F340556

General Info

Members Datasets Scaffolds Average Seq Length
228 157 456 156

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10026544|JGI25406J46586_100265442
Length 156
Sequence MPRRRVVDKREVLADPVYNSPLVTKFINGLMWGGKKSTAEGIFYRALTQVGEKTGEDPLKMFKRAIDNVRPTVEVKSRRVGGSTYQVPIEVPQERRGSLAIRWIVGAARARGEKTMTDRLAGEMLDAANNRGNAVKKKEDVHRMAEANKAFAHYKW

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
34 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
40 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
59 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
83 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
87 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
101 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
102 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
103 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
104 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
117 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
118 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
119 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
120 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
121 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
122 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
123 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
124 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
128 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
129 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
130 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
131 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.16
Metatranscriptomes 11.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 6.14
Rhizosphere 81.14
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10026544 3300003203 Bacteria 2231
2 JGI25406J46586_10009395 3300003203 Bacteria 4381
3 Ga0065715_10156201 3300005293 Bacteria 1658
4 Ga0070683_100346930 3300005329 Bacteria 1414
5 Ga0070680_101099394 3300005336 Bacteria 687
6 Ga0070689_101017558 3300005340 Bacteria 738
7 Ga0070687_101140901 3300005343 Bacteria 572
8 Ga0070661_101250464 3300005344 Bacteria 622
9 Ga0070668_101201523 3300005347 Bacteria 687
10 Ga0070713_101095631 3300005436 Bacteria 770
11 Ga0070694_100052247 3300005444 Bacteria 2762
12 Ga0070678_101430345 3300005456 Bacteria 646
13 Ga0070707_100003203 3300005468 Bacteria 15481
14 Ga0070698_100001364 3300005471 Bacteria 27181
15 Ga0070698_100266293 3300005471 Bacteria 1646
16 Ga0070699_100034589 3300005518 Bacteria 4367
17 Ga0070696_100045863 3300005546 Bacteria 3029
18 Ga0070704_100011229 3300005549 Bacteria 5481
19 Ga0070704_100302808 3300005549 Bacteria 1332
20 Ga0068856_101003848 3300005614 Bacteria 853
21 Ga0068852_101533303 3300005616 Bacteria 689
22 Ga0081538_10368151 3300005981 Bacteria 519
23 Ga0081539_10002683 3300005985 Bacteria 24194
24 Ga0081539_10003361 3300005985 Bacteria 19802
25 Ga0081539_10100437 3300005985 Bacteria 1476
26 Ga0075428_100587516 3300006844 Bacteria 1190
27 Ga0075433_10045085 3300006852 Bacteria 3832
28 Ga0111539_10029066 3300009094 Bacteria 6739
29 Ga0105245_11320773 3300009098 Bacteria 770
30 Ga0114129_10084333 3300009147 Bacteria 4412
31 Ga0114129_11536569 3300009147 Bacteria 817
32 Ga0105243_10182109 3300009148 Bacteria 1828
33 Ga0105243_11120790 3300009148 Bacteria 796
34 Ga0105249_10001283 3300009553 Bacteria 22053
35 Ga0105239_10724775 3300010375 Bacteria 1138
36 Ga0105246_12148623 3300011119 Bacteria 542
37 Ga0163162_10000784 3300013306 Bacteria 29548
38 Ga0163163_10470955 3300014325 Bacteria 1317
39 Ga0206356_11514647 3300020070 Bacteria 966
40 Ga0206356_11698754 3300020070 Bacteria 1324
41 Ga0206355_1376131 3300020076 Bacteria 833
42 Ga0206351_10294894 3300020077 Unclassified 841
43 Ga0206352_10530971 3300020078 Bacteria 921
44 Ga0206350_11062542 3300020080 Bacteria 797
45 Ga0206354_10298011 3300020081 Bacteria 1003
46 Ga0206354_11398323 3300020081 Bacteria 517
47 Ga0213876_10002063 3300021384 Bacteria 11902
48 Ga0213876_10003985 3300021384 Bacteria 8315
49 Ga0213871_10081659 3300021441 Bacteria 927
50 Ga0224712_10073615 3300022467 Bacteria 1394
51 Ga0224712_10224090 3300022467 Bacteria 862
52 Ga0209233_1018682 3300025261 Bacteria 1859
53 Ga0207653_10085121 3300025885 Bacteria 1100
54 Ga0207707_10997097 3300025912 Bacteria 688
55 Ga0207660_10679362 3300025917 Bacteria 840
56 Ga0207662_10712419 3300025918 Bacteria 704
57 Ga0207646_10004365 3300025922 Bacteria 15403
58 Ga0207681_10965208 3300025923 Bacteria 715
59 Ga0207700_10379447 3300025928 Bacteria 1236
60 Ga0207661_10287876 3300025944 Bacteria 1470
61 Ga0207661_11323682 3300025944 Bacteria 662
62 Ga0207679_11133675 3300025945 Bacteria 718
63 Ga0207712_10000586 3300025961 Bacteria 29417
64 Ga0207668_10045139 3300025972 Bacteria 3003
65 Ga0207702_10305086 3300026078 Bacteria 1512
66 Ga0207698_10422908 3300026142 Bacteria 1279
67 Ga0207428_10001994 3300027907 Bacteria 20707
68 Ga0268264_10834934 3300028381 Unclassified 922
69 Ga0265334_10000037 3300028573 Bacteria 102928
70 Ga0316177_1214281 3300030731 Bacteria 973
71 Ga0265777_111605 3300030877 Bacteria 657
72 Ga0307408_101465758 3300031548 Bacteria 644
73 Ga0307413_10703235 3300031824 Bacteria 840
74 Ga0326468_10049798 3300031889 Bacteria 631
75 Ga0307414_10979179 3300032004 Bacteria 778
76 Ga0373935_0072697 3300035692 Bacteria 2221
77 Ga0395900_0422239 3300037418 Bacteria 1294
78 Ga0395898_0394646 3300037466 Bacteria 1319
79 Ga0395905_0004072 3300037471 Bacteria 15323
80 Ga0436364_0017288 3300037853 Bacteria 828
81 Ga0436364_0448748 3300037853 Bacteria 643
82 Ga0436364_0889221 3300037853 Bacteria 921
83 Ga0436364_1077467 3300037853 Bacteria 616
84 Ga0436364_1332466 3300037853 Bacteria 2259
85 Ga0436364_1333069 3300037853 Bacteria 596
86 Ga0436364_1373734 3300037853 Bacteria 638
87 Ga0436364_1522382 3300037853 Bacteria 745
88 Ga0395901_1799888 3300038443 Bacteria 562
89 Ga0436365_0370071 3300039437 Bacteria 838
90 Ga0436365_0771081 3300039437 Bacteria 1124
91 Ga0436365_1025576 3300039437 Bacteria 13182
92 Ga0436365_1476151 3300039437 Bacteria 611
93 Ga0436365_1812885 3300039437 Bacteria 18963
94 Ga0436365_1844649 3300039437 Bacteria 806
95 Ga0436360_0032600 3300039438 Bacteria 658
96 Ga0436360_0539333 3300039438 Bacteria 1994
97 Ga0436360_0683381 3300039438 Bacteria 614
98 Ga0436360_1040566 3300039438 Bacteria 617
99 Ga0436360_1289763 3300039438 Bacteria 925
100 Ga0436360_1315200 3300039438 Bacteria 748
101 Ga0436361_0190433 3300039447 Bacteria 568
102 Ga0436361_0422993 3300039447 Bacteria 922
103 Ga0436361_0457145 3300039447 Bacteria 719
104 Ga0436361_0519623 3300039447 Bacteria 562
105 Ga0436361_0645822 3300039447 Bacteria 756
106 Ga0436361_0733514 3300039447 Bacteria 654
107 Ga0436361_0869010 3300039447 Bacteria 538
108 Ga0436361_0890332 3300039447 Bacteria 643
109 Ga0436361_0926619 3300039447 Bacteria 726
110 Ga0436363_0274371 3300039450 Bacteria 654
111 Ga0436363_0361840 3300039450 Bacteria 711
112 Ga0436363_0396465 3300039450 Bacteria 584
113 Ga0436363_0930951 3300039450 Bacteria 558
114 Ga0436363_1031563 3300039450 Bacteria 667
115 Ga0436363_1066762 3300039450 Bacteria 721
116 Ga0436363_1179018 3300039450 Bacteria 644
117 Ga0436363_1265684 3300039450 Bacteria 567
118 Ga0436363_1581383 3300039450 Bacteria 862
119 Ga0436363_1710086 3300039450 Bacteria 790
120 Ga0436362_0046395 3300039453 Bacteria 679
121 Ga0436362_0055496 3300039453 Bacteria 542
122 Ga0436362_0408683 3300039453 Bacteria 756
123 Ga0436362_0468561 3300039453 Bacteria 644
124 Ga0436362_0876626 3300039453 Bacteria 844
125 Ga0436362_0946738 3300039453 Bacteria 557
126 Ga0436362_0971269 3300039453 Bacteria 553
127 Ga0451577_0020753 3300042876 Bacteria 6023
128 Ga0466965_0133285 3300044683 Bacteria 1290
129 Ga0453684_0021242 3300044712 Bacteria 9714
130 Ga0453684_0348814 3300044712 Bacteria 1670
131 Ga0466957_0416553 3300044842 Bacteria 921
132 Ga0495608_0003961 3300046511 Bacteria 10637
133 Ga0495652_0366823 3300046529 Bacteria 1027
134 Ga0495667_0282136 3300046559 Bacteria 1054
135 Ga0495667_0688782 3300046559 Bacteria 634
136 Ga0495599_0196411 3300046678 Bacteria 1240
137 Ga0495623_0335969 3300046679 Bacteria 826
138 Ga0495646_0270479 3300046680 Bacteria 905
139 Ga0495604_0154062 3300047317 Bacteria 1630
140 Ga0495636_0001001 3300047318 Bacteria 10572
141 Ga0495675_0218217 3300047444 Bacteria 1155
142 Ga0496100_0474893 3300048903 Bacteria 961
143 Ga0496101_0047829 3300048904 Bacteria 3072
144 Ga0496104_0006010 3300048907 Bacteria 10642
145 Ga0496104_0937655 3300048907 Bacteria 770
146 Ga0496105_0001809 3300048908 Bacteria 15303
147 Ga0496105_1245972 3300048908 Bacteria 546
148 Ga0496108_0030874 3300048911 Bacteria 4441
149 Ga0496109_0448025 3300048912 Bacteria 1219
150 Ga0496110_0026675 3300048913 Bacteria 4947
151 Ga0496110_1013427 3300048913 Bacteria 738
152 Ga0496111_0109909 3300048914 Bacteria 2030
153 Ga0496112_0018018 3300048915 Bacteria 6646
154 Ga0496113_0014161 3300048916 Bacteria 5432
155 Ga0496115_0013592 3300048918 Bacteria 6159
156 Ga0501306_034855 3300049127 Bacteria 762
157 Ga0501293_003621 3300049516 Bacteria 1202
158 Ga0501295_050240 3300049518 Bacteria 890
159 Ga0501296_000508 3300049519 Bacteria 3806
160 Ga0501298_000210 3300049521 Bacteria 7431
161 Ga0501299_000429 3300049522 Bacteria 4974
162 Ga0501032_0289411 3300049569 Bacteria 1060
163 Ga0501034_0002113 3300049571 Bacteria 24747
164 Ga0501034_0418012 3300049571 Bacteria 1262
165 Ga0501037_0001148 3300049573 Bacteria 19589
166 Ga0501037_0881272 3300049573 Bacteria 587
167 Ga0501038_0009342 3300049574 Bacteria 8995
168 Ga0501042_0171855 3300049578 Bacteria 1564
169 Ga0501042_0420872 3300049578 Bacteria 968
170 Ga0501043_0000345 3300049579 Bacteria 42117
171 Ga0501046_0000001 3300049580 Bacteria 609806
172 Ga0501046_0153516 3300049580 Bacteria 1736
173 Ga0501047_0001739 3300049581 Bacteria 21109
174 Ga0501047_0077523 3300049581 Bacteria 3197
175 Ga0501047_0864481 3300049581 Bacteria 718
176 Ga0501048_0011547 3300049582 Bacteria 6586
177 Ga0501068_0696452 3300049584 Bacteria 664
178 Ga0501070_1057213 3300049586 Bacteria 628
179 Ga0501198_027356 3300049649 Bacteria 936
180 Ga0501201_006539 3300049651 Bacteria 1105
181 Ga0501202_002859 3300049652 Bacteria 2926
182 Ga0501217_061084 3300049661 Bacteria 1007
183 Ga0501224_042037 3300049664 Bacteria 692
184 Ga0501235_000790 3300049669 Bacteria 6449
185 Ga0501243_002361 3300049675 Bacteria 2758
186 Ga0501243_142886 3300049675 Bacteria 507
187 Ga0501250_003384 3300049680 Bacteria 1525
188 Ga0501225_0015459 3300049705 Bacteria 2124
189 Ga0501080_0059126 3300049742 Bacteria 3568
190 Ga0501080_0851447 3300049742 Bacteria 797
191 Ga0501083_0000001 3300049744 Bacteria 555041
192 Ga0501262_024426 3300049759 Bacteria 845
193 Ga0501264_008345 3300049761 Bacteria 977
194 Ga0501269_018766 3300049766 Bacteria 858
195 Ga0501270_005728 3300049767 Bacteria 1458
196 Ga0501283_001019 3300049779 Bacteria 3702
197 Ga0501035_0219875 3300049822 Bacteria 1622
198 Ga0501035_0380452 3300049822 Bacteria 1177
199 Ga0501044_0011722 3300049823 Bacteria 9494
200 Ga0501044_0046965 3300049823 Bacteria 4468
201 Ga0501044_0187370 3300049823 Bacteria 2033
202 nmdc:mga0yw44_806655_c1 3300050492 Bacteria 637
203 nmdc:mga05p37_841685_c1 3300050507 Bacteria 998
204 nmdc:mga08y16_19681_c1 3300050511 Bacteria 7117
205 nmdc:mga0n895_1813296_c1 3300050512 Bacteria 570
206 nmdc:mga0a205_190858_c1 3300050515 Bacteria 1941
207 Ga0495601_0001729 3300053077 Bacteria 12082
208 Ga0495595_0095175 3300053084 Bacteria 1433
209 Ga0495619_0253415 3300053085 Bacteria 1220
210 Ga0495619_0256481 3300053085 Bacteria 1212
211 Ga0500616_0022184 3300053153 Bacteria 3549
212 Ga0501084_0174297 3300054114 Bacteria 1815
213 Ga0587084_050425 3300059477 Bacteria 735
214 Ga0587066_048355 3300059490 Bacteria 828
215 Ga0587070_118238 3300059491 Bacteria 631
216 Ga0587077_210690 3300059493 Bacteria 543
217 Ga0587080_092203 3300059503 Bacteria 637
218 Ga0587083_0143346 3300059505 Bacteria 638
219 Ga0587083_0215196 3300059505 Unclassified 556
220 Ga0587109_069532 3300059624 Bacteria 758
221 Ga0587117_054152 3300059627 Bacteria 673
222 Ga0587062_044106 3300059639 Bacteria 734
223 Ga0587067_138018 3300059640 Bacteria 601
224 Ga0587107_052897 3300059652 Bacteria 694
225 Ga0587071_084874 3300060344 Bacteria 711
226 Ga0587111_0101197 3300060346 Bacteria 718
227 Ga0587111_0183354 3300060346 Bacteria 583
228 Ga0466962_0739203 3300061719 Bacteria 506
229 JGI25406J46586_10026544
230 JGI25406J46586_10009395
231 Ga0065715_10156201
232 Ga0070683_100346930
233 Ga0070680_101099394
234 Ga0070689_101017558
235 Ga0070687_101140901
236 Ga0070661_101250464
237 Ga0070668_101201523
238 Ga0070713_101095631
239 Ga0070694_100052247
240 Ga0070678_101430345
241 Ga0070707_100003203
242 Ga0070698_100001364
243 Ga0070698_100266293
244 Ga0070699_100034589
245 Ga0070696_100045863
246 Ga0070704_100011229
247 Ga0070704_100302808
248 Ga0068856_101003848
249 Ga0068852_101533303
250 Ga0081538_10368151
251 Ga0081539_10002683
252 Ga0081539_10003361
253 Ga0081539_10100437
254 Ga0075428_100587516
255 Ga0075433_10045085
256 Ga0111539_10029066
257 Ga0105245_11320773
258 Ga0114129_10084333
259 Ga0114129_11536569
260 Ga0105243_10182109
261 Ga0105243_11120790
262 Ga0105249_10001283
263 Ga0105239_10724775
264 Ga0105246_12148623
265 Ga0163162_10000784
266 Ga0163163_10470955
267 Ga0206356_11514647
268 Ga0206356_11698754
269 Ga0206355_1376131
270 Ga0206351_10294894
271 Ga0206352_10530971
272 Ga0206350_11062542
273 Ga0206354_10298011
274 Ga0206354_11398323
275 Ga0213876_10002063
276 Ga0213876_10003985
277 Ga0213871_10081659
278 Ga0224712_10073615
279 Ga0224712_10224090
280 Ga0209233_1018682
281 Ga0207653_10085121
282 Ga0207707_10997097
283 Ga0207660_10679362
284 Ga0207662_10712419
285 Ga0207646_10004365
286 Ga0207681_10965208
287 Ga0207700_10379447
288 Ga0207661_10287876
289 Ga0207661_11323682
290 Ga0207679_11133675
291 Ga0207712_10000586
292 Ga0207668_10045139
293 Ga0207702_10305086
294 Ga0207698_10422908
295 Ga0207428_10001994
296 Ga0268264_10834934
297 Ga0265334_10000037
298 Ga0316177_1214281
299 Ga0265777_111605
300 Ga0307408_101465758
301 Ga0307413_10703235
302 Ga0326468_10049798
303 Ga0307414_10979179
304 Ga0373935_0072697
305 Ga0395900_0422239
306 Ga0395898_0394646
307 Ga0395905_0004072
308 Ga0436364_0017288
309 Ga0436364_0448748
310 Ga0436364_0889221
311 Ga0436364_1077467
312 Ga0436364_1332466
313 Ga0436364_1333069
314 Ga0436364_1373734
315 Ga0436364_1522382
316 Ga0395901_1799888
317 Ga0436365_0370071
318 Ga0436365_0771081
319 Ga0436365_1025576
320 Ga0436365_1476151
321 Ga0436365_1812885
322 Ga0436365_1844649
323 Ga0436360_0032600
324 Ga0436360_0539333
325 Ga0436360_0683381
326 Ga0436360_1040566
327 Ga0436360_1289763
328 Ga0436360_1315200
329 Ga0436361_0190433
330 Ga0436361_0422993
331 Ga0436361_0457145
332 Ga0436361_0519623
333 Ga0436361_0645822
334 Ga0436361_0733514
335 Ga0436361_0869010
336 Ga0436361_0890332
337 Ga0436361_0926619
338 Ga0436363_0274371
339 Ga0436363_0361840
340 Ga0436363_0396465
341 Ga0436363_0930951
342 Ga0436363_1031563
343 Ga0436363_1066762
344 Ga0436363_1179018
345 Ga0436363_1265684
346 Ga0436363_1581383
347 Ga0436363_1710086
348 Ga0436362_0046395
349 Ga0436362_0055496
350 Ga0436362_0408683
351 Ga0436362_0468561
352 Ga0436362_0876626
353 Ga0436362_0946738
354 Ga0436362_0971269
355 Ga0451577_0020753
356 Ga0466965_0133285
357 Ga0453684_0021242
358 Ga0453684_0348814
359 Ga0466957_0416553
360 Ga0495608_0003961
361 Ga0495652_0366823
362 Ga0495667_0282136
363 Ga0495667_0688782
364 Ga0495599_0196411
365 Ga0495623_0335969
366 Ga0495646_0270479
367 Ga0495604_0154062
368 Ga0495636_0001001
369 Ga0495675_0218217
370 Ga0496100_0474893
371 Ga0496101_0047829
372 Ga0496104_0006010
373 Ga0496104_0937655
374 Ga0496105_0001809
375 Ga0496105_1245972
376 Ga0496108_0030874
377 Ga0496109_0448025
378 Ga0496110_0026675
379 Ga0496110_1013427
380 Ga0496111_0109909
381 Ga0496112_0018018
382 Ga0496113_0014161
383 Ga0496115_0013592
384 Ga0501306_034855
385 Ga0501293_003621
386 Ga0501295_050240
387 Ga0501296_000508
388 Ga0501298_000210
389 Ga0501299_000429
390 Ga0501032_0289411
391 Ga0501034_0002113
392 Ga0501034_0418012
393 Ga0501037_0001148
394 Ga0501037_0881272
395 Ga0501038_0009342
396 Ga0501042_0171855
397 Ga0501042_0420872
398 Ga0501043_0000345
399 Ga0501046_0000001
400 Ga0501046_0153516
401 Ga0501047_0001739
402 Ga0501047_0077523
403 Ga0501047_0864481
404 Ga0501048_0011547
405 Ga0501068_0696452
406 Ga0501070_1057213
407 Ga0501198_027356
408 Ga0501201_006539
409 Ga0501202_002859
410 Ga0501217_061084
411 Ga0501224_042037
412 Ga0501235_000790
413 Ga0501243_002361
414 Ga0501243_142886
415 Ga0501250_003384
416 Ga0501225_0015459
417 Ga0501080_0059126
418 Ga0501080_0851447
419 Ga0501083_0000001
420 Ga0501262_024426
421 Ga0501264_008345
422 Ga0501269_018766
423 Ga0501270_005728
424 Ga0501283_001019
425 Ga0501035_0219875
426 Ga0501035_0380452
427 Ga0501044_0011722
428 Ga0501044_0046965
429 Ga0501044_0187370
430 nmdc:mga0yw44_806655_c1
431 nmdc:mga05p37_841685_c1
432 nmdc:mga08y16_19681_c1
433 nmdc:mga0n895_1813296_c1
434 nmdc:mga0a205_190858_c1
435 Ga0495601_0001729
436 Ga0495595_0095175
437 Ga0495619_0253415
438 Ga0495619_0256481
439 Ga0500616_0022184
440 Ga0501084_0174297
441 Ga0587084_050425
442 Ga0587066_048355
443 Ga0587070_118238
444 Ga0587077_210690
445 Ga0587080_092203
446 Ga0587083_0143346
447 Ga0587083_0215196
448 Ga0587109_069532
449 Ga0587117_054152
450 Ga0587062_044106
451 Ga0587067_138018
452 Ga0587107_052897
453 Ga0587071_084874
454 Ga0587111_0101197
455 Ga0587111_0183354
456 Ga0466962_0739203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00177

Ribosomal_S7

Ribosomal protein S7p/S5e

2

149

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ca7-assembly1.cif.gz_G omadacycline and spectinomycin bound to the 30s ribosomal subunit head 0.9767 13 125
7nhn-assembly1.cif.gz_h vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9734 12 151
7p7u-assembly1.cif.gz_h e. faecalis 70s ribosome with p-trna, state iv 0.9652 9 153
7nhl-assembly1.cif.gz_h vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus 0.9651 12 151
8cdu-assembly1.cif.gz_H rnase r bound to a 30s degradation intermediate (main state) 0.9626 9 151
ID Description Score Start End Superfamily
5x8rg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9517 8 151 1.10.455.10
af_P48940_2_156_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9448 2 155 1.10.455.10
5mmjg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9406 3 154 1.10.455.10
1husA00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.937 10 147 1.10.455.10
1husA00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9302 10 147 1.10.455.10
ID Description Score Start End GO Terms
AF-A0A7Y2PLF6-F1-model_v4 Ribosomal protein S7 0.9851 13 147 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A2H0WRL7-F1-model_v4 30S ribosomal protein S7 0.9771 10 137 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A355GRF5-F1-model_v4 30S ribosomal protein S7 0.9745 51 144 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A2J6XAS8-F1-model_v4 30S ribosomal protein S7 0.9736 41 153 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A2J0MZE0-F1-model_v4 Small ribosomal subunit protein uS7 0.9706 11 152 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843

Map