 31 | Ga0068862_100114539 | 3300005844 | Bacteria | 2370 |
| 32 | Ga0070715_10162317 | 3300006163 | Bacteria | 1105 |
| 33 | Ga0075431_101030924 | 3300006847 | Bacteria | 789 |
| 34 | Ga0075429_100188786 | 3300006880 | Bacteria | 1806 |
| 35 | Ga0075429_100470057 | 3300006880 | Bacteria | 1102 |
| 36 | Ga0079104_1003607 | 3300006946 | Bacteria | 7081 |
| 37 | Ga0105240_10000018 | 3300009093 | Bacteria | 434461 |
| 38 | Ga0105240_10015676 | 3300009093 | Bacteria | 10290 |
| 39 | Ga0105240_10024997 | 3300009093 | Bacteria | 7861 |
| 40 | Ga0105240_10107983 | 3300009093 | Bacteria | 3373 |
| 41 | Ga0105240_10155792 | 3300009093 | Bacteria | 2717 |
| 42 | Ga0105240_10156673 | 3300009093 | Bacteria | 2708 |
| 43 | Ga0105240_10265383 | 3300009093 | Bacteria | 1979 |
| 44 | Ga0111539_10000771 | 3300009094 | Bacteria | 41650 |
| 45 | Ga0105247_10025812 | 3300009101 | Bacteria | 3546 |
| 46 | Ga0105241_10004437 | 3300009174 | Bacteria | 10375 |
| 47 | Ga0105237_10065140 | 3300009545 | Bacteria | 3640 |
| 48 | Ga0105237_10070105 | 3300009545 | Bacteria | 3501 |
| 49 | Ga0105237_10233936 | 3300009545 | Bacteria | 1838 |
| 50 | Ga0105238_10012622 | 3300009551 | Bacteria | 8527 |
| 51 | Ga0105238_10040019 | 3300009551 | Bacteria | 4751 |
| 52 | Ga0105238_10307111 | 3300009551 | Bacteria | 1571 |
| 53 | Ga0105249_10007566 | 3300009553 | Bacteria | 9476 |
| 54 | Ga0105249_10109696 | 3300009553 | Unclassified | 2607 |
| 55 | Ga0105239_10042949 | 3300010375 | Bacteria | 4953 |
| 56 | Ga0105239_10113904 | 3300010375 | Bacteria | 2999 |
| 57 | Ga0157369_10002941 | 3300013105 | Bacteria | 20371 |
| 58 | Ga0157369_10002959 | 3300013105 | Bacteria | 20314 |
| 59 | Ga0157374_10373697 | 3300013296 | Bacteria | 1419 |
| 60 | Ga0157372_10004592 | 3300013307 | Bacteria | 14681 |
| 61 | Ga0157372_10052503 | 3300013307 | Bacteria | 4540 |
| 62 | Ga0157372_10278382 | 3300013307 | Bacteria | 1945 |
| 63 | Ga0163163_10266786 | 3300014325 | Bacteria | 1763 |
| 64 | Ga0157380_10389570 | 3300014326 | Bacteria | 1318 |
| 65 | Ga0213876_10216636 | 3300021384 | Bacteria | 1018 |
| 66 | Ga0213875_10010838 | 3300021388 | Bacteria | 4556 |
| 67 | Ga0207647_10058515 | 3300025904 | Bacteria | 2360 |
| 68 | Ga0207699_10042876 | 3300025906 | Bacteria | 2625 |
| 69 | Ga0207654_10005979 | 3300025911 | Bacteria | 6123 |
| 70 | Ga0207707_10134347 | 3300025912 | Bacteria | 2163 |
| 71 | Ga0207707_10232593 | 3300025912 | Bacteria | 1603 |
| 72 | Ga0207695_10000141 | 3300025913 | Bacteria | 215831 |
| 73 | Ga0207695_10012344 | 3300025913 | Bacteria | 10264 |
| 74 | Ga0207695_10020388 | 3300025913 | Bacteria | 7595 |
| 75 | Ga0207695_10075977 | 3300025913 | Bacteria | 3416 |
| 76 | Ga0207695_10174778 | 3300025913 | Bacteria | 2071 |
| 77 | Ga0207695_10265062 | 3300025913 | Bacteria | 1615 |
| 78 | Ga0207695_10303010 | 3300025913 | Bacteria | 1489 |
| 79 | Ga0207671_10029146 | 3300025914 | Bacteria | 4124 |
| 80 | Ga0207652_10275911 | 3300025921 | Bacteria | 1516 |
| 81 | Ga0207694_10050105 | 3300025924 | Bacteria | 3233 |
| 82 | Ga0207694_10755167 | 3300025924 | Bacteria | 821 |
| 83 | Ga0207650_10019966 | 3300025925 | Bacteria | 4718 |
| 84 | Ga0207700_10258872 | 3300025928 | Bacteria | 1489 |
| 85 | Ga0207644_10000658 | 3300025931 | Bacteria | 21848 |
| 86 | Ga0207690_10025414 | 3300025932 | Bacteria | 3718 |
| 87 | Ga0207667_10002874 | 3300025949 | Bacteria | 21384 |
| 88 | Ga0207667_10370614 | 3300025949 | Bacteria | 1459 |
| 89 | Ga0207667_10490013 | 3300025949 | Unclassified | 1247 |
| 90 | Ga0207667_10823481 | 3300025949 | Bacteria | 924 |
| 91 | Ga0207651_10272719 | 3300025960 | Bacteria | 1394 |
| 92 | Ga0207640_10198064 | 3300025981 | Bacteria | 1520 |
| 93 | Ga0207703_10001727 | 3300026035 | Bacteria | 19642 |
| 94 | Ga0207639_10080439 | 3300026041 | Bacteria | 2577 |
| 95 | Ga0207678_10051606 | 3300026067 | Bacteria | 3551 |
| 96 | Ga0207702_10107372 | 3300026078 | Bacteria | 2475 |
| 97 | Ga0207702_10310901 | 3300026078 | Bacteria | 1498 |
| 98 | Ga0207641_10000599 | 3300026088 | Bacteria | 39635 |
| 99 | Ga0207676_10049405 | 3300026095 | Bacteria | 3272 |
| 100 | Ga0207698_10012056 | 3300026142 | Bacteria | 5636 |
| 101 | Ga0209281_1011394 | 3300027111 | Unclassified | 1994 |
| 102 | Ga0268266_10001067 | 3300028379 | Bacteria | 34352 |
| 103 | Ga0268265_10535488 | 3300028380 | Bacteria | 1109 |
| 104 | Ga0268264_10000034 | 3300028381 | Bacteria | 401894 |
| 105 | Ga0268264_10001061 | 3300028381 | Bacteria | 27289 |
| 106 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 107 | Ga0307515_10000645 | 3300028794 | Bacteria | 80548 |
| 108 | Ga0265338_10000343 | 3300028800 | Bacteria | 84846 |
| 109 | Ga0265338_10368899 | 3300028800 | Bacteria | 1028 |
| 110 | Ga0265329_10046268 | 3300031242 | Bacteria | 1390 |
| 111 | Ga0307408_100049808 | 3300031548 | Bacteria | 3010 |
| 112 | Ga0307408_100475328 | 3300031548 | Bacteria | 1089 |
| 113 | Ga0265314_10076564 | 3300031711 | Bacteria | 2222 |
| 114 | Ga0316578_10266376 | 3300031728 | Bacteria | 1027 |
| 115 | Ga0307516_10002063 | 3300031730 | Bacteria | 27367 |
| 116 | Ga0307405_10008766 | 3300031731 | Bacteria | 5146 |
| 117 | Ga0307413_10001784 | 3300031824 | Bacteria | 8423 |
| 118 | Ga0307413_10101711 | 3300031824 | Bacteria | 1901 |
| 119 | Ga0307413_10492130 | 3300031824 | Bacteria | 983 |
| 120 | Ga0307410_10001279 | 3300031852 | Bacteria | 11192 |
| 121 | Ga0307410_10333235 | 3300031852 | Bacteria | 1207 |
| 122 | Ga0307406_10002136 | 3300031901 | Bacteria | 10766 |
| 123 | Ga0307407_10148985 | 3300031903 | Bacteria | 1518 |
| 124 | Ga0307412_10006403 | 3300031911 | Bacteria | 6657 |
| 125 | Ga0307409_100234350 | 3300031995 | Bacteria | 1666 |
| 126 | Ga0307416_100018440 | 3300032002 | Bacteria | 4916 |
| 127 | Ga0307416_101261836 | 3300032002 | Bacteria | 845 |
| 128 | Ga0307414_10007975 | 3300032004 | Bacteria | 5981 |
| 129 | Ga0307414_10326771 | 3300032004 | Bacteria | 1308 |
| 130 | Ga0307411_10004922 | 3300032005 | Bacteria | 6494 |
| 131 | Ga0307411_10049254 | 3300032005 | Bacteria | 2737 |
| 132 | Ga0307415_100003716 | 3300032126 | Bacteria | 7808 |
| 133 | Ga0307510_10000005 | 3300033180 | Bacteria | 633068 |
| 134 | Ga0307510_10035334 | 3300033180 | Bacteria | 5584 |
| 135 | Ga0373923_0002790 | 3300035111 | Bacteria | 5468 |
| 136 | Ga0373936_0009588 | 3300035113 | Bacteria | 3648 |
| 137 | Ga0373954_0075793 | 3300035118 | Bacteria | 1602 |
| 138 | Ga0373955_0016432 | 3300035172 | Bacteria | 3643 |
| 139 | Ga0316574_0137300 | 3300035398 | Bacteria | 1574 |
| 140 | Ga0373933_0013349 | 3300035724 | Bacteria | 4552 |
| 141 | Ga0373937_0004233 | 3300036401 | Bacteria | 12164 |
| 142 | Ga0316584_0043265 | 3300036712 | Unclassified | 3358 |
| 143 | Ga0395899_0009458 | 3300037312 | Bacteria | 7481 |
| 144 | Ga0395905_0414975 | 3300037471 | Bacteria | 1242 |
| 145 | Ga0395905_0734800 | 3300037471 | Bacteria | 889 |
| 146 | Ga0316581_0046858 | 3300037588 | Bacteria | 1322 |
| 147 | Ga0436364_0498979 | 3300037853 | Bacteria | 13596 |
| 148 | Ga0436365_0897382 | 3300039437 | Bacteria | 3514 |
| 149 | Ga0436365_1224200 | 3300039437 | Bacteria | 1807 |
| 150 | Ga0436363_1288003 | 3300039450 | Bacteria | 3894 |
| 151 | Ga0450909_036584 | 3300042185 | Bacteria | 751 |
| 152 | Ga0451577_0217264 | 3300042876 | Bacteria | 1727 |
| 153 | Ga0466961_0027137 | 3300044693 | Bacteria | 3682 |
| 154 | Ga0453684_0295103 | 3300044712 | Bacteria | 1844 |
| 155 | Ga0451576_0533593 | 3300045051 | Bacteria | 1233 |
| 156 | Ga0495609_0209803 | 3300046538 | Bacteria | 812 |
| 157 | Ga0495649_0209640 | 3300046694 | Bacteria | 1010 |
| 158 | Ga0495687_084890 | 3300047443 | Bacteria | 1229 |
| 159 | Ga0496100_0731483 | 3300048903 | Bacteria | 773 |
| 160 | Ga0496102_0047498 | 3300048905 | Bacteria | 3902 |
| 161 | Ga0496102_0049502 | 3300048905 | Bacteria | 3823 |
| 162 | Ga0496102_0830720 | 3300048905 | Bacteria | 846 |
| 163 | Ga0496102_1234036 | 3300048905 | Bacteria | 667 |
| 164 | Ga0496103_0298436 | 3300048906 | Bacteria | 1036 |
| 165 | Ga0496117_0000012 | 3300048920 | Bacteria | 608530 |
| 166 | Ga0496118_0000003 | 3300048921 | Bacteria | 773148 |
| 167 | Ga0496119_0000196 | 3300048922 | Bacteria | 85266 |
| 168 | Ga0496119_0005323 | 3300048922 | Bacteria | 12383 |
| 169 | Ga0496119_0022197 | 3300048922 | Bacteria | 4555 |
| 170 | Ga0496120_0000338 | 3300048923 | Bacteria | 78053 |
| 171 | Ga0496120_0024863 | 3300048923 | Bacteria | 3727 |
| 172 | Ga0496121_0029567 | 3300048924 | Bacteria | 5062 |
| 173 | Ga0496124_0057742 | 3300048927 | Bacteria | 3268 |
| 174 | Ga0496125_0000271 | 3300048928 | Bacteria | 105521 |
| 175 | Ga0496125_0014522 | 3300048928 | Bacteria | 7667 |
| 176 | Ga0496125_0144502 | 3300048928 | Bacteria | 1647 |
| 177 | Ga0496126_0005913 | 3300048929 | Bacteria | 13798 |
| 178 | Ga0496126_0090059 | 3300048929 | Bacteria | 2699 |
| 179 | Ga0501031_0095469 | 3300049568 | Bacteria | 1940 |
| 180 | Ga0501039_0065167 | 3300049575 | Bacteria | 2826 |
| 181 | Ga0501039_0157782 | 3300049575 | Bacteria | 1783 |
| 182 | Ga0501040_0036529 | 3300049576 | Bacteria | 3335 |
| 183 | Ga0501046_0015120 | 3300049580 | Bacteria | 6489 |
| 184 | Ga0501047_0013993 | 3300049581 | Bacteria | 7626 |
| 185 | Ga0501047_0083438 | 3300049581 | Bacteria | 3071 |
| 186 | Ga0501047_0300359 | 3300049581 | Bacteria | 1448 |
| 187 | Ga0501048_0285590 | 3300049582 | Bacteria | 1173 |
| 188 | Ga0501067_0126141 | 3300049583 | Bacteria | 1424 |
| 189 | Ga0501068_0027919 | 3300049584 | Bacteria | 3335 |
| 190 | Ga0501069_0025550 | 3300049585 | Bacteria | 3229 |
| 191 | Ga0501069_0190400 | 3300049585 | Bacteria | 1187 |
| 192 | Ga0501070_0005758 | 3300049586 | Bacteria | 10567 |
| 193 | Ga0501071_0226692 | 3300049587 | Bacteria | 1407 |
| 194 | Ga0501072_0005559 | 3300049588 | Bacteria | 9589 |
| 195 | Ga0501072_0083214 | 3300049588 | Bacteria | 2537 |
| 196 | Ga0501073_0006197 | 3300049589 | Bacteria | 8919 |
| 197 | Ga0501073_0206965 | 3300049589 | Bacteria | 1356 |
| 198 | Ga0501074_0007549 | 3300049590 | Bacteria | 7867 |
| 199 | Ga0501074_0091632 | 3300049590 | Bacteria | 2177 |
| 200 | Ga0501075_0472949 | 3300049591 | Bacteria | 956 |
| 201 | Ga0501075_0510202 | 3300049591 | Bacteria | 917 |
| 202 | Ga0501076_0031560 | 3300049592 | Bacteria | 4133 |
| 203 | Ga0501077_0025482 | 3300049593 | Bacteria | 3757 |
| 204 | Ga0501079_0001754 | 3300049741 | Bacteria | 15461 |
| 205 | Ga0501079_0111885 | 3300049741 | Bacteria | 2122 |
| 206 | Ga0501080_0006901 | 3300049742 | Bacteria | 10241 |
| 207 | Ga0501080_0291751 | 3300049742 | Bacteria | 1481 |
| 208 | Ga0501081_0071054 | 3300049743 | Bacteria | 2426 |
| 209 | Ga0501083_0001415 | 3300049744 | Bacteria | 16344 |
| 210 | Ga0501035_0725792 | 3300049822 | Bacteria | 799 |
| 211 | Ga0501035_0982015 | 3300049822 | Bacteria | 665 |
| 212 | Ga0501044_0010433 | 3300049823 | Bacteria | 10083 |
| 213 | Ga0501045_0038980 | 3300049824 | Bacteria | 3457 |
| 214 | nmdc:mga0yw44_324881_c1 | 3300050492 | Bacteria | 1033 |
| 215 | nmdc:mga09592_180276_c1 | 3300050508 | Bacteria | 1827 |
| 216 | nmdc:mga09592_309439_c1 | 3300050508 | Bacteria | 1369 |
| 217 | nmdc:mga08y16_189337_c1 | 3300050511 | Bacteria | 2135 |
| 218 | Ga0495619_0205259 | 3300053085 | Bacteria | 1364 |
| 219 | Ga0500591_143140 | 3300053115 | Bacteria | 939 |
| 220 | Ga0500595_012044 | 3300053119 | Bacteria | 3356 |
| 221 | Ga0501084_0028099 | 3300054114 | Bacteria | 4701 |
| 222 | Ga0590075_003683 | 3300059424 | Bacteria | 3637 |
| 223 | Ga0501082_0003900 | 3300060353 | Bacteria | 13031 |
| 224 | Ga0501082_0265575 | 3300060353 | Bacteria | 1493 |
| 225 | Ga0530510_0410062 | 3300061734 | Bacteria | 1022 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042185 | Ga0450909_036584 | Ga0450909_036584_28_636 | 194 |
| 2 | 3300036712 | Ga0316584_0043265 | Ga0316584_0043265_2739_3347 | 195 |
| 3 | 3300046538 | Ga0495609_0209803 | Ga0495609_0209803_186_797 | 201 |
| 4 | 3300048905 | Ga0496102_1234036 | Ga0496102_1234036_12_623 | 201 |
| 5 | 3300014326 | Ga0157380_10389570 | Ga0157380_103895702 | 203 |
| 6 | 3300049568 | Ga0501031_0095469 | Ga0501031_0095469_355_1041 | 207 |
| 7 | 3300049575 | Ga0501039_0065167 | Ga0501039_0065167_468_1154 | 207 |
| 8 | 3300049576 | Ga0501040_0036529 | Ga0501040_0036529_350_1036 | 207 |
| 9 | 3300049580 | Ga0501046_0015120 | Ga0501046_0015120_354_1040 | 207 |
| 10 | 3300049582 | Ga0501048_0285590 | Ga0501048_0285590_417_1103 | 207 |
| 11 | 3300049585 | Ga0501069_0190400 | Ga0501069_0190400_362_1048 | 207 |
| 12 | 3300049587 | Ga0501071_0226692 | Ga0501071_0226692_465_1151 | 207 |
| 13 | 3300049588 | Ga0501072_0005559 | Ga0501072_0005559_2672_3358 | 207 |
| 14 | 3300049589 | Ga0501073_0206965 | Ga0501073_0206965_243_962 | 207 |
| 15 | 3300049590 | Ga0501074_0091632 | Ga0501074_0091632_142_828 | 207 |
| 16 | 3300049591 | Ga0501075_0510202 | Ga0501075_0510202_219_905 | 207 |
| 17 | 3300049592 | Ga0501076_0031560 | Ga0501076_0031560_1559_2245 | 207 |
| 18 | 3300049593 | Ga0501077_0025482 | Ga0501077_0025482_1240_1926 | 207 |
| 19 | 3300049741 | Ga0501079_0111885 | Ga0501079_0111885_773_1459 | 207 |
| 20 | 3300049742 | Ga0501080_0291751 | Ga0501080_0291751_82_768 | 207 |
| 21 | 3300049743 | Ga0501081_0071054 | Ga0501081_0071054_1463_2149 | 207 |
| 22 | 3300049824 | Ga0501045_0038980 | Ga0501045_0038980_453_1139 | 207 |
| 23 | 3300054114 | Ga0501084_0028099 | Ga0501084_0028099_4004_4690 | 207 |
| 24 | 3300060353 | Ga0501082_0003900 | Ga0501082_0003900_162_848 | 207 |
| 25 | 3300061734 | Ga0530510_0410062 | Ga0530510_0410062_314_1000 | 207 |
| 26 | 3300049575 | Ga0501039_0157782 | Ga0501039_0157782_111_773 | 208 |
| 27 | 3300005844 | Ga0068862_100114539 | Ga0068862_1001145393 | 210 |
| 28 | 3300006880 | Ga0075429_100188786 | Ga0075429_1001887862 | 210 |
| 29 | 3300025913 | Ga0207695_10075977 | Ga0207695_100759773 | 210 |
| 30 | 3300025949 | Ga0207667_10823481 | Ga0207667_108234812 | 210 |
| 31 | 3300031242 | Ga0265329_10046268 | Ga0265329_100462682 | 210 |
| 32 | 3300031711 | Ga0265314_10076564 | Ga0265314_100765642 | 210 |
| 33 | 3300033180 | Ga0307510_10035334 | Ga0307510_100353344 | 210 |
| 34 | 3300049822 | Ga0501035_0982015 | Ga0501035_0982015_16_648 | 210 |
| 35 | 3300013105 | Ga0157369_10002941 | Ga0157369_1000294114 | 214 |
| 36 | 3300005331 | Ga0070670_100106936 | Ga0070670_1001069362 | 216 |
| 37 | iso_pu_bacteria | 2515154189 | 2516023148 | 216 |
| 38 | iso_pu_bacteria | 2524023250 | 2524610353 | 216 |
| 39 | iso_pu_bacteria | 2883087390 | 2883093480 | 216 |
| 40 | 3300005843 | Ga0068860_100000904 | Ga0068860_10000090430 | 217 |
| 41 | 3300028381 | Ga0268264_10001061 | Ga0268264_1000106123 | 217 |
| 42 | 3300006880 | Ga0075429_100470057 | Ga0075429_1004700572 | 218 |
| 43 | 3300028800 | Ga0265338_10368899 | Ga0265338_103688991 | 218 |
| 44 | 3300048922 | Ga0496119_0022197 | Ga0496119_0022197_2384_3046 | 218 |
| 45 | 3300048928 | Ga0496125_0144502 | Ga0496125_0144502_892_1554 | 218 |
| 46 | 3300050508 | nmdc:mga09592_309439_c1 | nmdc:mga09592_309439_c1_570_1229 | 218 |
| 47 | 3300005355 | Ga0070671_100003081 | Ga0070671_1000030819 | 219 |
| 48 | 3300005366 | Ga0070659_100025994 | Ga0070659_1000259943 | 219 |
| 49 | 3300005439 | Ga0070711_100287884 | Ga0070711_1002878842 | 219 |
| 50 | 3300005563 | Ga0068855_100007677 | Ga0068855_1000076772 | 219 |
| 51 | 3300005614 | Ga0068856_100083295 | Ga0068856_1000832952 | 219 |
| 52 | 3300005616 | Ga0068852_100013921 | Ga0068852_1000139213 | 219 |
| 53 | 3300005841 | Ga0068863_100037847 | Ga0068863_1000378472 | 219 |
| 54 | 3300006163 | Ga0070715_10162317 | Ga0070715_101623172 | 219 |
| 55 | 3300006946 | Ga0079104_1003607 | Ga0079104_10036076 | 219 |
| 56 | 3300009093 | Ga0105240_10024997 | Ga0105240_100249975 | 219 |
| 57 | 3300009551 | Ga0105238_10012622 | Ga0105238_100126227 | 219 |
| 58 | 3300013105 | Ga0157369_10002959 | Ga0157369_100029592 | 219 |
| 59 | 3300013307 | Ga0157372_10004592 | Ga0157372_100045926 | 219 |
| 60 | 3300025913 | Ga0207695_10020388 | Ga0207695_100203882 | 219 |
| 61 | 3300025931 | Ga0207644_10000658 | Ga0207644_100006584 | 219 |
| 62 | 3300025932 | Ga0207690_10025414 | Ga0207690_100254142 | 219 |
| 63 | 3300026078 | Ga0207702_10107372 | Ga0207702_101073722 | 219 |
| 64 | 3300026142 | Ga0207698_10012056 | Ga0207698_100120563 | 219 |
| 65 | 3300027111 | Ga0209281_1011394 | Ga0209281_10113942 | 219 |
| 66 | 3300028800 | Ga0265338_10000343 | Ga0265338_1000034336 | 219 |
| 67 | 3300032002 | Ga0307416_101261836 | Ga0307416_1012618361 | 219 |
| 68 | 3300035111 | Ga0373923_0002790 | Ga0373923_0002790_4276_4950 | 219 |
| 69 | 3300035118 | Ga0373954_0075793 | Ga0373954_0075793_647_1321 | 219 |
| 70 | 3300035172 | Ga0373955_0016432 | Ga0373955_0016432_850_1524 | 219 |
| 71 | 3300035724 | Ga0373933_0013349 | Ga0373933_0013349_2823_3497 | 219 |
| 72 | 3300036401 | Ga0373937_0004233 | Ga0373937_0004233_9730_10404 | 219 |
| 73 | 3300044693 | Ga0466961_0027137 | Ga0466961_0027137_767_1426 | 219 |
| 74 | 3300053085 | Ga0495619_0205259 | Ga0495619_0205259_564_1238 | 219 |
| 75 | 3300053119 | Ga0500595_012044 | Ga0500595_012044_1791_2450 | 219 |
| 76 | 2162886007 | SwRhRL2b_contig_550266 | SwRhRL2b_0768.00000160 | 220 |
| 77 | 3300003320 | rootH2_10220263 | rootH2_102202632 | 220 |
| 78 | 3300003322 | rootL2_10029642 | rootL2_100296422 | 220 |
| 79 | 3300003323 | rootH1_10036123 | rootH1_100361232 | 220 |
| 80 | 3300005289 | Ga0065704_10076910 | Ga0065704_100769103 | 220 |
| 81 | 3300005345 | Ga0070692_10038585 | Ga0070692_100385852 | 220 |
| 82 | 3300005356 | Ga0070674_100000999 | Ga0070674_1000009998 | 220 |
| 83 | 3300005434 | Ga0070709_10007037 | Ga0070709_100070374 | 220 |
| 84 | 3300005436 | Ga0070713_100021688 | Ga0070713_1000216884 | 220 |
| 85 | 3300005445 | Ga0070708_100485652 | Ga0070708_1004856522 | 220 |
| 86 | 3300005455 | Ga0070663_100250850 | Ga0070663_1002508502 | 220 |
| 87 | 3300005458 | Ga0070681_10060743 | Ga0070681_100607432 | 220 |
| 88 | 3300005530 | Ga0070679_100029160 | Ga0070679_1000291602 | 220 |
| 89 | 3300005539 | Ga0068853_100220604 | Ga0068853_1002206042 | 220 |
| 90 | 3300005548 | Ga0070665_100014906 | Ga0070665_1000149068 | 220 |
| 91 | 3300005563 | Ga0068855_100002184 | Ga0068855_10000218417 | 220 |
| 92 | 3300005563 | Ga0068855_100082522 | Ga0068855_1000825223 | 220 |
| 93 | 3300005618 | Ga0068864_100024923 | Ga0068864_1000249235 | 220 |
| 94 | 3300005841 | Ga0068863_100003178 | Ga0068863_1000031788 | 220 |
| 95 | 3300005842 | Ga0068858_100003249 | Ga0068858_1000032499 | 220 |
| 96 | 3300005843 | Ga0068860_100000657 | Ga0068860_10000065729 | 220 |
| 97 | 3300006847 | Ga0075431_101030924 | Ga0075431_1010309241 | 220 |
| 98 | 3300009093 | Ga0105240_10000018 | Ga0105240_10000018182 | 220 |
| 99 | 3300009093 | Ga0105240_10015676 | Ga0105240_100156763 | 220 |
| 100 | 3300009093 | Ga0105240_10107983 | Ga0105240_101079833 | 220 |
| 101 | 3300009093 | Ga0105240_10155792 | Ga0105240_101557922 | 220 |
| 102 | 3300009093 | Ga0105240_10156673 | Ga0105240_101566732 | 220 |
| 103 | 3300009093 | Ga0105240_10265383 | Ga0105240_102653832 | 220 |
| 104 | 3300009094 | Ga0111539_10000771 | Ga0111539_1000077121 | 220 |
| 105 | 3300009101 | Ga0105247_10025812 | Ga0105247_100258122 | 220 |
| 106 | 3300009174 | Ga0105241_10004437 | Ga0105241_100044376 | 220 |
| 107 | 3300009545 | Ga0105237_10065140 | Ga0105237_100651401 | 220 |
| 108 | 3300009545 | Ga0105237_10070105 | Ga0105237_100701053 | 220 |
| 109 | 3300009545 | Ga0105237_10233936 | Ga0105237_102339362 | 220 |
| 110 | 3300009551 | Ga0105238_10040019 | Ga0105238_100400192 | 220 |
| 111 | 3300009551 | Ga0105238_10307111 | Ga0105238_103071112 | 220 |
| 112 | 3300009553 | Ga0105249_10007566 | Ga0105249_100075666 | 220 |
| 113 | 3300009553 | Ga0105249_10109696 | Ga0105249_101096962 | 220 |
| 114 | 3300010375 | Ga0105239_10042949 | Ga0105239_100429493 | 220 |
| 115 | 3300010375 | Ga0105239_10113904 | Ga0105239_101139042 | 220 |
| 116 | 3300013296 | Ga0157374_10373697 | Ga0157374_103736972 | 220 |
| 117 | 3300013307 | Ga0157372_10052503 | Ga0157372_100525032 | 220 |
| 118 | 3300013307 | Ga0157372_10278382 | Ga0157372_102783823 | 220 |
| 119 | 3300014325 | Ga0163163_10266786 | Ga0163163_102667862 | 220 |
| 120 | 3300021384 | Ga0213876_10216636 | Ga0213876_102166362 | 220 |
| 121 | 3300021388 | Ga0213875_10010838 | Ga0213875_100108382 | 220 |
| 122 | 3300025904 | Ga0207647_10058515 | Ga0207647_100585152 | 220 |
| 123 | 3300025906 | Ga0207699_10042876 | Ga0207699_100428763 | 220 |
| 124 | 3300025911 | Ga0207654_10005979 | Ga0207654_100059792 | 220 |
| 125 | 3300025912 | Ga0207707_10134347 | Ga0207707_101343472 | 220 |
| 126 | 3300025912 | Ga0207707_10232593 | Ga0207707_102325932 | 220 |
| 127 | 3300025913 | Ga0207695_10000141 | Ga0207695_10000141102 | 220 |
| 128 | 3300025913 | Ga0207695_10012344 | Ga0207695_100123447 | 220 |
| 129 | 3300025913 | Ga0207695_10174778 | Ga0207695_101747782 | 220 |
| 130 | 3300025913 | Ga0207695_10265062 | Ga0207695_102650622 | 220 |
| 131 | 3300025913 | Ga0207695_10303010 | Ga0207695_103030102 | 220 |
| 132 | 3300025914 | Ga0207671_10029146 | Ga0207671_100291465 | 220 |
| 133 | 3300025921 | Ga0207652_10275911 | Ga0207652_102759112 | 220 |
| 134 | 3300025924 | Ga0207694_10050105 | Ga0207694_100501052 | 220 |
| 135 | 3300025924 | Ga0207694_10755167 | Ga0207694_107551671 | 220 |
| 136 | 3300025925 | Ga0207650_10019966 | Ga0207650_100199662 | 220 |
| 137 | 3300025928 | Ga0207700_10258872 | Ga0207700_102588722 | 220 |
| 138 | 3300025949 | Ga0207667_10002874 | Ga0207667_1000287417 | 220 |
| 139 | 3300025949 | Ga0207667_10370614 | Ga0207667_103706142 | 220 |
| 140 | 3300025949 | Ga0207667_10490013 | Ga0207667_104900132 | 220 |
| 141 | 3300025960 | Ga0207651_10272719 | Ga0207651_102727192 | 220 |
| 142 | 3300025981 | Ga0207640_10198064 | Ga0207640_101980641 | 220 |
| 143 | 3300026035 | Ga0207703_10001727 | Ga0207703_1000172716 | 220 |
| 144 | 3300026041 | Ga0207639_10080439 | Ga0207639_100804392 | 220 |
| 145 | 3300026067 | Ga0207678_10051606 | Ga0207678_100516061 | 220 |
| 146 | 3300026078 | Ga0207702_10310901 | Ga0207702_103109012 | 220 |
| 147 | 3300026088 | Ga0207641_10000599 | Ga0207641_1000059932 | 220 |
| 148 | 3300026095 | Ga0207676_10049405 | Ga0207676_100494053 | 220 |
| 149 | 3300028379 | Ga0268266_10001067 | Ga0268266_1000106713 | 220 |
| 150 | 3300028380 | Ga0268265_10535488 | Ga0268265_105354882 | 220 |
| 151 | 3300028381 | Ga0268264_10000034 | Ga0268264_1000003456 | 220 |
| 152 | 3300028794 | Ga0307515_10000006 | Ga0307515_1000000692 | 220 |
| 153 | 3300028794 | Ga0307515_10000645 | Ga0307515_1000064539 | 220 |
| 154 | 3300031548 | Ga0307408_100049808 | Ga0307408_1000498082 | 220 |
| 155 | 3300031548 | Ga0307408_100475328 | Ga0307408_1004753282 | 220 |
| 156 | 3300031728 | Ga0316578_10266376 | Ga0316578_102663761 | 220 |
| 157 | 3300031730 | Ga0307516_10002063 | Ga0307516_100020639 | 220 |
| 158 | 3300031731 | Ga0307405_10008766 | Ga0307405_100087664 | 220 |
| 159 | 3300031824 | Ga0307413_10001784 | Ga0307413_100017846 | 220 |
| 160 | 3300031824 | Ga0307413_10101711 | Ga0307413_101017112 | 220 |
| 161 | 3300031824 | Ga0307413_10492130 | Ga0307413_104921302 | 220 |
| 162 | 3300031852 | Ga0307410_10001279 | Ga0307410_1000127912 | 220 |
| 163 | 3300031852 | Ga0307410_10333235 | Ga0307410_103332352 | 220 |
| 164 | 3300031901 | Ga0307406_10002136 | Ga0307406_1000213612 | 220 |
| 165 | 3300031903 | Ga0307407_10148985 | Ga0307407_101489852 | 220 |
| 166 | 3300031911 | Ga0307412_10006403 | Ga0307412_100064036 | 220 |
| 167 | 3300031995 | Ga0307409_100234350 | Ga0307409_1002343502 | 220 |
| 168 | 3300032002 | Ga0307416_100018440 | Ga0307416_1000184403 | 220 |
| 169 | 3300032004 | Ga0307414_10007975 | Ga0307414_100079753 | 220 |
| 170 | 3300032004 | Ga0307414_10326771 | Ga0307414_103267712 | 220 |
| 171 | 3300032005 | Ga0307411_10004922 | Ga0307411_100049226 | 220 |
| 172 | 3300032005 | Ga0307411_10049254 | Ga0307411_100492541 | 220 |
| 173 | 3300032126 | Ga0307415_100003716 | Ga0307415_1000037168 | 220 |
| 174 | 3300033180 | Ga0307510_10000005 | Ga0307510_10000005406 | 220 |
| 175 | 3300035113 | Ga0373936_0009588 | Ga0373936_0009588_198_866 | 220 |
| 176 | 3300035398 | Ga0316574_0137300 | Ga0316574_0137300_214_915 | 220 |
| 177 | 3300037312 | Ga0395899_0009458 | Ga0395899_0009458_5716_6426 | 220 |
| 178 | 3300037471 | Ga0395905_0414975 | Ga0395905_0414975_441_1127 | 220 |
| 179 | 3300037471 | Ga0395905_0734800 | Ga0395905_0734800_140_814 | 220 |
| 180 | 3300037588 | Ga0316581_0046858 | Ga0316581_0046858_460_1143 | 220 |
| 181 | 3300037853 | Ga0436364_0498979 | Ga0436364_0498979_5426_6133 | 220 |
| 182 | 3300039437 | Ga0436365_0897382 | Ga0436365_0897382_993_1661 | 220 |
| 183 | 3300039437 | Ga0436365_1224200 | Ga0436365_1224200_473_1135 | 220 |
| 184 | 3300039450 | Ga0436363_1288003 | Ga0436363_1288003_1061_1729 | 220 |
| 185 | 3300042876 | Ga0451577_0217264 | Ga0451577_0217264_18_707 | 220 |
| 186 | 3300044712 | Ga0453684_0295103 | Ga0453684_0295103_494_1183 | 220 |
| 187 | 3300045051 | Ga0451576_0533593 | Ga0451576_0533593_255_956 | 220 |
| 188 | 3300046694 | Ga0495649_0209640 | Ga0495649_0209640_27_695 | 220 |
| 189 | 3300047443 | Ga0495687_084890 | Ga0495687_084890_331_999 | 220 |
| 190 | 3300048903 | Ga0496100_0731483 | Ga0496100_0731483_23_691 | 220 |
| 191 | 3300048905 | Ga0496102_0047498 | Ga0496102_0047498_150_818 | 220 |
| 192 | 3300048905 | Ga0496102_0049502 | Ga0496102_0049502_925_1614 | 220 |
| 193 | 3300048905 | Ga0496102_0830720 | Ga0496102_0830720_18_704 | 220 |
| 194 | 3300048906 | Ga0496103_0298436 | Ga0496103_0298436_284_952 | 220 |
| 195 | 3300048920 | Ga0496117_0000012 | Ga0496117_0000012_190784_191452 | 220 |
| 196 | 3300048921 | Ga0496118_0000003 | Ga0496118_0000003_595176_595844 | 220 |
| 197 | 3300048922 | Ga0496119_0000196 | Ga0496119_0000196_59681_60349 | 220 |
| 198 | 3300048922 | Ga0496119_0005323 | Ga0496119_0005323_7065_7733 | 220 |
| 199 | 3300048923 | Ga0496120_0000338 | Ga0496120_0000338_24892_25560 | 220 |
| 200 | 3300048923 | Ga0496120_0024863 | Ga0496120_0024863_2384_3052 | 220 |
| 201 | 3300048924 | Ga0496121_0029567 | Ga0496121_0029567_994_1662 | 220 |
| 202 | 3300048927 | Ga0496124_0057742 | Ga0496124_0057742_2407_3075 | 220 |
| 203 | 3300048928 | Ga0496125_0000271 | Ga0496125_0000271_60491_61159 | 220 |
| 204 | 3300048928 | Ga0496125_0014522 | Ga0496125_0014522_908_1576 | 220 |
| 205 | 3300048929 | Ga0496126_0005913 | Ga0496126_0005913_12063_12731 | 220 |
| 206 | 3300048929 | Ga0496126_0090059 | Ga0496126_0090059_360_1028 | 220 |
| 207 | 3300049581 | Ga0501047_0013993 | Ga0501047_0013993_4605_5267 | 220 |
| 208 | 3300049581 | Ga0501047_0083438 | Ga0501047_0083438_1207_1869 | 220 |
| 209 | 3300049581 | Ga0501047_0300359 | Ga0501047_0300359_314_976 | 220 |
| 210 | 3300049583 | Ga0501067_0126141 | Ga0501067_0126141_211_873 | 220 |
| 211 | 3300049584 | Ga0501068_0027919 | Ga0501068_0027919_1175_1837 | 220 |
| 212 | 3300049585 | Ga0501069_0025550 | Ga0501069_0025550_197_859 | 220 |
| 213 | 3300049586 | Ga0501070_0005758 | Ga0501070_0005758_9341_10003 | 220 |
| 214 | 3300049588 | Ga0501072_0083214 | Ga0501072_0083214_747_1409 | 220 |
| 215 | 3300049589 | Ga0501073_0006197 | Ga0501073_0006197_7224_7886 | 220 |
| 216 | 3300049590 | Ga0501074_0007549 | Ga0501074_0007549_4527_5189 | 220 |
| 217 | 3300049591 | Ga0501075_0472949 | Ga0501075_0472949_253_921 | 220 |
| 218 | 3300049741 | Ga0501079_0001754 | Ga0501079_0001754_10623_11285 | 220 |
| 219 | 3300049742 | Ga0501080_0006901 | Ga0501080_0006901_3538_4200 | 220 |
| 220 | 3300049744 | Ga0501083_0001415 | Ga0501083_0001415_6133_6795 | 220 |
| 221 | 3300049822 | Ga0501035_0725792 | Ga0501035_0725792_19_693 | 220 |
| 222 | 3300049823 | Ga0501044_0010433 | Ga0501044_0010433_5972_6634 | 220 |
| 223 | 3300050492 | nmdc:mga0yw44_324881_c1 | nmdc:mga0yw44_324881_c1_21_707 | 220 |
| 224 | 3300050508 | nmdc:mga09592_180276_c1 | nmdc:mga09592_180276_c1_192_854 | 220 |
| 225 | 3300050511 | nmdc:mga08y16_189337_c1 | nmdc:mga08y16_189337_c1_1313_1975 | 220 |
| 226 | 3300053115 | Ga0500591_143140 | Ga0500591_143140_60_728 | 220 |
| 227 | 3300059424 | Ga0590075_003683 | Ga0590075_003683_243_986 | 220 |
| 228 | 3300060353 | Ga0501082_0265575 | Ga0501082_0265575_744_1406 | 220 |
| 229 | iso_pu_bacteria | 2501025502 | 2501079450 | 220 |
| 230 | iso_pu_bacteria | 2510917013 | 2511093810 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.964 | 2 | 118 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9601 | 1 | 118 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9589 | 1 | 118 |
| 3f7a-assembly1.cif.gz_A | structure of orthorhombic crystal form of pseudomonas aeruginosa rssb | 0.9542 | 2 | 120 |
| 6ifh-assembly1.cif.gz_A | unphosphorylated spo0f from paenisporosarcina sp. tg-14 | 0.9538 | 2 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9779 | 1 | 83 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9734 | 1 | 80 | 3.40.50.2300 |
| af_P52076_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9733 | 1 | 80 | 3.40.50.2300 |
| af_P30843_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9723 | 1 | 80 | 3.40.50.2300 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9704 | 1 | 80 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z7ESV8-F1-model_v4 | DNA-binding response regulator | 0.8218 | 1 | 220 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7Z7ESV8-F1-model_v4 | DNA-binding response regulator | 0.8183 | 1 | 220 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A1H3NKW3-F1-model_v4 | Two-component system, OmpR family, response regulator BasR | 0.8087 | 1 | 217 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A4V6PXR8-F1-model_v4 | Two-component system response regulator TctD | 0.766 | 1 | 218 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A4V6PXR8-F1-model_v4 | Two-component system response regulator TctD | 0.7572 | 1 | 218 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar