F341272

General Info

Members Datasets Scaffolds Average Seq Length
228 150 456 239

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0053956|Ga0466967_0053956_480_1331
Length 276
Sequence MPVASPPVGPPVVVRLARNRLVGSPVALPRRGARARVDHVKVSDSWYSERLEQPIGLVRWGHYGTPVLVFPTAGGDAEEIERNGVIGACWPMIEAGRIKVYSCDSVAGRAMVAKTGSPEYRMWLFNQFHHCVRHEVVPAIRSDLGGAETPIVAAGASIGAFNALAVLCRFPDVFRAAVGMSGTYRIQRFLDGQYSQDLFFASPLDFLPGLDGAQLDLLRTRFAILASGQGAWEDVGSSWDAGDVLGRKGVPNRVDAWGETWRRMLPQYLDELCPSA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
73 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
74 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.51
Rhizosphere 93.42
Stem 0
Stem Tuber 0
Unclassified 9.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0053956 3300045976 Bacteria 3535
2 rootL2_10139499 3300003322 Bacteria 1240
3 Ga0070658_10557515 3300005327 Bacteria 992
4 Ga0070683_100069813 3300005329 Bacteria 3276
5 Ga0070683_100344717 3300005329 Bacteria 1419
6 Ga0070680_100034466 3300005336 Bacteria 4081
7 Ga0070680_100444403 3300005336 Unclassified 1107
8 Ga0070682_100169502 3300005337 Bacteria 1516
9 Ga0070703_10005975 3300005406 Bacteria 3406
10 Ga0070714_100040328 3300005435 Bacteria 3935
11 Ga0070713_100604514 3300005436 Unclassified 1042
12 Ga0070710_10011749 3300005437 Bacteria 4334
13 Ga0070694_100085058 3300005444 Bacteria 2208
14 Ga0070708_100051383 3300005445 Bacteria 3652
15 Ga0070663_100093893 3300005455 Bacteria 2227
16 Ga0070681_10039694 3300005458 Bacteria 4718
17 Ga0070706_100356846 3300005467 Bacteria 1362
18 Ga0070707_100016104 3300005468 Bacteria 7015
19 Ga0070707_100062812 3300005468 Bacteria 3564
20 Ga0070699_100007634 3300005518 Bacteria 9404
21 Ga0070699_100077746 3300005518 Bacteria 2889
22 Ga0070679_100017535 3300005530 Bacteria 6930
23 Ga0070679_100027037 3300005530 Bacteria 5642
24 Ga0070679_100089327 3300005530 Bacteria 3068
25 Ga0070679_100659479 3300005530 Unclassified 989
26 Ga0070684_100147275 3300005535 Bacteria 2132
27 Ga0070684_100217312 3300005535 Bacteria 1743
28 Ga0070697_100183802 3300005536 Bacteria 1773
29 Ga0070665_100373869 3300005548 Unclassified 1432
30 Ga0068856_100229294 3300005614 Bacteria 1873
31 Ga0068864_100246436 3300005618 Bacteria 1657
32 Ga0068864_100430794 3300005618 Unclassified 1258
33 Ga0068858_100005047 3300005842 Bacteria 12940
34 Ga0081455_10000611 3300005937 Bacteria 46255
35 Ga0075428_100028182 3300006844 Bacteria 6212
36 Ga0075430_100008848 3300006846 Bacteria 8494
37 Ga0075430_100235694 3300006846 Bacteria 1517
38 Ga0075431_100003956 3300006847 Bacteria 14435
39 Ga0075433_10054815 3300006852 Bacteria 3479
40 Ga0075433_10210115 3300006852 Bacteria 1729
41 Ga0075429_100001460 3300006880 Bacteria 19415
42 Ga0075436_100152868 3300006914 Bacteria 1624
43 Ga0105240_10445928 3300009093 Bacteria 1449
44 Ga0111539_10079587 3300009094 Bacteria 3855
45 Ga0105245_10126902 3300009098 Bacteria 2389
46 Ga0105248_10072449 3300009177 Bacteria 3872
47 Ga0105248_10364786 3300009177 Bacteria 1626
48 Ga0105237_10096173 3300009545 Unclassified 2952
49 Ga0105237_10161312 3300009545 Unclassified 2241
50 Ga0105249_10794576 3300009553 Bacteria 1010
51 Ga0105246_10319517 3300011119 Bacteria 1261
52 Ga0157370_10548745 3300013104 Bacteria 1059
53 Ga0157372_10039167 3300013307 Bacteria 5232
54 Ga0157372_10157599 3300013307 Bacteria 2623
55 Ga0157372_10474226 3300013307 Bacteria 1459
56 Ga0157379_10341843 3300014968 Bacteria 1369
57 Ga0206353_11035252 3300020082 Bacteria 1152
58 Ga0213875_10013785 3300021388 Bacteria 3959
59 Ga0207699_10073526 3300025906 Bacteria 2097
60 Ga0207705_10000486 3300025909 Bacteria 34066
61 Ga0207684_10315479 3300025910 Bacteria 1348
62 Ga0207707_10001351 3300025912 Bacteria 22855
63 Ga0207707_10080993 3300025912 Bacteria 2834
64 Ga0207707_10418003 3300025912 Unclassified 1150
65 Ga0207695_10404431 3300025913 Bacteria 1249
66 Ga0207671_10076170 3300025914 Bacteria 2510
67 Ga0207663_10438360 3300025916 Bacteria 1006
68 Ga0207660_10000962 3300025917 Bacteria 19071
69 Ga0207660_10021562 3300025917 Bacteria 4334
70 Ga0207660_10070088 3300025917 Bacteria 2548
71 Ga0207660_10071275 3300025917 Bacteria 2528
72 Ga0207660_10203631 3300025917 Bacteria 1547
73 Ga0207660_10326810 3300025917 Bacteria 1226
74 Ga0207652_10000293 3300025921 Bacteria 51659
75 Ga0207652_10011802 3300025921 Bacteria 7050
76 Ga0207652_10012890 3300025921 Bacteria 6763
77 Ga0207646_10002985 3300025922 Bacteria 19544
78 Ga0207646_10014952 3300025922 Bacteria 7349
79 Ga0207646_10097316 3300025922 Bacteria 2637
80 Ga0207694_10320429 3300025924 Bacteria 1279
81 Ga0207687_10479802 3300025927 Bacteria 1035
82 Ga0207700_10285210 3300025928 Bacteria 1422
83 Ga0207664_10121636 3300025929 Bacteria 2185
84 Ga0207664_10342882 3300025929 Bacteria 1321
85 Ga0207661_10067581 3300025944 Bacteria 2907
86 Ga0207661_10114632 3300025944 Bacteria 2285
87 Ga0207703_10000802 3300026035 Bacteria 30959
88 Ga0207708_10662781 3300026075 Bacteria 889
89 Ga0207702_10395494 3300026078 Bacteria 1332
90 Ga0207698_10429908 3300026142 Bacteria 1269
91 Ga0268266_10272917 3300028379 Bacteria 1570
92 Ga0307512_10169794 3300030522 Unclassified 1254
93 Ga0307410_10043719 3300031852 Bacteria 2971
94 Ga0326468_10010164 3300031889 Bacteria 947
95 Ga0307407_10086211 3300031903 Bacteria 1913
96 Ga0307407_10271692 3300031903 Bacteria 1170
97 Ga0307412_10665597 3300031911 Archaea 890
98 Ga0307409_100044336 3300031995 Bacteria 3349
99 Ga0307414_10162711 3300032004 Bacteria 1775
100 Ga0307415_100366372 3300032126 Bacteria 1219
101 Ga0307510_10028953 3300033180 Bacteria 6313
102 Ga0373944_0013642 3300035089 Bacteria 2259
103 Ga0373954_0085565 3300035118 Bacteria 1510
104 Ga0373937_0031546 3300036401 Bacteria 4803
105 Ga0373925_0254310 3300037068 Unclassified 1409
106 Ga0395900_0007427 3300037418 Bacteria 11326
107 Ga0395900_0046033 3300037418 Bacteria 4493
108 Ga0395898_0022095 3300037466 Bacteria 6446
109 Ga0395898_0591785 3300037466 Bacteria 1052
110 Ga0395905_0307768 3300037471 Bacteria 1473
111 Ga0436364_0473486 3300037853 Bacteria 7718
112 Ga0395901_0016622 3300038443 Bacteria 7497
113 Ga0395901_0105160 3300038443 Bacteria 2963
114 Ga0439460_0034350 3300042461 Bacteria 1462
115 Ga0451577_0002980 3300042876 Bacteria 19358
116 Ga0453683_0048859 3300044673 Bacteria 2653
117 Ga0466966_0145207 3300044684 Unclassified 1448
118 Ga0453684_0016065 3300044712 Bacteria 11752
119 Ga0466971_0036176 3300044719 Bacteria 2214
120 Ga0466957_0054169 3300044842 Bacteria 2447
121 Ga0466957_0229525 3300044842 Unclassified 1228
122 Ga0466960_0037069 3300044901 Bacteria 2286
123 Ga0466960_0071016 3300044901 Bacteria 1733
124 Ga0466960_0123494 3300044901 Bacteria 1358
125 Ga0466960_0233029 3300044901 Bacteria 1017
126 Ga0466958_0025194 3300045836 Bacteria 3505
127 Ga0466958_0046817 3300045836 Bacteria 2610
128 Ga0466958_0206966 3300045836 Bacteria 1249
129 Ga0466967_0005717 3300045976 Bacteria 8674
130 Ga0466967_0153611 3300045976 Unclassified 2154
131 Ga0466967_0571845 3300045976 Bacteria 1113
132 Ga0466967_0597008 3300045976 Bacteria 1089
133 Ga0495592_0095474 3300046454 Bacteria 2126
134 Ga0495603_0129040 3300046455 Bacteria 1473
135 Ga0495651_0001406 3300046462 Bacteria 18670
136 Ga0495653_0001075 3300046463 Bacteria 21079
137 Ga0495608_0000999 3300046511 Bacteria 19927
138 Ga0495628_0019501 3300046516 Bacteria 5604
139 Ga0495652_0024437 3300046529 Bacteria 5348
140 Ga0495640_0184767 3300046533 Bacteria 1327
141 Ga0495587_0001532 3300046536 Bacteria 15367
142 Ga0495667_0003538 3300046559 Bacteria 10493
143 Ga0495667_0128542 3300046559 Unclassified 1634
144 Ga0495635_0002115 3300046663 Bacteria 13475
145 Ga0495657_0004058 3300046675 Bacteria 11740
146 Ga0495599_0014018 3300046678 Bacteria 4962
147 Ga0495646_0019026 3300046680 Bacteria 4350
148 Ga0495646_0024600 3300046680 Bacteria 3791
149 Ga0495600_0000957 3300046809 Bacteria 15523
150 Ga0495604_0011576 3300047317 Bacteria 7012
151 Ga0495674_0044807 3300047319 Bacteria 3931
152 Ga0495672_0000975 3300047320 Bacteria 29631
153 Ga0495680_0002010 3300047322 Bacteria 21346
154 Ga0495684_0039320 3300047471 Bacteria 3625
155 Ga0495602_0000946 3300048088 Bacteria 28012
156 Ga0496101_0268423 3300048904 Bacteria 1332
157 Ga0496104_0095696 3300048907 Bacteria 2841
158 Ga0496108_0614320 3300048911 Bacteria 947
159 Ga0496109_0371935 3300048912 Bacteria 1350
160 Ga0496109_0485906 3300048912 Bacteria 1166
161 Ga0496110_0291342 3300048913 Unclassified 1487
162 Ga0496114_0000408 3300048917 Bacteria 31851
163 Ga0496114_0394073 3300048917 Bacteria 1226
164 Ga0496125_0000813 3300048928 Bacteria 50736
165 Ga0496126_0018875 3300048929 Bacteria 6814
166 Ga0501031_0021037 3300049568 Bacteria 4255
167 Ga0501031_0394447 3300049568 Bacteria 895
168 Ga0501036_0051773 3300049572 Bacteria 3477
169 Ga0501036_0561385 3300049572 Bacteria 948
170 Ga0501037_0350156 3300049573 Bacteria 1019
171 Ga0501038_0042688 3300049574 Bacteria 3949
172 Ga0501038_0159542 3300049574 Bacteria 1834
173 Ga0501038_0727486 3300049574 Bacteria 742
174 Ga0501039_0031633 3300049575 Bacteria 4080
175 Ga0501039_0167567 3300049575 Bacteria 1727
176 Ga0501039_0314412 3300049575 Bacteria 1231
177 Ga0501040_0083235 3300049576 Bacteria 2219
178 Ga0501040_0106700 3300049576 Bacteria 1957
179 Ga0501041_0020849 3300049577 Bacteria 3923
180 Ga0501042_0035049 3300049578 Bacteria 3561
181 Ga0501042_0105522 3300049578 Bacteria 2028
182 Ga0501042_0130230 3300049578 Bacteria 1813
183 Ga0501042_0461105 3300049578 Unclassified 922
184 Ga0501046_0049718 3300049580 Bacteria 3316
185 Ga0501048_0227501 3300049582 Bacteria 1323
186 Ga0501048_0239077 3300049582 Bacteria 1289
187 Ga0501071_0266845 3300049587 Bacteria 1293
188 Ga0501071_0363646 3300049587 Unclassified 1102
189 Ga0501072_0040997 3300049588 Bacteria 3636
190 Ga0501072_0281751 3300049588 Bacteria 1322
191 Ga0501072_0283347 3300049588 Bacteria 1318
192 Ga0501074_0145656 3300049590 Bacteria 1694
193 Ga0501075_0037319 3300049591 Bacteria 3630
194 Ga0501075_0395544 3300049591 Unclassified 1053
195 Ga0501076_0096001 3300049592 Bacteria 2388
196 Ga0501076_0251447 3300049592 Bacteria 1446
197 Ga0501076_0503950 3300049592 Unclassified 998
198 Ga0501077_0029887 3300049593 Bacteria 3466
199 Ga0501079_0272860 3300049741 Bacteria 1322
200 Ga0501079_0340390 3300049741 Bacteria 1175
201 Ga0501080_0407953 3300049742 Bacteria 1222
202 Ga0501081_0056734 3300049743 Bacteria 2707
203 Ga0501081_0513334 3300049743 Unclassified 894
204 Ga0501045_0022408 3300049824 Bacteria 4523
205 Ga0501045_0029817 3300049824 Bacteria 3945
206 Ga0501045_0032538 3300049824 Bacteria 3779
207 Ga0501045_0083037 3300049824 Bacteria 2363
208 Ga0501045_0399515 3300049824 Bacteria 1023
209 nmdc:mga05p37_4019_c1 3300050507 Bacteria 17201
210 nmdc:mga09592_464_c1 3300050508 Bacteria 30285
211 nmdc:mga0qj67_221776_c1 3300050509 Bacteria 1535
212 nmdc:mga06r32_1332_c1 3300050510 Bacteria 22277
213 nmdc:mga06r32_193039_c1 3300050510 Unclassified 2023
214 nmdc:mga06r32_292_c1 3300050510 Bacteria 41600
215 nmdc:mga08y16_162168_c1 3300050511 Bacteria 2323
216 nmdc:mga08y16_5819_c1 3300050511 Bacteria 12921
217 nmdc:mga0a205_214334_c1 3300050515 Bacteria 1813
218 Ga0495612_0060191 3300053078 Bacteria 1572
219 Ga0501084_0117797 3300054114 Bacteria 2233
220 Ga0501084_0354704 3300054114 Bacteria 1239
221 Ga0501084_0419683 3300054114 Bacteria 1131
222 Ga0501082_0084355 3300060353 Bacteria 2740
223 Ga0501082_0174373 3300060353 Bacteria 1870
224 Ga0501082_0187492 3300060353 Bacteria 1800
225 Ga0501082_0537980 3300060353 Bacteria 1022
226 Ga0466962_0171176 3300061719 Bacteria 1057
227 Ga0530510_0055869 3300061734 Bacteria 2852
228 Ga0530510_0191248 3300061734 Bacteria 1519
229 Ga0466967_0053956
230 rootL2_10139499
231 Ga0070658_10557515
232 Ga0070683_100069813
233 Ga0070683_100344717
234 Ga0070680_100034466
235 Ga0070680_100444403
236 Ga0070682_100169502
237 Ga0070703_10005975
238 Ga0070714_100040328
239 Ga0070713_100604514
240 Ga0070710_10011749
241 Ga0070694_100085058
242 Ga0070708_100051383
243 Ga0070663_100093893
244 Ga0070681_10039694
245 Ga0070706_100356846
246 Ga0070707_100016104
247 Ga0070707_100062812
248 Ga0070699_100007634
249 Ga0070699_100077746
250 Ga0070679_100017535
251 Ga0070679_100027037
252 Ga0070679_100089327
253 Ga0070679_100659479
254 Ga0070684_100147275
255 Ga0070684_100217312
256 Ga0070697_100183802
257 Ga0070665_100373869
258 Ga0068856_100229294
259 Ga0068864_100246436
260 Ga0068864_100430794
261 Ga0068858_100005047
262 Ga0081455_10000611
263 Ga0075428_100028182
264 Ga0075430_100008848
265 Ga0075430_100235694
266 Ga0075431_100003956
267 Ga0075433_10054815
268 Ga0075433_10210115
269 Ga0075429_100001460
270 Ga0075436_100152868
271 Ga0105240_10445928
272 Ga0111539_10079587
273 Ga0105245_10126902
274 Ga0105248_10072449
275 Ga0105248_10364786
276 Ga0105237_10096173
277 Ga0105237_10161312
278 Ga0105249_10794576
279 Ga0105246_10319517
280 Ga0157370_10548745
281 Ga0157372_10039167
282 Ga0157372_10157599
283 Ga0157372_10474226
284 Ga0157379_10341843
285 Ga0206353_11035252
286 Ga0213875_10013785
287 Ga0207699_10073526
288 Ga0207705_10000486
289 Ga0207684_10315479
290 Ga0207707_10001351
291 Ga0207707_10080993
292 Ga0207707_10418003
293 Ga0207695_10404431
294 Ga0207671_10076170
295 Ga0207663_10438360
296 Ga0207660_10000962
297 Ga0207660_10021562
298 Ga0207660_10070088
299 Ga0207660_10071275
300 Ga0207660_10203631
301 Ga0207660_10326810
302 Ga0207652_10000293
303 Ga0207652_10011802
304 Ga0207652_10012890
305 Ga0207646_10002985
306 Ga0207646_10014952
307 Ga0207646_10097316
308 Ga0207694_10320429
309 Ga0207687_10479802
310 Ga0207700_10285210
311 Ga0207664_10121636
312 Ga0207664_10342882
313 Ga0207661_10067581
314 Ga0207661_10114632
315 Ga0207703_10000802
316 Ga0207708_10662781
317 Ga0207702_10395494
318 Ga0207698_10429908
319 Ga0268266_10272917
320 Ga0307512_10169794
321 Ga0307410_10043719
322 Ga0326468_10010164
323 Ga0307407_10086211
324 Ga0307407_10271692
325 Ga0307412_10665597
326 Ga0307409_100044336
327 Ga0307414_10162711
328 Ga0307415_100366372
329 Ga0307510_10028953
330 Ga0373944_0013642
331 Ga0373954_0085565
332 Ga0373937_0031546
333 Ga0373925_0254310
334 Ga0395900_0007427
335 Ga0395900_0046033
336 Ga0395898_0022095
337 Ga0395898_0591785
338 Ga0395905_0307768
339 Ga0436364_0473486
340 Ga0395901_0016622
341 Ga0395901_0105160
342 Ga0439460_0034350
343 Ga0451577_0002980
344 Ga0453683_0048859
345 Ga0466966_0145207
346 Ga0453684_0016065
347 Ga0466971_0036176
348 Ga0466957_0054169
349 Ga0466957_0229525
350 Ga0466960_0037069
351 Ga0466960_0071016
352 Ga0466960_0123494
353 Ga0466960_0233029
354 Ga0466958_0025194
355 Ga0466958_0046817
356 Ga0466958_0206966
357 Ga0466967_0005717
358 Ga0466967_0153611
359 Ga0466967_0571845
360 Ga0466967_0597008
361 Ga0495592_0095474
362 Ga0495603_0129040
363 Ga0495651_0001406
364 Ga0495653_0001075
365 Ga0495608_0000999
366 Ga0495628_0019501
367 Ga0495652_0024437
368 Ga0495640_0184767
369 Ga0495587_0001532
370 Ga0495667_0003538
371 Ga0495667_0128542
372 Ga0495635_0002115
373 Ga0495657_0004058
374 Ga0495599_0014018
375 Ga0495646_0019026
376 Ga0495646_0024600
377 Ga0495600_0000957
378 Ga0495604_0011576
379 Ga0495674_0044807
380 Ga0495672_0000975
381 Ga0495680_0002010
382 Ga0495684_0039320
383 Ga0495602_0000946
384 Ga0496101_0268423
385 Ga0496104_0095696
386 Ga0496108_0614320
387 Ga0496109_0371935
388 Ga0496109_0485906
389 Ga0496110_0291342
390 Ga0496114_0000408
391 Ga0496114_0394073
392 Ga0496125_0000813
393 Ga0496126_0018875
394 Ga0501031_0021037
395 Ga0501031_0394447
396 Ga0501036_0051773
397 Ga0501036_0561385
398 Ga0501037_0350156
399 Ga0501038_0042688
400 Ga0501038_0159542
401 Ga0501038_0727486
402 Ga0501039_0031633
403 Ga0501039_0167567
404 Ga0501039_0314412
405 Ga0501040_0083235
406 Ga0501040_0106700
407 Ga0501041_0020849
408 Ga0501042_0035049
409 Ga0501042_0105522
410 Ga0501042_0130230
411 Ga0501042_0461105
412 Ga0501046_0049718
413 Ga0501048_0227501
414 Ga0501048_0239077
415 Ga0501071_0266845
416 Ga0501071_0363646
417 Ga0501072_0040997
418 Ga0501072_0281751
419 Ga0501072_0283347
420 Ga0501074_0145656
421 Ga0501075_0037319
422 Ga0501075_0395544
423 Ga0501076_0096001
424 Ga0501076_0251447
425 Ga0501076_0503950
426 Ga0501077_0029887
427 Ga0501079_0272860
428 Ga0501079_0340390
429 Ga0501080_0407953
430 Ga0501081_0056734
431 Ga0501081_0513334
432 Ga0501045_0022408
433 Ga0501045_0029817
434 Ga0501045_0032538
435 Ga0501045_0083037
436 Ga0501045_0399515
437 nmdc:mga05p37_4019_c1
438 nmdc:mga09592_464_c1
439 nmdc:mga0qj67_221776_c1
440 nmdc:mga06r32_1332_c1
441 nmdc:mga06r32_193039_c1
442 nmdc:mga06r32_292_c1
443 nmdc:mga08y16_162168_c1
444 nmdc:mga08y16_5819_c1
445 nmdc:mga0a205_214334_c1
446 Ga0495612_0060191
447 Ga0501084_0117797
448 Ga0501084_0354704
449 Ga0501084_0419683
450 Ga0501082_0084355
451 Ga0501082_0174373
452 Ga0501082_0187492
453 Ga0501082_0537980
454 Ga0466962_0171176
455 Ga0530510_0055869
456 Ga0530510_0191248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

88

260

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ls2-assembly2.cif.gz_D crystal structure of an s-formylglutathione hydrolase from pseudoalteromonas haloplanktis tac125 0.7559 2 240
3c8d-assembly5.cif.gz_A crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-glycine 0.7555 1 240
5vol-assembly2.cif.gz_G bacint_04212 ferulic acid esterase 0.7476 1 240
3ls2-assembly2.cif.gz_D crystal structure of an s-formylglutathione hydrolase from pseudoalteromonas haloplanktis tac125 0.7476 2 240
3fcx-assembly2.cif.gz_B crystal structure of human esterase d 0.7459 2 240
ID Description Score Start End Superfamily
af_Q95X98_24_117_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.8268 1 22 2.70.130.10
af_A0A0G2JYG2_4_177_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7494 2 137 3.40.50.1820
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7459 2 240 3.40.50.1820
3c8dD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7456 1 240 3.40.50.1820
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7386 2 240 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A838SM24-F1-model_v4 Esterase 0.9925 1 134
AF-A0A542E609-F1-model_v4 Esterase/lipase superfamily enzyme 0.9904 1 237
AF-A0A516G8D5-F1-model_v4 Esterase 0.9891 1 239
AF-A0A848XHZ4-F1-model_v4 Esterase 0.9888 1 220
AF-A0A6N9RVP0-F1-model_v4 deleted 0.9876 2 239

Map