F338988

General Info

Members Datasets Scaffolds Average Seq Length
226 159 220 178

Family's Representative Sequence

Representative Sequence 3300030522|Ga0307512_10024327|Ga0307512_100243274
Length 204
Sequence MTFTSRLATRQDLPVLAPLIENAITELQKGFLDPGQIDSSRAIMGIDTQLIDDGTYFVVEAVEEGGAVDAGGRIAGCGGWSRRKTLYGGDHSAGRDHALLDPATDPAKIRAMYTDPAFARRGVGRLILSLCETAAIEEGFTTLELMSTLAGQPLYRAAGYHPVEHLTEAAGGAPVPLVRMRKRLSRERPAPLRRTGASRPGRSG

Samples

Sample ID Description Type Environment
1 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
2 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
3 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
4 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
152 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
153 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
154 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
155 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
158 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
159 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 0
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.27
Nodule 0.44
Rhizoplane 6.19
Rhizosphere 70.35
Stem 0
Stem Tuber 0
Unclassified 9.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10061521 3300003203 Unclassified 1210
2 JGI25153J46596_10047608 3300003215 Bacteria 1260
3 Ga0055531_10001025 3300003794 Bacteria 22117
4 Ga0055543_1011846 3300004625 Bacteria 1770
5 Ga0065165_1000029 3300005262 Bacteria 220342
6 Ga0070683_100701882 3300005329 Bacteria 969
7 Ga0070680_100007357 3300005336 Bacteria 8403
8 Ga0070680_100153525 3300005336 Bacteria 1934
9 Ga0070660_100220746 3300005339 Bacteria 1540
10 Ga0070660_100541796 3300005339 Bacteria 970
11 Ga0070691_10004855 3300005341 Bacteria 6122
12 Ga0070671_100354969 3300005355 Bacteria 1252
13 Ga0070671_100560118 3300005355 Bacteria 986
14 Ga0070671_100741283 3300005355 Bacteria 853
15 Ga0070674_100032510 3300005356 Bacteria 3464
16 Ga0070659_100002459 3300005366 Bacteria 13170
17 Ga0070667_100882190 3300005367 Bacteria 832
18 Ga0070708_100042067 3300005445 Bacteria 4008
19 Ga0070708_100420942 3300005445 Bacteria 1260
20 Ga0070662_100269585 3300005457 Bacteria 1374
21 Ga0070681_10016259 3300005458 Bacteria 7423
22 Ga0070681_10057013 3300005458 Bacteria 3887
23 Ga0070706_100013193 3300005467 Bacteria 7645
24 Ga0070707_100391551 3300005468 Bacteria 1349
25 Ga0070698_100050586 3300005471 Bacteria 4235
26 Ga0070699_100083296 3300005518 Bacteria 2789
27 Ga0070699_100114749 3300005518 Bacteria 2366
28 Ga0070679_100140140 3300005530 Bacteria 2398
29 Ga0070679_100157657 3300005530 Bacteria 2244
30 Ga0070697_100048360 3300005536 Bacteria 3448
31 Ga0068853_100112540 3300005539 Bacteria 2419
32 Ga0068853_100557304 3300005539 Bacteria 1086
33 Ga0070665_100000176 3300005548 Bacteria 113398
34 Ga0070665_100140166 3300005548 Bacteria 2421
35 Ga0068855_100026229 3300005563 Bacteria 6972
36 Ga0068855_100620324 3300005563 Bacteria 1164
37 Ga0068855_101104269 3300005563 Bacteria 829
38 Ga0070664_100839483 3300005564 Bacteria 860
39 Ga0070664_100841900 3300005564 Bacteria 859
40 Ga0068854_100113958 3300005578 Bacteria 2043
41 Ga0068856_100649110 3300005614 Bacteria 1076
42 Ga0068852_100761090 3300005616 Bacteria 981
43 Ga0068852_101340360 3300005616 Bacteria 737
44 Ga0068864_100025496 3300005618 Bacteria 4980
45 Ga0068851_10290634 3300005834 Bacteria 937
46 Ga0068863_100271211 3300005841 Bacteria 1642
47 Ga0068858_100946942 3300005842 Bacteria 843
48 Ga0068862_100987251 3300005844 Bacteria 832
49 Ga0081539_10000973 3300005985 Bacteria 53526
50 Ga0070717_10025113 3300006028 Bacteria 4733
51 Ga0075368_10002608 3300006042 Bacteria 5912
52 Ga0075368_10003519 3300006042 Bacteria 5241
53 Ga0075364_10000128 3300006051 Bacteria 31758
54 Ga0075362_10050687 3300006177 Bacteria 1856
55 Ga0075367_10010738 3300006178 Bacteria 4822
56 Ga0075369_10096701 3300006186 Bacteria 1322
57 Ga0075366_10242634 3300006195 Bacteria 1098
58 Ga0075370_10121239 3300006353 Bacteria 1522
59 Ga0075430_100042985 3300006846 Bacteria 3820
60 Ga0075431_101333065 3300006847 Bacteria 678
61 Ga0075429_100136242 3300006880 Bacteria 2149
62 Ga0075429_100768115 3300006880 Bacteria 844
63 Ga0105240_10020395 3300009093 Bacteria 8843
64 Ga0105240_10108843 3300009093 Bacteria 3357
65 Ga0105240_10527982 3300009093 Bacteria 1309
66 Ga0114129_10361954 3300009147 Unclassified 1919
67 Ga0114129_10512572 3300009147 Bacteria 1565
68 Ga0105238_10023790 3300009551 Bacteria 6244
69 Ga0105238_10131178 3300009551 Bacteria 2484
70 Ga0105238_10214180 3300009551 Bacteria 1903
71 Ga0105238_10778868 3300009551 Bacteria 971
72 Ga0105030_112147 3300009987 Unclassified 748
73 Ga0105239_10051552 3300010375 Bacteria 4511
74 Ga0105239_11372519 3300010375 Bacteria 816
75 Ga0163162_10069825 3300013306 Bacteria 3565
76 Ga0157375_10431152 3300013308 Bacteria 1484
77 Ga0163163_10025449 3300014325 Bacteria 5642
78 Ga0163163_10364234 3300014325 Bacteria 1502
79 Ga0209026_1000876 3300025250 Bacteria 15669
80 Ga0209758_1000401 3300025297 Bacteria 74599
81 Ga0209050_1000031 3300025298 Bacteria 458181
82 Ga0209257_1000073 3300025304 Bacteria 325833
83 Ga0207642_10253432 3300025899 Bacteria 1000
84 Ga0207705_10025685 3300025909 Bacteria 4202
85 Ga0207705_10260329 3300025909 Bacteria 1324
86 Ga0207684_10085847 3300025910 Bacteria 2680
87 Ga0207707_10017874 3300025912 Bacteria 6182
88 Ga0207707_10038157 3300025912 Bacteria 4198
89 Ga0207707_10136989 3300025912 Bacteria 2140
90 Ga0207695_10000984 3300025913 Bacteria 50625
91 Ga0207695_10004242 3300025913 Bacteria 19698
92 Ga0207695_10231622 3300025913 Bacteria 1751
93 Ga0207660_10021279 3300025917 Bacteria 4360
94 Ga0207660_10165971 3300025917 Bacteria 1706
95 Ga0207657_10004142 3300025919 Bacteria 15371
96 Ga0207657_10094513 3300025919 Bacteria 2489
97 Ga0207652_10164476 3300025921 Bacteria 1989
98 Ga0207646_10050522 3300025922 Unclassified 3721
99 Ga0207694_10012045 3300025924 Bacteria 6520
100 Ga0207694_10162938 3300025924 Bacteria 1802
101 Ga0207694_10796214 3300025924 Bacteria 798
102 Ga0207644_10092355 3300025931 Bacteria 2258
103 Ga0207644_10186066 3300025931 Bacteria 1631
104 Ga0207644_10303023 3300025931 Bacteria 1288
105 Ga0207706_10362480 3300025933 Bacteria 1259
106 Ga0207686_10292474 3300025934 Bacteria 1207
107 Ga0207669_10601791 3300025937 Bacteria 893
108 Ga0207704_10038026 3300025938 Bacteria 2786
109 Ga0207711_10012039 3300025941 Bacteria 7191
110 Ga0207679_10776352 3300025945 Bacteria 873
111 Ga0207667_10100262 3300025949 Bacteria 2987
112 Ga0207667_10579063 3300025949 Bacteria 1133
113 Ga0207640_10103385 3300025981 Bacteria 2003
114 Ga0207658_10340218 3300025986 Bacteria 1304
115 Ga0207639_10012119 3300026041 Bacteria 5999
116 Ga0207639_10524646 3300026041 Bacteria 1085
117 Ga0207678_11451850 3300026067 Bacteria 606
118 Ga0207702_10650279 3300026078 Bacteria 1037
119 Ga0207641_10054979 3300026088 Bacteria 3380
120 Ga0207676_10140969 3300026095 Bacteria 2063
121 Ga0209813_10002735 3300027866 Bacteria 4067
122 Ga0268266_10000005 3300028379 Bacteria 1448194
123 Ga0268266_10125951 3300028379 Bacteria 2286
124 Ga0307517_10006727 3300028786 Bacteria 16923
125 Ga0307517_10131563 3300028786 Bacteria 1799
126 Ga0307515_10013486 3300028794 Bacteria 15269
127 Ga0307515_10018426 3300028794 Bacteria 12635
128 Ga0307511_10006178 3300030521 Bacteria 12086
129 Ga0307512_10024327 3300030522 Bacteria 5390
130 Ga0265327_10061152 3300031251 Bacteria 1923
131 Ga0307513_10000615 3300031456 Bacteria 50932
132 Ga0307513_10014979 3300031456 Bacteria 9418
133 Ga0307513_10015028 3300031456 Bacteria 9399
134 Ga0307408_100219427 3300031548 Bacteria 1551
135 Ga0307508_10028021 3300031616 Bacteria 5096
136 Ga0307516_10000268 3300031730 Bacteria 66758
137 Ga0307516_10271910 3300031730 Bacteria 1380
138 Ga0307405_10203196 3300031731 Unclassified 1440
139 Ga0307410_10891521 3300031852 Bacteria 761
140 Ga0307410_11147905 3300031852 Bacteria 675
141 Ga0307406_10001055 3300031901 Bacteria 15360
142 Ga0307406_10585786 3300031901 Bacteria 918
143 Ga0307407_10003907 3300031903 Bacteria 6222
144 Ga0307409_100001673 3300031995 Bacteria 11155
145 Ga0307409_100282898 3300031995 Unclassified 1534
146 Ga0307409_100358750 3300031995 Bacteria 1378
147 Ga0307416_100000220 3300032002 Bacteria 30200
148 Ga0307414_10446046 3300032004 Bacteria 1134
149 Ga0307411_10255713 3300032005 Bacteria 1380
150 Ga0307411_10695378 3300032005 Bacteria 885
151 Ga0307415_100000053 3300032126 Bacteria 49897
152 Ga0307510_10009365 3300033180 Bacteria 11666
153 Ga0373936_0001582 3300035113 Bacteria 8308
154 Ga0395900_0000010 3300037418 Bacteria 461364
155 Ga0395900_0282158 3300037418 Bacteria 1652
156 Ga0395898_0066796 3300037466 Bacteria 3482
157 Ga0395905_0059371 3300037471 Bacteria 3575
158 Ga0395905_0089775 3300037471 Bacteria 2880
159 Ga0395905_0477611 3300037471 Bacteria 1146
160 Ga0395905_0536599 3300037471 Bacteria 1071
161 Ga0395901_0000007 3300038443 Bacteria 497408
162 Ga0395901_0042261 3300038443 Bacteria 4725
163 Ga0395901_0764428 3300038443 Bacteria 958
164 Ga0237819_00447 3300038705 Bacteria 14029
165 Ga0451837_1765454 3300041494 Bacteria 1953
166 Ga0439437_035838 3300042000 Bacteria 634
167 Ga0466960_0143515 3300044901 Unclassified 1270
168 Ga0495583_0029145 3300046506 Bacteria 2704
169 Ga0495630_0056264 3300046517 Bacteria 2948
170 Ga0495642_0115239 3300046528 Bacteria 1151
171 Ga0495586_0659706 3300046535 Bacteria 604
172 Ga0495645_0052091 3300046543 Bacteria 2978
173 Ga0495668_0073758 3300046616 Bacteria 1874
174 Ga0495668_0085589 3300046616 Bacteria 1729
175 Ga0495668_0207948 3300046616 Bacteria 1071
176 Ga0495611_0038640 3300046648 Bacteria 2123
177 Ga0495625_0483071 3300046660 Bacteria 760
178 Ga0495599_0403135 3300046678 Bacteria 814
179 Ga0495672_0249114 3300047320 Bacteria 863
180 Ga0495676_0622632 3300047321 Bacteria 702
181 Ga0495685_040469 3300047447 Bacteria 1594
182 Ga0496101_1014400 3300048904 Bacteria 652
183 Ga0496102_0078256 3300048905 Bacteria 3044
184 Ga0496103_0109484 3300048906 Bacteria 1754
185 Ga0496107_0341421 3300048910 Bacteria 1114
186 Ga0496108_0509108 3300048911 Bacteria 1051
187 Ga0496110_0275244 3300048913 Bacteria 1533
188 Ga0496112_0005208 3300048915 Bacteria 11189
189 Ga0496112_0006386 3300048915 Bacteria 10349
190 Ga0496112_0135421 3300048915 Bacteria 2434
191 Ga0496113_0243151 3300048916 Bacteria 1436
192 Ga0496113_0296908 3300048916 Unclassified 1293
193 Ga0496115_0001979 3300048918 Bacteria 14630
194 Ga0496115_0014035 3300048918 Bacteria 6064
195 Ga0496115_0235841 3300048918 Bacteria 1508
196 Ga0496121_0005248 3300048924 Bacteria 16759
197 Ga0501047_0008801 3300049581 Bacteria 9524
198 Ga0501076_1169412 3300049592 Bacteria 633
199 Ga0501081_0249827 3300049743 Bacteria 1295
200 Ga0501035_0943487 3300049822 Bacteria 681
201 nmdc:mga00v17_465850_c1 3300050491 Unclassified 820
202 nmdc:mga00v17_6711_c1 3300050491 Bacteria 6116
203 nmdc:mga06z11_458520_c1 3300050494 Bacteria 771
204 nmdc:mga04h51_5046_c1 3300050495 Bacteria 1250
205 nmdc:mga04h51_8128_c1 3300050495 Bacteria 2799
206 nmdc:mga07m45_161477_c2 3300050496 Bacteria 930
207 nmdc:mga07m45_51244_c1 3300050496 Bacteria 2328
208 nmdc:mga05p37_1703108_c1 3300050507 Bacteria 614
209 nmdc:mga05p37_431018_c1 3300050507 Bacteria 1532
210 nmdc:mga05p37_674070_c1 3300050507 Bacteria 1154
211 nmdc:mga09592_705371_c1 3300050508 Bacteria 858
212 nmdc:mga09592_88594_c1 3300050508 Bacteria 2643
213 nmdc:mga0qj67_886431_c1 3300050509 Unclassified 703
214 nmdc:mga0sz30_5994_c2 3300050516 Bacteria 2854
215 Ga0500641_0073249 3300053096 Bacteria 1445
216 Ga0500650_0155641 3300053098 Bacteria 1055
217 Ga0500554_021496 3300053102 Bacteria 1790
218 Ga0500594_0003744 3300053118 Bacteria 3351
219 Ga0500595_090551 3300053119 Bacteria 885
220 Ga0500652_034716 3300053131 Bacteria 1999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003215 JGI25153J46596_10047608 JGI25153J46596_100476082 156
2 3300003794 Ga0055531_10001025 Ga0055531_100010251 156
3 3300004625 Ga0055543_1011846 Ga0055543_10118463 156
4 3300005262 Ga0065165_1000029 Ga0065165_1000029212 156
5 3300005548 Ga0070665_100140166 Ga0070665_1001401662 156
6 3300005563 Ga0068855_101104269 Ga0068855_1011042692 156
7 3300006880 Ga0075429_100136242 Ga0075429_1001362422 156
8 3300009093 Ga0105240_10527982 Ga0105240_105279822 156
9 3300009147 Ga0114129_10361954 Ga0114129_103619543 156
10 3300009551 Ga0105238_10131178 Ga0105238_101311782 156
11 3300013308 Ga0157375_10431152 Ga0157375_104311521 156
12 3300025297 Ga0209758_1000401 Ga0209758_100040121 156
13 3300025298 Ga0209050_1000031 Ga0209050_1000031189 156
14 3300025304 Ga0209257_1000073 Ga0209257_1000073191 156
15 3300025899 Ga0207642_10253432 Ga0207642_102534321 156
16 3300025924 Ga0207694_10162938 Ga0207694_101629382 156
17 3300025938 Ga0207704_10038026 Ga0207704_100380262 156
18 3300025941 Ga0207711_10012039 Ga0207711_100120392 156
19 3300028379 Ga0268266_10125951 Ga0268266_101259512 156
20 3300028794 Ga0307515_10018426 Ga0307515_100184265 156
21 3300031456 Ga0307513_10014979 Ga0307513_100149795 156
22 3300031730 Ga0307516_10000268 Ga0307516_100002683 156
23 3300031852 Ga0307410_11147905 Ga0307410_111479051 156
24 3300032005 Ga0307411_10255713 Ga0307411_102557132 156
25 3300037471 Ga0395905_0477611 Ga0395905_0477611_459_992 156
26 3300046616 Ga0495668_0073758 Ga0495668_0073758_391_933 156
27 3300046616 Ga0495668_0085589 Ga0495668_0085589_54_581 156
28 3300047320 Ga0495672_0249114 Ga0495672_0249114_377_847 156
29 3300049581 Ga0501047_0008801 Ga0501047_0008801_2703_3173 156
30 3300049592 Ga0501076_1169412 Ga0501076_1169412_59_580 156
31 3300050507 nmdc:mga05p37_674070_c1 nmdc:mga05p37_674070_c1_94_630 156
32 3300050508 nmdc:mga09592_88594_c1 nmdc:mga09592_88594_c1_1705_2241 156
33 3300050509 nmdc:mga0qj67_886431_c1 nmdc:mga0qj67_886431_c1_32_568 156
34 3300053131 Ga0500652_034716 Ga0500652_034716_473_1036 156
35 iso_pu_bacteria 2643221663 2644354056 156
36 3300005329 Ga0070683_100701882 Ga0070683_1007018821 157
37 3300005336 Ga0070680_100007357 Ga0070680_1000073577 157
38 3300005336 Ga0070680_100153525 Ga0070680_1001535252 157
39 3300005339 Ga0070660_100220746 Ga0070660_1002207462 157
40 3300005339 Ga0070660_100541796 Ga0070660_1005417961 157
41 3300005341 Ga0070691_10004855 Ga0070691_100048552 157
42 3300005355 Ga0070671_100354969 Ga0070671_1003549692 157
43 3300005355 Ga0070671_100741283 Ga0070671_1007412832 157
44 3300005366 Ga0070659_100002459 Ga0070659_1000024593 157
45 3300005367 Ga0070667_100882190 Ga0070667_1008821901 157
46 3300005457 Ga0070662_100269585 Ga0070662_1002695852 157
47 3300005458 Ga0070681_10016259 Ga0070681_100162592 157
48 3300005530 Ga0070679_100140140 Ga0070679_1001401402 157
49 3300005530 Ga0070679_100157657 Ga0070679_1001576572 157
50 3300005539 Ga0068853_100112540 Ga0068853_1001125402 157
51 3300005539 Ga0068853_100557304 Ga0068853_1005573042 157
52 3300005548 Ga0070665_100000176 Ga0070665_10000017621 157
53 3300005563 Ga0068855_100026229 Ga0068855_1000262292 157
54 3300005563 Ga0068855_100620324 Ga0068855_1006203242 157
55 3300005564 Ga0070664_100839483 Ga0070664_1008394832 157
56 3300005614 Ga0068856_100649110 Ga0068856_1006491102 157
57 3300005616 Ga0068852_100761090 Ga0068852_1007610902 157
58 3300005618 Ga0068864_100025496 Ga0068864_1000254965 157
59 3300005834 Ga0068851_10290634 Ga0068851_102906341 157
60 3300005841 Ga0068863_100271211 Ga0068863_1002712112 157
61 3300005842 Ga0068858_100946942 Ga0068858_1009469422 157
62 3300006028 Ga0070717_10025113 Ga0070717_100251132 157
63 3300006042 Ga0075368_10002608 Ga0075368_100026081 157
64 3300006042 Ga0075368_10003519 Ga0075368_100035196 157
65 3300006051 Ga0075364_10000128 Ga0075364_100001284 157
66 3300006177 Ga0075362_10050687 Ga0075362_100506872 157
67 3300006178 Ga0075367_10010738 Ga0075367_100107382 157
68 3300006186 Ga0075369_10096701 Ga0075369_100967012 157
69 3300006195 Ga0075366_10242634 Ga0075366_102426342 157
70 3300006353 Ga0075370_10121239 Ga0075370_101212392 157
71 3300009093 Ga0105240_10020395 Ga0105240_100203953 157
72 3300009551 Ga0105238_10023790 Ga0105238_100237905 157
73 3300009551 Ga0105238_10214180 Ga0105238_102141802 157
74 3300009551 Ga0105238_10778868 Ga0105238_107788682 157
75 3300010375 Ga0105239_11372519 Ga0105239_113725191 157
76 3300013306 Ga0163162_10069825 Ga0163162_100698252 157
77 3300014325 Ga0163163_10364234 Ga0163163_103642342 157
78 3300025909 Ga0207705_10025685 Ga0207705_100256851 157
79 3300025909 Ga0207705_10260329 Ga0207705_102603291 157
80 3300025912 Ga0207707_10017874 Ga0207707_100178745 157
81 3300025912 Ga0207707_10136989 Ga0207707_101369892 157
82 3300025913 Ga0207695_10000984 Ga0207695_100009844 157
83 3300025913 Ga0207695_10004242 Ga0207695_100042425 157
84 3300025917 Ga0207660_10021279 Ga0207660_100212791 157
85 3300025917 Ga0207660_10165971 Ga0207660_101659712 157
86 3300025919 Ga0207657_10004142 Ga0207657_1000414211 157
87 3300025919 Ga0207657_10094513 Ga0207657_100945132 157
88 3300025921 Ga0207652_10164476 Ga0207652_101644762 157
89 3300025924 Ga0207694_10012045 Ga0207694_100120455 157
90 3300025924 Ga0207694_10796214 Ga0207694_107962141 157
91 3300025931 Ga0207644_10092355 Ga0207644_100923552 157
92 3300025933 Ga0207706_10362480 Ga0207706_103624802 157
93 3300025945 Ga0207679_10776352 Ga0207679_107763522 157
94 3300025949 Ga0207667_10100262 Ga0207667_101002622 157
95 3300025949 Ga0207667_10579063 Ga0207667_105790632 157
96 3300025986 Ga0207658_10340218 Ga0207658_103402182 157
97 3300026041 Ga0207639_10012119 Ga0207639_100121192 157
98 3300026041 Ga0207639_10524646 Ga0207639_105246462 157
99 3300026067 Ga0207678_11451850 Ga0207678_114518501 157
100 3300026078 Ga0207702_10650279 Ga0207702_106502792 157
101 3300026088 Ga0207641_10054979 Ga0207641_100549793 157
102 3300026095 Ga0207676_10140969 Ga0207676_101409692 157
103 3300027866 Ga0209813_10002735 Ga0209813_100027353 157
104 3300028379 Ga0268266_10000005 Ga0268266_100000051225 157
105 3300028786 Ga0307517_10006727 Ga0307517_100067272 157
106 3300031852 Ga0307410_10891521 Ga0307410_108915211 157
107 3300031995 Ga0307409_100358750 Ga0307409_1003587502 157
108 3300032005 Ga0307411_10695378 Ga0307411_106953782 157
109 3300033180 Ga0307510_10009365 Ga0307510_100093654 157
110 3300035113 Ga0373936_0001582 Ga0373936_0001582_6049_6582 157
111 3300037418 Ga0395900_0000010 Ga0395900_0000010_263678_264208 157
112 3300037466 Ga0395898_0066796 Ga0395898_0066796_2307_2837 157
113 3300037471 Ga0395905_0059371 Ga0395905_0059371_573_1103 157
114 3300038443 Ga0395901_0000007 Ga0395901_0000007_348042_348572 157
115 3300038705 Ga0237819_00447 Ga0237819_00447_10876_11415 157
116 3300041494 Ga0451837_1765454 Ga0451837_1765454_406_936 157
117 3300046517 Ga0495630_0056264 Ga0495630_0056264_486_1013 157
118 3300046535 Ga0495586_0659706 Ga0495586_0659706_75_548 157
119 3300046543 Ga0495645_0052091 Ga0495645_0052091_1323_1850 157
120 3300046678 Ga0495599_0403135 Ga0495599_0403135_17_550 157
121 3300047447 Ga0495685_040469 Ga0495685_040469_449_982 157
122 3300048904 Ga0496101_1014400 Ga0496101_1014400_165_638 157
123 3300048905 Ga0496102_0078256 Ga0496102_0078256_145_678 157
124 3300048906 Ga0496103_0109484 Ga0496103_0109484_705_1238 157
125 3300048910 Ga0496107_0341421 Ga0496107_0341421_13_486 157
126 3300048911 Ga0496108_0509108 Ga0496108_0509108_12_533 157
127 3300048913 Ga0496110_0275244 Ga0496110_0275244_375_908 157
128 3300048915 Ga0496112_0005208 Ga0496112_0005208_9992_10525 157
129 3300048916 Ga0496113_0243151 Ga0496113_0243151_516_1049 157
130 3300048918 Ga0496115_0001979 Ga0496115_0001979_10845_11378 157
131 3300049822 Ga0501035_0943487 Ga0501035_0943487_112_654 157
132 3300050491 nmdc:mga00v17_465850_c1 nmdc:mga00v17_465850_c1_136_666 157
133 3300050491 nmdc:mga00v17_6711_c1 nmdc:mga00v17_6711_c1_3599_4138 157
134 3300050494 nmdc:mga06z11_458520_c1 nmdc:mga06z11_458520_c1_110_649 157
135 3300050495 nmdc:mga04h51_5046_c1 nmdc:mga04h51_5046_c1_17_556 157
136 3300050495 nmdc:mga04h51_8128_c1 nmdc:mga04h51_8128_c1_81_611 157
137 3300050496 nmdc:mga07m45_161477_c2 nmdc:mga07m45_161477_c2_363_902 157
138 3300050496 nmdc:mga07m45_51244_c1 nmdc:mga07m45_51244_c1_431_970 157
139 3300050516 nmdc:mga0sz30_5994_c2 nmdc:mga0sz30_5994_c2_1809_2348 157
140 iso_pu_bacteria 8002869464 8002871952 157
141 iso_pu_bacteria 8054609563 8054614093 157
142 3300005355 Ga0070671_100560118 Ga0070671_1005601182 158
143 3300005445 Ga0070708_100420942 Ga0070708_1004209422 158
144 3300005564 Ga0070664_100841900 Ga0070664_1008419002 158
145 3300005844 Ga0068862_100987251 Ga0068862_1009872511 158
146 3300006846 Ga0075430_100042985 Ga0075430_1000429851 158
147 3300009093 Ga0105240_10108843 Ga0105240_101088432 158
148 3300025250 Ga0209026_1000876 Ga0209026_10008763 158
149 3300025913 Ga0207695_10231622 Ga0207695_102316222 158
150 3300025931 Ga0207644_10186066 Ga0207644_101860661 158
151 3300046506 Ga0495583_0029145 Ga0495583_0029145_1773_2309 158
152 3300046616 Ga0495668_0207948 Ga0495668_0207948_405_941 158
153 3300046648 Ga0495611_0038640 Ga0495611_0038640_64_600 158
154 3300046660 Ga0495625_0483071 Ga0495625_0483071_142_678 158
155 3300048918 Ga0496115_0014035 Ga0496115_0014035_2141_2677 158
156 3300048918 Ga0496115_0235841 Ga0496115_0235841_610_1146 158
157 3300049743 Ga0501081_0249827 Ga0501081_0249827_66_620 158
158 3300053102 Ga0500554_021496 Ga0500554_021496_565_1080 158
159 iso_pu_bacteria 2808606439 2809195670 158
160 iso_pu_bacteria 2891968417 2891971825 158
161 3300006880 Ga0075429_100768115 Ga0075429_1007681151 159
162 3300014325 Ga0163163_10025449 Ga0163163_100254492 159
163 3300025931 Ga0207644_10303023 Ga0207644_103030232 159
164 3300025934 Ga0207686_10292474 Ga0207686_102924741 159
165 3300028786 Ga0307517_10131563 Ga0307517_101315632 159
166 3300031456 Ga0307513_10015028 Ga0307513_100150285 159
167 3300031548 Ga0307408_100219427 Ga0307408_1002194272 159
168 3300032004 Ga0307414_10446046 Ga0307414_104460462 159
169 3300042000 Ga0439437_035838 Ga0439437_035838_37_618 159
170 3300046528 Ga0495642_0115239 Ga0495642_0115239_447_986 159
171 3300048915 Ga0496112_0135421 Ga0496112_0135421_853_1392 159
172 3300048924 Ga0496121_0005248 Ga0496121_0005248_1843_2388 159
173 3300050508 nmdc:mga09592_705371_c1 nmdc:mga09592_705371_c1_25_564 159
174 3300005458 Ga0070681_10057013 Ga0070681_100570137 160
175 3300025912 Ga0207707_10038157 Ga0207707_100381577 160
176 3300030521 Ga0307511_10006178 Ga0307511_1000617810 160
177 3300048915 Ga0496112_0006386 Ga0496112_0006386_7043_7582 160
178 3300048916 Ga0496113_0296908 Ga0496113_0296908_114_653 160
179 3300053119 Ga0500595_090551 Ga0500595_090551_15_554 160
180 3300005616 Ga0068852_101340360 Ga0068852_1013403601 161
181 3300010375 Ga0105239_10051552 Ga0105239_100515521 161
182 3300028794 Ga0307515_10013486 Ga0307515_100134864 161
183 3300031456 Ga0307513_10000615 Ga0307513_1000061530 161
184 3300031731 Ga0307405_10203196 Ga0307405_102031962 161
185 3300031901 Ga0307406_10001055 Ga0307406_100010553 161
186 3300031901 Ga0307406_10585786 Ga0307406_105857861 161
187 3300031903 Ga0307407_10003907 Ga0307407_100039073 161
188 3300031995 Ga0307409_100001673 Ga0307409_1000016739 161
189 3300031995 Ga0307409_100282898 Ga0307409_1002828981 161
190 3300032002 Ga0307416_100000220 Ga0307416_10000022019 161
191 3300032126 Ga0307415_100000053 Ga0307415_1000000532 161
192 3300037471 Ga0395905_0536599 Ga0395905_0536599_267_815 161
193 3300044901 Ga0466960_0143515 Ga0466960_0143515_41_529 161
194 3300047321 Ga0495676_0622632 Ga0495676_0622632_141_683 161
195 3300003203 JGI25406J46586_10061521 JGI25406J46586_100615211 162
196 3300005356 Ga0070674_100032510 Ga0070674_1000325104 162
197 3300005445 Ga0070708_100042067 Ga0070708_1000420672 162
198 3300005467 Ga0070706_100013193 Ga0070706_1000131934 162
199 3300005468 Ga0070707_100391551 Ga0070707_1003915512 162
200 3300005471 Ga0070698_100050586 Ga0070698_1000505862 162
201 3300005518 Ga0070699_100083296 Ga0070699_1000832961 162
202 3300005518 Ga0070699_100114749 Ga0070699_1001147492 162
203 3300005536 Ga0070697_100048360 Ga0070697_1000483603 162
204 3300005578 Ga0068854_100113958 Ga0068854_1001139583 162
205 3300005985 Ga0081539_10000973 Ga0081539_1000097336 162
206 3300006847 Ga0075431_101333065 Ga0075431_1013330651 162
207 3300009147 Ga0114129_10512572 Ga0114129_105125722 162
208 3300009987 Ga0105030_112147 Ga0105030_1121471 162
209 3300025910 Ga0207684_10085847 Ga0207684_100858471 162
210 3300025922 Ga0207646_10050522 Ga0207646_100505222 162
211 3300025937 Ga0207669_10601791 Ga0207669_106017911 162
212 3300025981 Ga0207640_10103385 Ga0207640_101033852 162
213 3300030522 Ga0307512_10024327 Ga0307512_100243274 162
214 3300031251 Ga0265327_10061152 Ga0265327_100611522 162
215 3300031616 Ga0307508_10028021 Ga0307508_100280212 162
216 3300031730 Ga0307516_10271910 Ga0307516_102719102 162
217 3300037418 Ga0395900_0282158 Ga0395900_0282158_730_1278 162
218 3300037471 Ga0395905_0089775 Ga0395905_0089775_1937_2497 162
219 3300038443 Ga0395901_0042261 Ga0395901_0042261_2424_2972 162
220 3300038443 Ga0395901_0764428 Ga0395901_0764428_236_796 162
221 3300050507 nmdc:mga05p37_1703108_c1 nmdc:mga05p37_1703108_c1_43_603 162
222 3300050507 nmdc:mga05p37_431018_c1 nmdc:mga05p37_431018_c1_398_994 162
223 3300053096 Ga0500641_0073249 Ga0500641_0073249_249_863 162
224 3300053098 Ga0500650_0155641 Ga0500650_0155641_14_628 162
225 3300053118 Ga0500594_0003744 Ga0500594_0003744_618_1232 162
226 iso_pu_bacteria 2773857762 2774393436 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

98

184

0.87

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

21

160

0.79

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

52

162

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jph-assembly1.cif.gz_B structure of a gnat acetyltransferase sacol1063 from staphylococcus aureus in complex with coa 0.8557 37 157
2jdd-assembly1.cif.gz_A glyphosate n-acetyltransferase bound to acetyl coa and 3-phosphoglycerate 0.8491 37 157
8heh-assembly1.cif.gz_B crystal structure of gcn5-related n-acetyltransferase 05790 0.8372 30 155
4u5y-assembly1.cif.gz_A crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica 0.8257 37 155
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8182 37 157
ID Description Score Start End Superfamily
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8581 37 138 3.40.630.30
af_Q54RD2_128_353_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8482 78 154 3.40.630.30
2bswA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8366 37 157 3.40.630.30
af_Q8WUY8_92_189_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8336 38 110 3.40.630.30
4u5yA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8257 37 155 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7C9KWR9-F1-model_v4 GNAT family N-acetyltransferase 0.996 1 155 GO:0016747
AF-A0A4P7QMX2-F1-model_v4 deleted 0.9958 1 156
AF-W1KT53-F1-model_v4 deleted 0.9941 1 157
AF-A0A2R7RT58-F1-model_v4 deleted 0.9922 1 112
AF-A0A562US94-F1-model_v4 Acetyltransferase, GNAT family 0.9919 1 157 GO:0016747

Feature Viewer

pLDDT pTM Quality
95.29 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map