F339055

General Info

Members Datasets Scaffolds Average Seq Length
226 149 452 101

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0001783|Ga0395899_0001783_3367_3744
Length 125
Sequence MKRQKSFSPALTYRSIINKETEIVMARSASIQNNDKRKKLVKTFSSKRKALKEKIYDKNLPLEERFGLVMKLAKLPRNSAKTRVRNRCALTGRPRGCYRRLGLSRNMFRELAGQGMLPGVVKSSW

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
88 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
89 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
90 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
113 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
136 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
137 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 3.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 4.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0001783 3300037312 Bacteria 17833
2 JGI25165J46597_1001315 3300003214 Bacteria 14050
3 rootH2_10048944 3300003320 Bacteria 1909
4 rootH2_10093439 3300003320 Bacteria 1483
5 rootH2_10168355 3300003320 Bacteria 2472
6 Ga0070658_10857372 3300005327 Bacteria 789
7 Ga0070690_100593715 3300005330 Bacteria 840
8 Ga0070670_101844696 3300005331 Bacteria 557
9 Ga0070691_10261507 3300005341 Bacteria 932
10 Ga0070661_100005946 3300005344 Bacteria 8403
11 Ga0070659_101588435 3300005366 Bacteria 584
12 Ga0070714_100273243 3300005435 Bacteria 1568
13 Ga0070713_100162144 3300005436 Bacteria 1997
14 Ga0070713_101569033 3300005436 Bacteria 639
15 Ga0070711_101326801 3300005439 Bacteria 625
16 Ga0070694_100835981 3300005444 Bacteria 757
17 Ga0070684_100312947 3300005535 Bacteria 1442
18 Ga0070695_100266207 3300005545 Bacteria 1254
19 Ga0068855_101327035 3300005563 Bacteria 744
20 Ga0068858_101287761 3300005842 Bacteria 719
21 Ga0081538_10003741 3300005981 Bacteria 14245
22 Ga0070717_10387942 3300006028 Bacteria 1253
23 Ga0097621_101929408 3300006237 Bacteria 564
24 Ga0075428_100908885 3300006844 Bacteria 934
25 Ga0075430_101593664 3300006846 Bacteria 536
26 Ga0105240_10763362 3300009093 Bacteria 1050
27 Ga0105240_12678305 3300009093 Bacteria 515
28 Ga0105245_10202856 3300009098 Bacteria 1905
29 Ga0105242_10069068 3300009176 Bacteria 2925
30 Ga0105242_12696661 3300009176 Bacteria 547
31 Ga0105248_12443525 3300009177 Bacteria 595
32 Ga0105238_10737084 3300009551 Bacteria 999
33 Ga0105239_12819734 3300010375 Bacteria 567
34 Ga0157373_10256054 3300013100 Bacteria 1238
35 Ga0157373_10845482 3300013100 Bacteria 677
36 Ga0157369_10297493 3300013105 Bacteria 1679
37 Ga0157378_10008956 3300013297 Unclassified 8713
38 Ga0157372_10007016 3300013307 Bacteria 11997
39 Ga0157372_10066383 3300013307 Bacteria 4053
40 Ga0163163_12554707 3300014325 Eukaryota 569
41 Ga0157380_12505430 3300014326 Bacteria 582
42 Ga0157376_10147364 3300014969 Bacteria 2119
43 Ga0157376_10332857 3300014969 Bacteria 1447
44 Ga0213874_10002785 3300021377 Bacteria 3804
45 Ga0213874_10006777 3300021377 Bacteria 2724
46 Ga0213876_10000421 3300021384 Bacteria 35344
47 Ga0207692_10166684 3300025898 Bacteria 1274
48 Ga0207688_10262458 3300025901 Bacteria 1048
49 Ga0207695_10551357 3300025913 Bacteria 1034
50 Ga0207695_11262508 3300025913 Bacteria 619
51 Ga0207687_10017844 3300025927 Bacteria 4682
52 Ga0207687_11918912 3300025927 Bacteria 506
53 Ga0207664_11223358 3300025929 Bacteria 669
54 Ga0207686_10037974 3300025934 Bacteria 2910
55 Ga0207702_12031562 3300026078 Bacteria 565
56 Ga0209982_1023326 3300027552 Eukaryota 957
57 Ga0265337_1034178 3300028556 Bacteria 1497
58 Ga0265319_1008011 3300028563 Bacteria 4678
59 Ga0265319_1201766 3300028563 Bacteria 610
60 Ga0265334_10053153 3300028573 Bacteria 1548
61 Ga0265318_10004788 3300028577 Bacteria 6480
62 Ga0265322_10154096 3300028654 Bacteria 657
63 Ga0265336_10078427 3300028666 Bacteria 986
64 Ga0265338_10126730 3300028800 Bacteria 2024
65 Ga0265324_10238011 3300029957 Bacteria 618
66 Ga0265330_10006774 3300031235 Bacteria 5647
67 Ga0265332_10180643 3300031238 Bacteria 879
68 Ga0265328_10059974 3300031239 Bacteria 1397
69 Ga0265320_10057577 3300031240 Bacteria 1864
70 Ga0265320_10058685 3300031240 Bacteria 1841
71 Ga0265325_10193080 3300031241 Bacteria 943
72 Ga0265325_10213204 3300031241 Bacteria 886
73 Ga0265325_10313159 3300031241 Bacteria 699
74 Ga0265329_10058829 3300031242 Bacteria 1217
75 Ga0265340_10042793 3300031247 Bacteria 2221
76 Ga0265340_10056107 3300031247 Bacteria 1895
77 Ga0265340_10539012 3300031247 Unclassified 514
78 Ga0265339_10057525 3300031249 Bacteria 2103
79 Ga0265339_10081034 3300031249 Bacteria 1716
80 Ga0265339_10366929 3300031249 Bacteria 676
81 Ga0265331_10002422 3300031250 Bacteria 12651
82 Ga0265331_10017155 3300031250 Bacteria 3782
83 Ga0265331_10036854 3300031250 Bacteria 2399
84 Ga0265316_10028793 3300031344 Bacteria 4577
85 Ga0265316_10077735 3300031344 Bacteria 2548
86 Ga0265316_10233900 3300031344 Bacteria 1352
87 Ga0265313_10004186 3300031595 Bacteria 11195
88 Ga0265313_10016556 3300031595 Bacteria 4233
89 Ga0265313_10019748 3300031595 Bacteria 3739
90 Ga0265313_10139128 3300031595 Bacteria 1045
91 Ga0265313_10425620 3300031595 Bacteria 518
92 Ga0265314_10027129 3300031711 Bacteria 4292
93 Ga0265314_10027518 3300031711 Bacteria 4257
94 Ga0265314_10062141 3300031711 Bacteria 2540
95 Ga0265314_10174454 3300031711 Bacteria 1294
96 Ga0265314_10206501 3300031711 Bacteria 1157
97 Ga0265314_10218330 3300031711 Bacteria 1114
98 Ga0265342_10006333 3300031712 Bacteria 8824
99 Ga0265342_10049147 3300031712 Bacteria 2525
100 Ga0265342_10049993 3300031712 Bacteria 2499
101 Ga0265342_10052173 3300031712 Bacteria 2438
102 Ga0316576_10025702 3300031727 Unclassified 4125
103 Ga0316578_10038018 3300031728 Unclassified 2774
104 Ga0307405_10907370 3300031731 Bacteria 746
105 Ga0307416_100276671 3300032002 Bacteria 1652
106 Ga0307416_100515390 3300032002 Unclassified 1263
107 Ga0307415_100165328 3300032126 Eukaryota 1720
108 Ga0307415_100552612 3300032126 Eukaryota 1016
109 Ga0316592_1001713 3300033524 Eukaryota 3634
110 Ga0316592_1005231 3300033524 Unclassified 2454
111 Ga0316592_1008054 3300033524 Eukaryota 2071
112 Ga0316592_1016510 3300033524 Eukaryota 1543
113 Ga0316586_1118853 3300033527 Unclassified 514
114 Ga0316588_1010425 3300033528 Eukaryota 1959
115 Ga0316588_1026013 3300033528 Eukaryota 1354
116 Ga0373936_0008097 3300035113 Bacteria 3952
117 Ga0373945_0006653 3300035116 Bacteria 3735
118 Ga0373943_0080948 3300035170 Bacteria 1665
119 Ga0373931_0290104 3300035691 Bacteria 1007
120 Ga0373935_0003403 3300035692 Bacteria 9238
121 Ga0373927_0093543 3300035695 Bacteria 1953
122 Ga0373933_0616071 3300035724 Unclassified 713
123 Ga0373947_0011709 3300035725 Bacteria 5027
124 Ga0373947_0124556 3300035725 Bacteria 1640
125 Ga0373937_0607216 3300036401 Unclassified 1038
126 Ga0373937_1572797 3300036401 Bacteria 605
127 Ga0373925_0002514 3300037068 Bacteria 14651
128 Ga0395900_0186083 3300037418 Bacteria 2108
129 Ga0395900_0302577 3300037418 Bacteria 1585
130 Ga0395901_0041541 3300038443 Bacteria 4767
131 Ga0400488_28788 3300038741 Bacteria 1065
132 Ga0400486_04379 3300038742 Bacteria 2620
133 Ga0400483_050763 3300039062 Unclassified 1238
134 Ga0400483_241217 3300039062 Eukaryota 1315
135 Ga0400487_03567 3300039110 Eukaryota 56162
136 Ga0436365_1637588 3300039437 Bacteria 49130
137 Ga0436360_0028901 3300039438 Bacteria 883
138 Ga0436363_0427400 3300039450 Bacteria 3997
139 Ga0436363_1330839 3300039450 Bacteria 585
140 Ga0436363_1470856 3300039450 Bacteria 3937
141 Ga0451839_1610991 3300041496 Bacteria 591
142 Ga0466963_0375241 3300044694 Bacteria 1002
143 Ga0466964_0136044 3300044706 Bacteria 1124
144 Ga0453684_0026762 3300044712 Bacteria 8311
145 Ga0453684_0070476 3300044712 Eukaryota 4427
146 Ga0453684_2514307 3300044712 Eukaryota 508
147 Ga0451576_0196053 3300045051 Eukaryota 2109
148 Ga0466958_0259205 3300045836 Bacteria 1113
149 Ga0466967_0059567 3300045976 Bacteria 3380
150 Ga0466967_0812956 3300045976 Bacteria 928
151 Ga0495629_0405578 3300046459 Bacteria 926
152 Ga0495580_0003736 3300046472 Bacteria 12895
153 Ga0495582_0043074 3300046473 Bacteria 2486
154 Ga0495639_0582843 3300046475 Bacteria 574
155 Ga0495665_0521960 3300046531 Bacteria 597
156 Ga0495657_0316650 3300046675 Bacteria 928
157 Ga0495658_0001492 3300046683 Bacteria 12268
158 Ga0495613_0169492 3300046689 Bacteria 1550
159 Ga0495674_0110175 3300047319 Bacteria 2335
160 Ga0495675_0304620 3300047444 Bacteria 946
161 Ga0495602_0814233 3300048088 Bacteria 626
162 Ga0501291_116555 3300049514 Bacteria 575
163 Ga0501298_035298 3300049521 Bacteria 997
164 Ga0501031_0094198 3300049568 Bacteria 1954
165 Ga0501032_0030051 3300049569 Bacteria 3727
166 Ga0501033_0141890 3300049570 Bacteria 1736
167 Ga0501034_0076809 3300049571 Bacteria 3346
168 Ga0501036_0009536 3300049572 Bacteria 7983
169 Ga0501036_1006234 3300049572 Bacteria 682
170 Ga0501036_1494837 3300049572 Bacteria 546
171 Ga0501037_0267029 3300049573 Bacteria 1195
172 Ga0501038_0560080 3300049574 Bacteria 868
173 Ga0501039_0168128 3300049575 Bacteria 1724
174 Ga0501039_0493272 3300049575 Bacteria 962
175 Ga0501042_0273066 3300049578 Bacteria 1221
176 Ga0501043_0685434 3300049579 Bacteria 750
177 Ga0501046_0711158 3300049580 Bacteria 707
178 Ga0501047_0025996 3300049581 Bacteria 5629
179 Ga0501047_0075405 3300049581 Bacteria 3245
180 Ga0501047_0267162 3300049581 Bacteria 1557
181 Ga0501047_0502068 3300049581 Bacteria 1040
182 Ga0501048_0124442 3300049582 Bacteria 1823
183 Ga0501067_0005350 3300049583 Bacteria 7126
184 Ga0501067_0005578 3300049583 Bacteria 6979
185 Ga0501069_0439375 3300049585 Bacteria 775
186 Ga0501070_0000481 3300049586 Bacteria 36249
187 Ga0501070_0003398 3300049586 Bacteria 13819
188 Ga0501070_0031071 3300049586 Bacteria 4473
189 Ga0501072_0015507 3300049588 Bacteria 5840
190 Ga0501073_0004494 3300049589 Bacteria 10476
191 Ga0501073_0015128 3300049589 Bacteria 5597
192 Ga0501074_0042382 3300049590 Bacteria 3293
193 Ga0501074_0172806 3300049590 Bacteria 1542
194 Ga0501074_0382006 3300049590 Bacteria 999
195 Ga0501074_0759005 3300049590 Bacteria 684
196 Ga0501075_0575858 3300049591 Bacteria 859
197 Ga0501077_0801341 3300049593 Bacteria 606
198 Ga0501198_070080 3300049649 Bacteria 660
199 Ga0501198_096075 3300049649 Bacteria 594
200 Ga0501261_127587 3300049690 Bacteria 510
201 Ga0501219_012224 3300049703 Bacteria 663
202 Ga0501079_0017836 3300049741 Bacteria 5421
203 Ga0501079_0188192 3300049741 Bacteria 1611
204 Ga0501080_0006960 3300049742 Bacteria 10202
205 Ga0501080_0018079 3300049742 Bacteria 6526
206 Ga0501080_0062400 3300049742 Bacteria 3468
207 Ga0501081_1494682 3300049743 Bacteria 513
208 Ga0501083_0733476 3300049744 Unclassified 643
209 Ga0501035_0037025 3300049822 Bacteria 4420
210 Ga0501035_0186281 3300049822 Bacteria 1786
211 Ga0501044_0032329 3300049823 Bacteria 5501
212 Ga0501044_0187794 3300049823 Bacteria 2030
213 Ga0501044_0265916 3300049823 Bacteria 1652
214 Ga0501044_0572541 3300049823 Bacteria 1024
215 Ga0501044_0820153 3300049823 Bacteria 808
216 nmdc:mga09592_789047_c1 3300050508 Bacteria 804
217 nmdc:mga0qj67_734278_c1 3300050509 Bacteria 784
218 Ga0495619_0715723 3300053085 Bacteria 680
219 Ga0501084_0029906 3300054114 Bacteria 4556
220 Ga0501084_0048815 3300054114 Bacteria 3543
221 Ga0501084_0595352 3300054114 Bacteria 934
222 Ga0501084_1685262 3300054114 Bacteria 530
223 Ga0501082_0107936 3300060353 Bacteria 2409
224 Ga0501082_1181191 3300060353 Bacteria 669
225 Ga0530510_0169326 3300061734 Bacteria 1618
226 Ga0530510_1411876 3300061734 Bacteria 534
227 Ga0395899_0001783
228 JGI25165J46597_1001315
229 rootH2_10048944
230 rootH2_10093439
231 rootH2_10168355
232 Ga0070658_10857372
233 Ga0070690_100593715
234 Ga0070670_101844696
235 Ga0070691_10261507
236 Ga0070661_100005946
237 Ga0070659_101588435
238 Ga0070714_100273243
239 Ga0070713_100162144
240 Ga0070713_101569033
241 Ga0070711_101326801
242 Ga0070694_100835981
243 Ga0070684_100312947
244 Ga0070695_100266207
245 Ga0068855_101327035
246 Ga0068858_101287761
247 Ga0081538_10003741
248 Ga0070717_10387942
249 Ga0097621_101929408
250 Ga0075428_100908885
251 Ga0075430_101593664
252 Ga0105240_10763362
253 Ga0105240_12678305
254 Ga0105245_10202856
255 Ga0105242_10069068
256 Ga0105242_12696661
257 Ga0105248_12443525
258 Ga0105238_10737084
259 Ga0105239_12819734
260 Ga0157373_10256054
261 Ga0157373_10845482
262 Ga0157369_10297493
263 Ga0157378_10008956
264 Ga0157372_10007016
265 Ga0157372_10066383
266 Ga0163163_12554707
267 Ga0157380_12505430
268 Ga0157376_10147364
269 Ga0157376_10332857
270 Ga0213874_10002785
271 Ga0213874_10006777
272 Ga0213876_10000421
273 Ga0207692_10166684
274 Ga0207688_10262458
275 Ga0207695_10551357
276 Ga0207695_11262508
277 Ga0207687_10017844
278 Ga0207687_11918912
279 Ga0207664_11223358
280 Ga0207686_10037974
281 Ga0207702_12031562
282 Ga0209982_1023326
283 Ga0265337_1034178
284 Ga0265319_1008011
285 Ga0265319_1201766
286 Ga0265334_10053153
287 Ga0265318_10004788
288 Ga0265322_10154096
289 Ga0265336_10078427
290 Ga0265338_10126730
291 Ga0265324_10238011
292 Ga0265330_10006774
293 Ga0265332_10180643
294 Ga0265328_10059974
295 Ga0265320_10057577
296 Ga0265320_10058685
297 Ga0265325_10193080
298 Ga0265325_10213204
299 Ga0265325_10313159
300 Ga0265329_10058829
301 Ga0265340_10042793
302 Ga0265340_10056107
303 Ga0265340_10539012
304 Ga0265339_10057525
305 Ga0265339_10081034
306 Ga0265339_10366929
307 Ga0265331_10002422
308 Ga0265331_10017155
309 Ga0265331_10036854
310 Ga0265316_10028793
311 Ga0265316_10077735
312 Ga0265316_10233900
313 Ga0265313_10004186
314 Ga0265313_10016556
315 Ga0265313_10019748
316 Ga0265313_10139128
317 Ga0265313_10425620
318 Ga0265314_10027129
319 Ga0265314_10027518
320 Ga0265314_10062141
321 Ga0265314_10174454
322 Ga0265314_10206501
323 Ga0265314_10218330
324 Ga0265342_10006333
325 Ga0265342_10049147
326 Ga0265342_10049993
327 Ga0265342_10052173
328 Ga0316576_10025702
329 Ga0316578_10038018
330 Ga0307405_10907370
331 Ga0307416_100276671
332 Ga0307416_100515390
333 Ga0307415_100165328
334 Ga0307415_100552612
335 Ga0316592_1001713
336 Ga0316592_1005231
337 Ga0316592_1008054
338 Ga0316592_1016510
339 Ga0316586_1118853
340 Ga0316588_1010425
341 Ga0316588_1026013
342 Ga0373936_0008097
343 Ga0373945_0006653
344 Ga0373943_0080948
345 Ga0373931_0290104
346 Ga0373935_0003403
347 Ga0373927_0093543
348 Ga0373933_0616071
349 Ga0373947_0011709
350 Ga0373947_0124556
351 Ga0373937_0607216
352 Ga0373937_1572797
353 Ga0373925_0002514
354 Ga0395900_0186083
355 Ga0395900_0302577
356 Ga0395901_0041541
357 Ga0400488_28788
358 Ga0400486_04379
359 Ga0400483_050763
360 Ga0400483_241217
361 Ga0400487_03567
362 Ga0436365_1637588
363 Ga0436360_0028901
364 Ga0436363_0427400
365 Ga0436363_1330839
366 Ga0436363_1470856
367 Ga0451839_1610991
368 Ga0466963_0375241
369 Ga0466964_0136044
370 Ga0453684_0026762
371 Ga0453684_0070476
372 Ga0453684_2514307
373 Ga0451576_0196053
374 Ga0466958_0259205
375 Ga0466967_0059567
376 Ga0466967_0812956
377 Ga0495629_0405578
378 Ga0495580_0003736
379 Ga0495582_0043074
380 Ga0495639_0582843
381 Ga0495665_0521960
382 Ga0495657_0316650
383 Ga0495658_0001492
384 Ga0495613_0169492
385 Ga0495674_0110175
386 Ga0495675_0304620
387 Ga0495602_0814233
388 Ga0501291_116555
389 Ga0501298_035298
390 Ga0501031_0094198
391 Ga0501032_0030051
392 Ga0501033_0141890
393 Ga0501034_0076809
394 Ga0501036_0009536
395 Ga0501036_1006234
396 Ga0501036_1494837
397 Ga0501037_0267029
398 Ga0501038_0560080
399 Ga0501039_0168128
400 Ga0501039_0493272
401 Ga0501042_0273066
402 Ga0501043_0685434
403 Ga0501046_0711158
404 Ga0501047_0025996
405 Ga0501047_0075405
406 Ga0501047_0267162
407 Ga0501047_0502068
408 Ga0501048_0124442
409 Ga0501067_0005350
410 Ga0501067_0005578
411 Ga0501069_0439375
412 Ga0501070_0000481
413 Ga0501070_0003398
414 Ga0501070_0031071
415 Ga0501072_0015507
416 Ga0501073_0004494
417 Ga0501073_0015128
418 Ga0501074_0042382
419 Ga0501074_0172806
420 Ga0501074_0382006
421 Ga0501074_0759005
422 Ga0501075_0575858
423 Ga0501077_0801341
424 Ga0501198_070080
425 Ga0501198_096075
426 Ga0501261_127587
427 Ga0501219_012224
428 Ga0501079_0017836
429 Ga0501079_0188192
430 Ga0501080_0006960
431 Ga0501080_0018079
432 Ga0501080_0062400
433 Ga0501081_1494682
434 Ga0501083_0733476
435 Ga0501035_0037025
436 Ga0501035_0186281
437 Ga0501044_0032329
438 Ga0501044_0187794
439 Ga0501044_0265916
440 Ga0501044_0572541
441 Ga0501044_0820153
442 nmdc:mga09592_789047_c1
443 nmdc:mga0qj67_734278_c1
444 Ga0495619_0715723
445 Ga0501084_0029906
446 Ga0501084_0048815
447 Ga0501084_0595352
448 Ga0501084_1685262
449 Ga0501082_0107936
450 Ga0501082_1181191
451 Ga0530510_0169326
452 Ga0530510_1411876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

71

124

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ywy-assembly1.cif.gz_NN the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.8726 7 101
5mrc-assembly1.cif.gz_NN structure of the yeast mitochondrial ribosome - class a 0.8681 6 101
7pnu-assembly1.cif.gz_K assembly intermediate of mouse mitochondrial ribosome small subunit without ms37 in complex with rbfa inward conformation 0.864 7 101
8any-assembly1.cif.gz_AK human mitochondrial ribosome in complex with lrpprc, slirp, a-site, p-site, e-site trnas and mrna 0.8636 7 101
7nql-assembly1.cif.gz_AN 55s mammalian mitochondrial ribosome with ict1 and p site trnamet 0.8593 7 101
ID Description Score Start End Superfamily
af_K7K3I6_14_100_3.30.260.10 Alpha Beta;2-Layer Sandwich;GROEL; domain 2;TCP-1-like chaperonin intermediate domain 0.952 24 51 3.30.260.10
af_Q5AJZ7_16_105_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9371 6 91 1.10.287.1480
af_M1FQJ9_1_90_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9172 1 91 1.10.287.1480
af_O42859_6_94_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9131 6 89 1.10.287.1480
af_M1FQJ9_1_90_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9078 1 91 1.10.287.1480
ID Description Score Start End GO Terms
AF-A0A498MQB2-F1-model_v4 Calcyclin-binding protein 0.9884 7 63 GO:0005634
GO:0005737
GO:0007507
GO:0015631
GO:0031625
GO:0044548
AF-A0A229YYJ9-F1-model_v4 Arb2 domain-containing protein 0.9808 6 81 GO:0003735
GO:0005634
GO:0005840
GO:0006412
GO:0031048
GO:0035197
GO:1990904
AF-A0A559LY09-F1-model_v4 37S ribosomal protein, mitochondrial 0.9806 25 81 GO:0003735
GO:0005763
GO:0006412
AF-A0A425BPZ2-F1-model_v4 deleted 0.9799 7 81
AF-A0A2R7S599-F1-model_v4 deleted 0.9771 1 61

Map