F341942

General Info

Members Datasets Scaffolds Average Seq Length
229 195 458 196

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10093113|Ga0099794_100931132
Length 235
Sequence MRVSKDNVDVRMQIPGAVIRQRTDFGDVSGLRPTPSRDSTTMQLAYSTKQRLLDVGMAMLLRHGYHDLGIQALLAATRIPKGSFYHHFKDKEDFALQVIDQYMRHVHAGLDDCLGDKSRPPLERVRRFFELTQQSYRREGYMGCLLGGLGQELSGVSEVFRRKVDGCFSKIAKRIAVCLKEARNRGDIQAESNPRRMASLLVDCWEGAALRSRLRGNAAPLTTMLDFYFQSAVSR

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
77 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
92 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
107 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
108 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
109 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
110 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
111 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
112 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
128 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
129 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
130 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
131 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
132 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
133 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
134 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
135 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
136 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
137 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
138 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
139 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
140 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
141 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
142 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
143 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
144 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
145 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
146 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
147 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
148 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
149 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
150 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
151 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
152 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
153 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
154 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
160 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
161 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
162 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
163 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
164 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
165 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
166 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
167 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
168 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
169 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
170 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
171 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
172 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
173 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
174 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
178 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.24
Nodule 0
Rhizoplane 0
Rhizosphere 93.89
Stem 0
Stem Tuber 0
Unclassified 24.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10093113 3300007265 Bacteria 1497
2 rootH2_10009051 3300003320 Bacteria 1734
3 rootH1_10003546 3300003323 Bacteria 10744
4 Ga0065712_10025964 3300005290 Bacteria 1193
5 Ga0070658_10538438 3300005327 Bacteria 1010
6 Ga0070670_100306469 3300005331 Bacteria 1390
7 Ga0070677_10094002 3300005333 Bacteria 1309
8 Ga0068869_100168657 3300005334 Bacteria 1709
9 Ga0068868_100156654 3300005338 Bacteria 1879
10 Ga0070687_100368486 3300005343 Bacteria 932
11 Ga0070668_101013316 3300005347 Bacteria 747
12 Ga0070671_100438394 3300005355 Bacteria 1120
13 Ga0070674_100257357 3300005356 Bacteria 1374
14 Ga0070673_100421672 3300005364 Bacteria 1196
15 Ga0070688_100856308 3300005365 Unclassified 714
16 Ga0070667_100279234 3300005367 Bacteria 1499
17 Ga0070678_100060150 3300005456 Bacteria 2795
18 Ga0070678_100181459 3300005456 Bacteria 1723
19 Ga0068867_100306708 3300005459 Bacteria 1311
20 Ga0068867_101128463 3300005459 Bacteria 717
21 Ga0070685_10111190 3300005466 Bacteria 1688
22 Ga0070706_100764244 3300005467 Bacteria 895
23 Ga0070706_101225278 3300005467 Bacteria 689
24 Ga0070698_100043165 3300005471 Bacteria 4624
25 Ga0070672_100171192 3300005543 Bacteria 1806
26 Ga0070672_101004334 3300005543 Bacteria 739
27 Ga0070665_101005753 3300005548 Bacteria 846
28 Ga0068857_100046140 3300005577 Bacteria 3866
29 Ga0070702_100131598 3300005615 Bacteria 1581
30 Ga0068864_100119318 3300005618 Bacteria 2356
31 Ga0068866_10249466 3300005718 Bacteria 1085
32 Ga0068863_100366815 3300005841 Bacteria 1405
33 Ga0070717_10088059 3300006028 Bacteria 2616
34 Ga0075365_10558978 3300006038 Unclassified 809
35 Ga0075364_10089556 3300006051 Bacteria 2040
36 Ga0075362_10070813 3300006177 Bacteria 1592
37 Ga0075366_10048387 3300006195 Bacteria 2521
38 Ga0075430_100014845 3300006846 Bacteria 6632
39 Ga0075431_100008191 3300006847 Bacteria 10445
40 Ga0075431_100055543 3300006847 Bacteria 4085
41 Ga0111539_11139436 3300009094 Bacteria 906
42 Ga0105245_10467975 3300009098 Bacteria 1272
43 Ga0105247_10217832 3300009101 Bacteria 1291
44 Ga0114129_10002792 3300009147 Bacteria 24355
45 Ga0105242_10668979 3300009176 Bacteria 1012
46 Ga0105246_10070996 3300011119 Bacteria 2451
47 Ga0105246_10327151 3300011119 Bacteria 1248
48 Ga0157378_10070060 3300013297 Bacteria 3147
49 Ga0157375_10037236 3300013308 Bacteria 4659
50 Ga0163163_10459750 3300014325 Bacteria 1333
51 Ga0163163_10576474 3300014325 Bacteria 1188
52 Ga0157380_10017779 3300014326 Bacteria 5267
53 Ga0157380_10174254 3300014326 Bacteria 1883
54 Ga0157376_10477504 3300014969 Bacteria 1221
55 Ga0163161_10055960 3300017792 Bacteria 2864
56 Ga0207682_10002486 3300025893 Bacteria 8246
57 Ga0207642_10119272 3300025899 Bacteria 1358
58 Ga0207680_10022523 3300025903 Bacteria 3428
59 Ga0207645_10062254 3300025907 Bacteria 2384
60 Ga0207684_10765277 3300025910 Bacteria 818
61 Ga0207654_10027128 3300025911 Bacteria 3110
62 Ga0207662_10251959 3300025918 Bacteria 1159
63 Ga0207681_10299704 3300025923 Bacteria 1271
64 Ga0207694_10722875 3300025924 Bacteria 840
65 Ga0207650_10110007 3300025925 Bacteria 2132
66 Ga0207650_10178654 3300025925 Bacteria 1690
67 Ga0207687_10330144 3300025927 Bacteria 1237
68 Ga0207670_10217234 3300025936 Bacteria 1461
69 Ga0207669_10168897 3300025937 Bacteria 1554
70 Ga0207691_10257215 3300025940 Bacteria 1506
71 Ga0207689_10120851 3300025942 Bacteria 2155
72 Ga0207703_10115002 3300026035 Bacteria 2301
73 Ga0207639_10729489 3300026041 Bacteria 920
74 Ga0207676_10022795 3300026095 Bacteria 4609
75 Ga0207674_10041386 3300026116 Bacteria 4766
76 Ga0207675_101247929 3300026118 Bacteria 764
77 Ga0207683_10013364 3300026121 Bacteria 7001
78 Ga0207683_10174098 3300026121 Bacteria 1950
79 Ga0209967_1000915 3300027364 Bacteria 3775
80 Ga0209981_1001318 3300027378 Bacteria 3144
81 Ga0210000_1001904 3300027462 Bacteria 2951
82 Ga0209999_1000868 3300027543 Bacteria 5040
83 Ga0209588_1048510 3300027671 Unclassified 1374
84 Ga0268266_10847760 3300028379 Bacteria 883
85 Ga0268265_10298312 3300028380 Bacteria 1450
86 Ga0316575_10015579 3300031665 Unclassified 2867
87 Ga0316575_10282315 3300031665 Unclassified 700
88 Ga0316579_10101269 3300031691 Unclassified 1379
89 Ga0316576_10079403 3300031727 Bacteria 2432
90 Ga0316578_10044846 3300031728 Unclassified 2573
91 Ga0307405_10038243 3300031731 Unclassified 2890
92 Ga0307410_10023684 3300031852 Unclassified 3822
93 Ga0307406_10062320 3300031901 Unclassified 2412
94 Ga0307412_10012986 3300031911 Bacteria 4869
95 Ga0307409_100053005 3300031995 Unclassified 3114
96 Ga0307409_100117559 3300031995 Bacteria 2244
97 Ga0307416_100055552 3300032002 Unclassified 3189
98 Ga0307414_10250833 3300032004 Unclassified 1471
99 Ga0307411_10002757 3300032005 Bacteria 7897
100 Ga0316574_0495601 3300035398 Bacteria 762
101 Ga0316582_0045719 3300036647 Bacteria 2757
102 Ga0316582_0350192 3300036647 Unclassified 1016
103 Ga0316584_0585126 3300036712 Bacteria 776
104 Ga0316581_0000549 3300037588 Bacteria 7333
105 Ga0439435_0003657 3300042436 Bacteria 3222
106 Ga0451577_0059262 3300042876 Bacteria 3414
107 Ga0451577_0070789 3300042876 Bacteria 3110
108 Ga0453683_0065431 3300044673 Bacteria 2272
109 Ga0453683_0229441 3300044673 Bacteria 1182
110 Ga0466966_0059897 3300044684 Unclassified 2404
111 Ga0466961_0265023 3300044693 Bacteria 1053
112 Ga0466963_0001428 3300044694 Bacteria 12874
113 Ga0466964_0008481 3300044706 Bacteria 3863
114 Ga0453684_0249758 3300044712 Bacteria 2038
115 Ga0453684_0326995 3300044712 Bacteria 1735
116 Ga0466970_0114653 3300044765 Bacteria 1473
117 Ga0466970_0118105 3300044765 Bacteria 1451
118 Ga0466959_0024849 3300045049 Bacteria 4437
119 Ga0451576_0112820 3300045051 Bacteria 2829
120 Ga0466958_0071554 3300045836 Unclassified 2123
121 Ga0495598_0056120 3300046537 Bacteria 1202
122 Ga0495656_0265359 3300046615 Bacteria 871
123 Ga0501290_003457 3300049513 Bacteria 1991
124 Ga0501291_004812 3300049514 Unclassified 1737
125 Ga0501292_001980 3300049515 Unclassified 2588
126 Ga0501297_001419 3300049520 Bacteria 2194
127 Ga0501298_000701 3300049521 Unclassified 4684
128 Ga0501299_000617 3300049522 Unclassified 4230
129 Ga0501303_001810 3300049526 Unclassified 1615
130 Ga0501034_0159208 3300049571 Bacteria 2230
131 Ga0501034_0184510 3300049571 Bacteria 2050
132 Ga0501034_0205863 3300049571 Bacteria 1924
133 Ga0501039_0374201 3300049575 Unclassified 1119
134 Ga0501041_0083984 3300049577 Unclassified 1963
135 Ga0501042_0610009 3300049578 Bacteria 793
136 Ga0501068_0016347 3300049584 Bacteria 4276
137 Ga0501068_0038190 3300049584 Bacteria 2876
138 Ga0501069_0006146 3300049585 Bacteria 6272
139 Ga0501069_0154238 3300049585 Unclassified 1321
140 Ga0501070_0000091 3300049586 Bacteria 77270
141 Ga0501070_0325871 3300049586 Bacteria 1249
142 Ga0501071_0194977 3300049587 Bacteria 1520
143 Ga0501071_0993679 3300049587 Bacteria 648
144 Ga0501072_0551196 3300049588 Bacteria 910
145 Ga0501073_0001363 3300049589 Bacteria 18031
146 Ga0501073_0002814 3300049589 Bacteria 13022
147 Ga0501073_0003905 3300049589 Bacteria 11195
148 Ga0501074_0010144 3300049590 Bacteria 6839
149 Ga0501074_0048259 3300049590 Bacteria 3076
150 Ga0501075_0164399 3300049591 Unclassified 1693
151 Ga0501075_0398980 3300049591 Bacteria 1049
152 Ga0501076_0296307 3300049592 Bacteria 1326
153 Ga0501077_0072599 3300049593 Unclassified 2181
154 Ga0501198_018560 3300049649 Bacteria 1089
155 Ga0501202_050592 3300049652 Unclassified 919
156 Ga0501206_000626 3300049653 Bacteria 4251
157 Ga0501207_020283 3300049654 Unclassified 1060
158 Ga0501214_000760 3300049659 Unclassified 2314
159 Ga0501216_002309 3300049660 Unclassified 2693
160 Ga0501217_015565 3300049661 Unclassified 1733
161 Ga0501223_004094 3300049663 Unclassified 3143
162 Ga0501227_013945 3300049665 Unclassified 1777
163 Ga0501228_000540 3300049666 Unclassified 2455
164 Ga0501230_002624 3300049667 Unclassified 2309
165 Ga0501235_000614 3300049669 Bacteria 7192
166 Ga0501236_011337 3300049670 Bacteria 1182
167 Ga0501239_001866 3300049672 Unclassified 1864
168 Ga0501242_003416 3300049674 Bacteria 1718
169 Ga0501243_009930 3300049675 Unclassified 1481
170 Ga0501247_005201 3300049677 Bacteria 1443
171 Ga0501249_001564 3300049679 Bacteria 4688
172 Ga0501251_010461 3300049681 Bacteria 1088
173 Ga0501252_003269 3300049682 Unclassified 1661
174 Ga0501253_022967 3300049683 Bacteria 1116
175 Ga0501259_002574 3300049688 Unclassified 2926
176 Ga0501260_000904 3300049689 Unclassified 2374
177 Ga0501261_002824 3300049690 Bacteria 2135
178 Ga0501221_002137 3300049704 Unclassified 3285
179 Ga0501229_015173 3300049706 Unclassified 997
180 Ga0501234_008387 3300049707 Unclassified 1611
181 Ga0501245_000674 3300049708 Bacteria 4220
182 Ga0501079_0112983 3300049741 Bacteria 2111
183 Ga0501080_0005298 3300049742 Bacteria 11489
184 Ga0501080_0020326 3300049742 Bacteria 6144
185 Ga0501080_0021643 3300049742 Bacteria 5953
186 Ga0501081_0088386 3300049743 Bacteria 2177
187 Ga0501081_0389516 3300049743 Bacteria 1031
188 Ga0501083_0006242 3300049744 Bacteria 8455
189 Ga0501232_002154 3300049757 Bacteria 1680
190 Ga0501241_027481 3300049758 Unclassified 1064
191 Ga0501263_001500 3300049760 Bacteria 2212
192 Ga0501264_002079 3300049761 Unclassified 1918
193 Ga0501265_003650 3300049762 Bacteria 1747
194 Ga0501268_004620 3300049765 Unclassified 1946
195 Ga0501270_001397 3300049767 Unclassified 2298
196 Ga0501271_002583 3300049768 Unclassified 1624
197 Ga0501272_001920 3300049769 Unclassified 2031
198 Ga0501273_000959 3300049770 Unclassified 2571
199 Ga0501274_000805 3300049771 Unclassified 2311
200 Ga0501276_002154 3300049773 Unclassified 1380
201 Ga0501278_001135 3300049774 Unclassified 1911
202 Ga0501279_014777 3300049775 Bacteria 1077
203 Ga0501279_028883 3300049775 Bacteria 817
204 Ga0501282_005690 3300049778 Bacteria 1335
205 Ga0501283_002917 3300049779 Unclassified 2241
206 Ga0501035_0370212 3300049822 Unclassified 1196
207 Ga0501044_0121921 3300049823 Bacteria 2607
208 Ga0501212_014309 3300049851 Bacteria 1172
209 Ga0501226_009560 3300049853 Bacteria 1079
210 nmdc:mga03683_18879_c1 3300050489 Bacteria 2627
211 nmdc:mga03n38_99757_c1 3300050490 Bacteria 1399
212 nmdc:mga00v17_63476_c1 3300050491 Bacteria 2275
213 nmdc:mga0yw44_87472_c1 3300050492 Bacteria 1964
214 nmdc:mga0k408_40084_c1 3300050493 Bacteria 2694
215 nmdc:mga06z11_32314_c1 3300050494 Bacteria 2551
216 nmdc:mga07m45_103999_c1 3300050496 Bacteria 1632
217 nmdc:mga05p37_67_c1 3300050507 Bacteria 91619
218 nmdc:mga09592_39_c1 3300050508 Bacteria 71520
219 nmdc:mga0qj67_1032870_c1 3300050509 Bacteria 644
220 nmdc:mga0qj67_14358_c1 3300050509 Bacteria 5988
221 nmdc:mga06r32_26288_c1 3300050510 Bacteria 5425
222 nmdc:mga06r32_312_c2 3300050510 Bacteria 36748
223 Ga0500616_0001201 3300053153 Bacteria 26311
224 Ga0501084_0382827 3300054114 Bacteria 1189
225 Ga0590071_009629 3300059421 Unclassified 2269
226 Ga0501082_0011509 3300060353 Bacteria 7616
227 Ga0501082_0048180 3300060353 Bacteria 3672
228 Ga0466962_0148232 3300061719 Unclassified 1138
229 Ga0530510_0068178 3300061734 Bacteria 2581
230 Ga0099794_10093113
231 rootH2_10009051
232 rootH1_10003546
233 Ga0065712_10025964
234 Ga0070658_10538438
235 Ga0070670_100306469
236 Ga0070677_10094002
237 Ga0068869_100168657
238 Ga0068868_100156654
239 Ga0070687_100368486
240 Ga0070668_101013316
241 Ga0070671_100438394
242 Ga0070674_100257357
243 Ga0070673_100421672
244 Ga0070688_100856308
245 Ga0070667_100279234
246 Ga0070678_100060150
247 Ga0070678_100181459
248 Ga0068867_100306708
249 Ga0068867_101128463
250 Ga0070685_10111190
251 Ga0070706_100764244
252 Ga0070706_101225278
253 Ga0070698_100043165
254 Ga0070672_100171192
255 Ga0070672_101004334
256 Ga0070665_101005753
257 Ga0068857_100046140
258 Ga0070702_100131598
259 Ga0068864_100119318
260 Ga0068866_10249466
261 Ga0068863_100366815
262 Ga0070717_10088059
263 Ga0075365_10558978
264 Ga0075364_10089556
265 Ga0075362_10070813
266 Ga0075366_10048387
267 Ga0075430_100014845
268 Ga0075431_100008191
269 Ga0075431_100055543
270 Ga0111539_11139436
271 Ga0105245_10467975
272 Ga0105247_10217832
273 Ga0114129_10002792
274 Ga0105242_10668979
275 Ga0105246_10070996
276 Ga0105246_10327151
277 Ga0157378_10070060
278 Ga0157375_10037236
279 Ga0163163_10459750
280 Ga0163163_10576474
281 Ga0157380_10017779
282 Ga0157380_10174254
283 Ga0157376_10477504
284 Ga0163161_10055960
285 Ga0207682_10002486
286 Ga0207642_10119272
287 Ga0207680_10022523
288 Ga0207645_10062254
289 Ga0207684_10765277
290 Ga0207654_10027128
291 Ga0207662_10251959
292 Ga0207681_10299704
293 Ga0207694_10722875
294 Ga0207650_10110007
295 Ga0207650_10178654
296 Ga0207687_10330144
297 Ga0207670_10217234
298 Ga0207669_10168897
299 Ga0207691_10257215
300 Ga0207689_10120851
301 Ga0207703_10115002
302 Ga0207639_10729489
303 Ga0207676_10022795
304 Ga0207674_10041386
305 Ga0207675_101247929
306 Ga0207683_10013364
307 Ga0207683_10174098
308 Ga0209967_1000915
309 Ga0209981_1001318
310 Ga0210000_1001904
311 Ga0209999_1000868
312 Ga0209588_1048510
313 Ga0268266_10847760
314 Ga0268265_10298312
315 Ga0316575_10015579
316 Ga0316575_10282315
317 Ga0316579_10101269
318 Ga0316576_10079403
319 Ga0316578_10044846
320 Ga0307405_10038243
321 Ga0307410_10023684
322 Ga0307406_10062320
323 Ga0307412_10012986
324 Ga0307409_100053005
325 Ga0307409_100117559
326 Ga0307416_100055552
327 Ga0307414_10250833
328 Ga0307411_10002757
329 Ga0316574_0495601
330 Ga0316582_0045719
331 Ga0316582_0350192
332 Ga0316584_0585126
333 Ga0316581_0000549
334 Ga0439435_0003657
335 Ga0451577_0059262
336 Ga0451577_0070789
337 Ga0453683_0065431
338 Ga0453683_0229441
339 Ga0466966_0059897
340 Ga0466961_0265023
341 Ga0466963_0001428
342 Ga0466964_0008481
343 Ga0453684_0249758
344 Ga0453684_0326995
345 Ga0466970_0114653
346 Ga0466970_0118105
347 Ga0466959_0024849
348 Ga0451576_0112820
349 Ga0466958_0071554
350 Ga0495598_0056120
351 Ga0495656_0265359
352 Ga0501290_003457
353 Ga0501291_004812
354 Ga0501292_001980
355 Ga0501297_001419
356 Ga0501298_000701
357 Ga0501299_000617
358 Ga0501303_001810
359 Ga0501034_0159208
360 Ga0501034_0184510
361 Ga0501034_0205863
362 Ga0501039_0374201
363 Ga0501041_0083984
364 Ga0501042_0610009
365 Ga0501068_0016347
366 Ga0501068_0038190
367 Ga0501069_0006146
368 Ga0501069_0154238
369 Ga0501070_0000091
370 Ga0501070_0325871
371 Ga0501071_0194977
372 Ga0501071_0993679
373 Ga0501072_0551196
374 Ga0501073_0001363
375 Ga0501073_0002814
376 Ga0501073_0003905
377 Ga0501074_0010144
378 Ga0501074_0048259
379 Ga0501075_0164399
380 Ga0501075_0398980
381 Ga0501076_0296307
382 Ga0501077_0072599
383 Ga0501198_018560
384 Ga0501202_050592
385 Ga0501206_000626
386 Ga0501207_020283
387 Ga0501214_000760
388 Ga0501216_002309
389 Ga0501217_015565
390 Ga0501223_004094
391 Ga0501227_013945
392 Ga0501228_000540
393 Ga0501230_002624
394 Ga0501235_000614
395 Ga0501236_011337
396 Ga0501239_001866
397 Ga0501242_003416
398 Ga0501243_009930
399 Ga0501247_005201
400 Ga0501249_001564
401 Ga0501251_010461
402 Ga0501252_003269
403 Ga0501253_022967
404 Ga0501259_002574
405 Ga0501260_000904
406 Ga0501261_002824
407 Ga0501221_002137
408 Ga0501229_015173
409 Ga0501234_008387
410 Ga0501245_000674
411 Ga0501079_0112983
412 Ga0501080_0005298
413 Ga0501080_0020326
414 Ga0501080_0021643
415 Ga0501081_0088386
416 Ga0501081_0389516
417 Ga0501083_0006242
418 Ga0501232_002154
419 Ga0501241_027481
420 Ga0501263_001500
421 Ga0501264_002079
422 Ga0501265_003650
423 Ga0501268_004620
424 Ga0501270_001397
425 Ga0501271_002583
426 Ga0501272_001920
427 Ga0501273_000959
428 Ga0501274_000805
429 Ga0501276_002154
430 Ga0501278_001135
431 Ga0501279_014777
432 Ga0501279_028883
433 Ga0501282_005690
434 Ga0501283_002917
435 Ga0501035_0370212
436 Ga0501044_0121921
437 Ga0501212_014309
438 Ga0501226_009560
439 nmdc:mga03683_18879_c1
440 nmdc:mga03n38_99757_c1
441 nmdc:mga00v17_63476_c1
442 nmdc:mga0yw44_87472_c1
443 nmdc:mga0k408_40084_c1
444 nmdc:mga06z11_32314_c1
445 nmdc:mga07m45_103999_c1
446 nmdc:mga05p37_67_c1
447 nmdc:mga09592_39_c1
448 nmdc:mga0qj67_1032870_c1
449 nmdc:mga0qj67_14358_c1
450 nmdc:mga06r32_26288_c1
451 nmdc:mga06r32_312_c2
452 Ga0500616_0001201
453 Ga0501084_0382827
454 Ga0590071_009629
455 Ga0501082_0011509
456 Ga0501082_0048180
457 Ga0466962_0148232
458 Ga0530510_0068178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

121

228

0.96

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

52

98

0.95

PF21993

TetR_C_13_2

Transcriptional regulator LmrA/YxaF-like, C-terminal domain

121

226

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bru-assembly1.cif.gz_B crystal structure of regulatory protein tetr from rhodobacter sphaeroides 0.9351 7 189
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.9335 4 87
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.9028 6 191
3bru-assembly1.cif.gz_B crystal structure of regulatory protein tetr from rhodobacter sphaeroides 0.9022 7 189
3knw-assembly1.cif.gz_B crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.8862 5 184
ID Description Score Start End Superfamily
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9889 4 51 1.10.10.60
1jupA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9785 4 51 1.10.10.60
3btjA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9775 4 51 1.10.10.60
3btlA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9767 4 51 1.10.10.60
3br6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.976 4 51 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A6N6ZBW2-F1-model_v4 deleted 0.9588 1 191
AF-A0A7M2YW83-F1-model_v4 TetR-type regulatory protein 0.9583 5 191 GO:0003677
GO:0006355
AF-A0A1F3ZNR8-F1-model_v4 TetR family transcriptional regulator 0.9444 16 196 GO:0003677
GO:0006355
AF-A0A7V9LCQ2-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9431 1 163 GO:0003677
GO:0006355
AF-A0A1F3ZNR8-F1-model_v4 TetR family transcriptional regulator 0.9393 16 196 GO:0003677
GO:0006355

Map