F338748

General Info

Members Datasets Scaffolds Average Seq Length
226 159 452 349

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100002191|Ga0075431_10000219110
Length 411
Sequence MPASPYQDDRAGATSGVPGRGRQHGHLAFSLHDLPAHALIIRLVGRGLEVPGQVGLGMIGTEVCGVDADLTRPETARPAPHHVVDCAVYVDGRRLPAEWTHTEAMAELRRRGEGFIWIGLHEPDAGDLLTLAETFGLHELAVEDAITAHQRPKLQRFDDMLFTVLKTVKYVEHESPSTANEIVESGEIMAFLGNDFIITVRHGQHASLRDLRKELEADPERLRAGPAAVLHAIADRIVDNYLSVTEAFEDDIDEIERLVFAPRSPISPEQMYLMKREVLELRRAVMPLATPMHQLVEEDTPLIPPQVRSYFRDVEDHLSTVAEEVAGFDSLLTTLVDATLAKVTLQQSTDMRKITAWAAIIAVPTMVVGVYGMNFDHMPELHWRFGYPLVMVVIVGACLVLHRIFVRNKWL

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
140 2547132424 Nocardia nova SH22a Isolate Unclassified
141 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
142 2643221714 Streptomyces sp. Root264 Isolate Unclassified
143 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
144 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
145 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
146 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
147 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
148 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
149 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
150 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
151 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
152 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
153 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
154 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
155 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
156 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
157 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
158 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
159 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.71
Metatranscriptomes 0
Isolates 9.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.87
Nodule 0
Rhizoplane 7.52
Rhizosphere 80.09
Stem 0
Stem Tuber 0.44
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100002191 3300006847 Bacteria 18691
2 LJQas_1003442 3300000549 Bacteria 2117
3 JGI24750J21931_1009892 3300002070 Bacteria 1235
4 JGI25406J46586_10001558 3300003203 Bacteria 10824
5 JGI25406J46586_10008969 3300003203 Bacteria 4498
6 Ga0055540_1005125 3300003792 Bacteria 5635
7 Ga0070683_100410771 3300005329 Bacteria 1291
8 Ga0070682_100081215 3300005337 Bacteria 2098
9 Ga0068868_100023607 3300005338 Bacteria 4656
10 Ga0070689_100084464 3300005340 Bacteria 2495
11 Ga0070691_10049900 3300005341 Bacteria 1995
12 Ga0070668_100033187 3300005347 Bacteria 3929
13 Ga0070668_100039745 3300005347 Bacteria 3597
14 Ga0070671_100000655 3300005355 Bacteria 24851
15 Ga0070659_100016526 3300005366 Bacteria 5540
16 Ga0070659_100085466 3300005366 Bacteria 2523
17 Ga0070667_100013536 3300005367 Bacteria 6741
18 Ga0070667_100056099 3300005367 Bacteria 3327
19 Ga0070705_100075345 3300005440 Bacteria 2054
20 Ga0070662_100110952 3300005457 Bacteria 2089
21 Ga0070662_100168034 3300005457 Bacteria 1720
22 Ga0070679_100299802 3300005530 Bacteria 1558
23 Ga0068853_100082502 3300005539 Bacteria 2816
24 Ga0070665_100008289 3300005548 Bacteria 10509
25 Ga0070665_100011089 3300005548 Bacteria 9106
26 Ga0070665_100093604 3300005548 Bacteria 3010
27 Ga0068856_100225075 3300005614 Bacteria 1891
28 Ga0068852_100086388 3300005616 Bacteria 2796
29 Ga0068859_100224877 3300005617 Bacteria 1965
30 Ga0068870_10138712 3300005840 Bacteria 1420
31 Ga0068863_100002458 3300005841 Bacteria 18417
32 Ga0068863_100146395 3300005841 Bacteria 2259
33 Ga0068863_100281409 3300005841 Bacteria 1612
34 Ga0068858_100219482 3300005842 Bacteria 1800
35 Ga0068860_100064334 3300005843 Bacteria 3484
36 Ga0068860_100086991 3300005843 Bacteria 2975
37 Ga0068862_100059912 3300005844 Bacteria 3270
38 Ga0068862_100304001 3300005844 Bacteria 1468
39 Ga0081455_10000397 3300005937 Bacteria 57358
40 Ga0081455_10071960 3300005937 Bacteria 2864
41 Ga0081539_10000085 3300005985 Bacteria 217816
42 Ga0081539_10000132 3300005985 Bacteria 175454
43 Ga0075364_10005545 3300006051 Bacteria 7350
44 Ga0075364_10101766 3300006051 Bacteria 1913
45 Ga0075367_10103445 3300006178 Bacteria 1743
46 Ga0075369_10041713 3300006186 Bacteria 1965
47 Ga0075428_100000373 3300006844 Bacteria 44416
48 Ga0075430_100037420 3300006846 Bacteria 4113
49 Ga0075431_100002589 3300006847 Bacteria 17468
50 Ga0075431_100013192 3300006847 Bacteria 8347
51 Ga0075433_10001096 3300006852 Bacteria 19545
52 Ga0075434_100040509 3300006871 Bacteria 4612
53 Ga0075429_100003816 3300006880 Bacteria 12863
54 Ga0075429_100031061 3300006880 Bacteria 4643
55 Ga0075429_100056848 3300006880 Bacteria 3406
56 Ga0068865_100016953 3300006881 Bacteria 4675
57 Ga0097620_100224887 3300006931 Bacteria 1965
58 Ga0075435_100042044 3300007076 Bacteria 3655
59 Ga0111539_10006512 3300009094 Bacteria 15041
60 Ga0111539_10008725 3300009094 Bacteria 12859
61 Ga0114129_10014452 3300009147 Bacteria 11249
62 Ga0114129_10014587 3300009147 Bacteria 11195
63 Ga0114129_10620805 3300009147 Bacteria 1398
64 Ga0105242_10280388 3300009176 Bacteria 1513
65 Ga0105248_10139118 3300009177 Bacteria 2739
66 Ga0105249_10054030 3300009553 Bacteria 3672
67 Ga0105249_10091553 3300009553 Bacteria 2845
68 Ga0105249_10243956 3300009553 Bacteria 1777
69 Ga0105249_10335991 3300009553 Bacteria 1526
70 Ga0105239_10064233 3300010375 Bacteria 4029
71 Ga0157377_10046855 3300014745 Bacteria 2420
72 Ga0163161_10101983 3300017792 Bacteria 2137
73 Ga0163161_10159446 3300017792 Bacteria 1720
74 Ga0213875_10000917 3300021388 Bacteria 21338
75 Ga0209051_1005059 3300025303 Bacteria 7846
76 Ga0207688_10050593 3300025901 Bacteria 2326
77 Ga0207688_10133614 3300025901 Bacteria 1456
78 Ga0207647_10102458 3300025904 Bacteria 1697
79 Ga0207645_10010501 3300025907 Bacteria 6359
80 Ga0207643_10015348 3300025908 Bacteria 4169
81 Ga0207654_10052736 3300025911 Bacteria 2345
82 Ga0207662_10112817 3300025918 Bacteria 1697
83 Ga0207657_10027295 3300025919 Bacteria 5230
84 Ga0207652_10247957 3300025921 Bacteria 1606
85 Ga0207681_10164415 3300025923 Bacteria 1676
86 Ga0207644_10005414 3300025931 Bacteria 8323
87 Ga0207690_10085571 3300025932 Bacteria 2213
88 Ga0207706_10024449 3300025933 Bacteria 5416
89 Ga0207706_10031864 3300025933 Bacteria 4696
90 Ga0207709_10042726 3300025935 Bacteria 2728
91 Ga0207709_10110281 3300025935 Bacteria 1838
92 Ga0207661_10369985 3300025944 Bacteria 1296
93 Ga0207667_10253649 3300025949 Bacteria 1800
94 Ga0207712_10141288 3300025961 Bacteria 1848
95 Ga0207668_10057035 3300025972 Bacteria 2723
96 Ga0207668_10115780 3300025972 Bacteria 2020
97 Ga0207668_10198921 3300025972 Bacteria 1594
98 Ga0207640_10065701 3300025981 Bacteria 2421
99 Ga0207658_10008494 3300025986 Bacteria 6988
100 Ga0207658_10341732 3300025986 Bacteria 1301
101 Ga0207641_10009378 3300026088 Bacteria 8065
102 Ga0207641_10086661 3300026088 Bacteria 2731
103 Ga0207648_10156830 3300026089 Bacteria 2009
104 Ga0207675_100304916 3300026118 Bacteria 1552
105 Ga0207683_10068504 3300026121 Bacteria 3133
106 Ga0207428_10000496 3300027907 Bacteria 47043
107 Ga0268266_10014399 3300028379 Bacteria 6800
108 Ga0268266_10035268 3300028379 Bacteria 4255
109 Ga0268266_10092205 3300028379 Bacteria 2658
110 Ga0268265_10121561 3300028380 Bacteria 2152
111 Ga0268264_10003187 3300028381 Bacteria 14212
112 Ga0268264_10123432 3300028381 Bacteria 2286
113 Ga0268264_10161456 3300028381 Bacteria 2019
114 Ga0265327_10002217 3300031251 Bacteria 21198
115 Ga0307513_10034081 3300031456 Bacteria 5717
116 Ga0307408_100044733 3300031548 Bacteria 3157
117 Ga0307405_10017262 3300031731 Bacteria 3956
118 Ga0307518_10000112 3300031838 Bacteria 56876
119 Ga0307518_10058201 3300031838 Bacteria 2807
120 Ga0307410_10062400 3300031852 Bacteria 2553
121 Ga0307406_10069015 3300031901 Bacteria 2309
122 Ga0307412_10081899 3300031911 Bacteria 2233
123 Ga0307409_100258367 3300031995 Bacteria 1597
124 Ga0307414_10070163 3300032004 Bacteria 2522
125 Ga0307415_100115097 3300032126 Bacteria 2004
126 Ga0307507_10067703 3300033179 Bacteria 3263
127 Ga0307507_10121196 3300033179 Bacteria 2091
128 Ga0373956_0012279 3300035119 Bacteria 3548
129 Ga0395899_0035177 3300037312 Bacteria 3761
130 Ga0395899_0051022 3300037312 Bacteria 3071
131 Ga0395900_0024605 3300037418 Bacteria 6163
132 Ga0395900_0067337 3300037418 Bacteria 3679
133 Ga0395900_0152784 3300037418 Bacteria 2358
134 Ga0395898_0018886 3300037466 Bacteria 7024
135 Ga0395898_0139667 3300037466 Bacteria 2319
136 Ga0395898_0243763 3300037466 Bacteria 1714
137 Ga0395905_0001912 3300037471 Bacteria 23920
138 Ga0395905_0074287 3300037471 Bacteria 3186
139 Ga0436364_0199487 3300037853 Bacteria 23161
140 Ga0395901_0015509 3300038443 Bacteria 7759
141 Ga0395901_0068504 3300038443 Bacteria 3696
142 Ga0466972_0019216 3300044658 Bacteria 3418
143 Ga0466972_0101212 3300044658 Bacteria 1363
144 Ga0466965_0000817 3300044683 Bacteria 11741
145 Ga0466965_0004645 3300044683 Bacteria 6120
146 Ga0466965_0016165 3300044683 Bacteria 3547
147 Ga0466966_0057212 3300044684 Bacteria 2465
148 Ga0466961_0026058 3300044693 Bacteria 3759
149 Ga0466971_0016391 3300044719 Bacteria 3269
150 Ga0466968_0005313 3300044735 Bacteria 4822
151 Ga0466968_0051054 3300044735 Bacteria 1766
152 Ga0466970_0033865 3300044765 Bacteria 2702
153 Ga0466957_0065004 3300044842 Bacteria 2245
154 Ga0466957_0065644 3300044842 Bacteria 2235
155 Ga0466957_0092578 3300044842 Bacteria 1896
156 Ga0466960_0000806 3300044901 Bacteria 10999
157 Ga0466960_0003220 3300044901 Bacteria 6259
158 Ga0466960_0011799 3300044901 Bacteria 3669
159 Ga0466959_0077181 3300045049 Bacteria 2404
160 Ga0466967_0635775 3300045976 Bacteria 1055
161 Ga0495603_0025984 3300046455 Bacteria 3540
162 Ga0495629_0041806 3300046459 Bacteria 3223
163 Ga0495653_0029530 3300046463 Bacteria 4376
164 Ga0495594_0065356 3300046499 Bacteria 2017
165 Ga0495588_0007706 3300046674 Bacteria 4916
166 Ga0495636_0001393 3300047318 Bacteria 9127
167 Ga0495687_019278 3300047443 Bacteria 3352
168 Ga0495685_021219 3300047447 Bacteria 2235
169 Ga0496102_0018913 3300048905 Bacteria 6061
170 Ga0496102_0367918 3300048905 Bacteria 1353
171 Ga0496105_0263663 3300048908 Bacteria 1393
172 Ga0496108_0022865 3300048911 Bacteria 5144
173 Ga0496108_0153968 3300048911 Bacteria 1984
174 Ga0496108_0184010 3300048911 Bacteria 1810
175 Ga0496108_0252551 3300048911 Bacteria 1534
176 Ga0496109_0014875 3300048912 Bacteria 6771
177 Ga0496109_0102680 3300048912 Bacteria 2653
178 Ga0496109_0144323 3300048912 Bacteria 2226
179 Ga0496110_0013479 3300048913 Bacteria 6761
180 Ga0496110_0313542 3300048913 Bacteria 1428
181 Ga0496110_0441347 3300048913 Bacteria 1186
182 Ga0496112_0020695 3300048915 Bacteria 6240
183 Ga0496113_0022556 3300048916 Bacteria 4455
184 Ga0496113_0188625 3300048916 Bacteria 1636
185 Ga0496115_0229367 3300048918 Bacteria 1532
186 Ga0501069_0174226 3300049585 Bacteria 1242
187 Ga0501202_004684 3300049652 Bacteria 2397
188 nmdc:mga00v17_139201_c1 3300050491 Bacteria 1555
189 nmdc:mga00v17_2959_c1 3300050491 Bacteria 8721
190 nmdc:mga06z11_17313_c1 3300050494 Bacteria 3268
191 nmdc:mga07m45_92598_c1 3300050496 Bacteria 1732
192 nmdc:mga05p37_15040_c1 3300050507 Bacteria 9290
193 nmdc:mga05p37_351587_c1 3300050507 Bacteria 1735
194 nmdc:mga05p37_43799_c1 3300050507 Bacteria 5507
195 nmdc:mga09592_58510_c1 3300050508 Bacteria 3259
196 nmdc:mga09592_82_c1 3300050508 Bacteria 55790
197 nmdc:mga0qj67_30444_c1 3300050509 Bacteria 4202
198 nmdc:mga06r32_3723_c1 3300050510 Bacteria 13642
199 nmdc:mga06r32_80562_c1 3300050510 Bacteria 3169
200 nmdc:mga08y16_2057_c1 3300050511 Bacteria 20602
201 nmdc:mga0n895_1607_c1 3300050512 Bacteria 17015
202 nmdc:mga0rr50_7529_c1 3300050513 Bacteria 6724
203 nmdc:mga0a205_5269_c1 3300050515 Bacteria 11647
204 nmdc:mga0sz30_1979_c1 3300050516 Bacteria 7329
205 Ga0466962_0009781 3300061719 Bacteria 4601
206 2523387665 2523231044 Bacteria 6434991
207 2548698671 2547132424 Bacteria 8348532
208 2586064126 2585427649 Bacteria 9053857
209 2644631571 2643221714 Bacteria 9015452
210 2744954659 2744054611 Bacteria 5611514
211 2776371754 2775506925 Bacteria 7237746
212 2791913086 2791354901 Bacteria 8322202
213 2795785810 2795385470 Bacteria 8317180
214 2795791470 2795385472 Bacteria 6627535
215 2809586631 2808606522 Bacteria 9488490
216 2863068892 2863067949 Bacteria 8541735
217 2866553083 2866552031 Bacteria 5824618
218 2866618710 2866612099 Bacteria 7543886
219 2891328020 2891326441 Bacteria 6439512
220 2899360248 2899359706 Bacteria 10940472
221 2899372802 2899370129 Bacteria 6781179
222 2915772425 2915768154 Bacteria 8424322
223 2919719345 2919713450 Bacteria 7431245
224 2946079267 2946072368 Bacteria 8999607
225 8054475493 8054472261 Bacteria 7464355
226 8056215387 8056207758 Bacteria 8639239
227 Ga0075431_100002191
228 LJQas_1003442
229 JGI24750J21931_1009892
230 JGI25406J46586_10001558
231 JGI25406J46586_10008969
232 Ga0055540_1005125
233 Ga0070683_100410771
234 Ga0070682_100081215
235 Ga0068868_100023607
236 Ga0070689_100084464
237 Ga0070691_10049900
238 Ga0070668_100033187
239 Ga0070668_100039745
240 Ga0070671_100000655
241 Ga0070659_100016526
242 Ga0070659_100085466
243 Ga0070667_100013536
244 Ga0070667_100056099
245 Ga0070705_100075345
246 Ga0070662_100110952
247 Ga0070662_100168034
248 Ga0070679_100299802
249 Ga0068853_100082502
250 Ga0070665_100008289
251 Ga0070665_100011089
252 Ga0070665_100093604
253 Ga0068856_100225075
254 Ga0068852_100086388
255 Ga0068859_100224877
256 Ga0068870_10138712
257 Ga0068863_100002458
258 Ga0068863_100146395
259 Ga0068863_100281409
260 Ga0068858_100219482
261 Ga0068860_100064334
262 Ga0068860_100086991
263 Ga0068862_100059912
264 Ga0068862_100304001
265 Ga0081455_10000397
266 Ga0081455_10071960
267 Ga0081539_10000085
268 Ga0081539_10000132
269 Ga0075364_10005545
270 Ga0075364_10101766
271 Ga0075367_10103445
272 Ga0075369_10041713
273 Ga0075428_100000373
274 Ga0075430_100037420
275 Ga0075431_100002589
276 Ga0075431_100013192
277 Ga0075433_10001096
278 Ga0075434_100040509
279 Ga0075429_100003816
280 Ga0075429_100031061
281 Ga0075429_100056848
282 Ga0068865_100016953
283 Ga0097620_100224887
284 Ga0075435_100042044
285 Ga0111539_10006512
286 Ga0111539_10008725
287 Ga0114129_10014452
288 Ga0114129_10014587
289 Ga0114129_10620805
290 Ga0105242_10280388
291 Ga0105248_10139118
292 Ga0105249_10054030
293 Ga0105249_10091553
294 Ga0105249_10243956
295 Ga0105249_10335991
296 Ga0105239_10064233
297 Ga0157377_10046855
298 Ga0163161_10101983
299 Ga0163161_10159446
300 Ga0213875_10000917
301 Ga0209051_1005059
302 Ga0207688_10050593
303 Ga0207688_10133614
304 Ga0207647_10102458
305 Ga0207645_10010501
306 Ga0207643_10015348
307 Ga0207654_10052736
308 Ga0207662_10112817
309 Ga0207657_10027295
310 Ga0207652_10247957
311 Ga0207681_10164415
312 Ga0207644_10005414
313 Ga0207690_10085571
314 Ga0207706_10024449
315 Ga0207706_10031864
316 Ga0207709_10042726
317 Ga0207709_10110281
318 Ga0207661_10369985
319 Ga0207667_10253649
320 Ga0207712_10141288
321 Ga0207668_10057035
322 Ga0207668_10115780
323 Ga0207668_10198921
324 Ga0207640_10065701
325 Ga0207658_10008494
326 Ga0207658_10341732
327 Ga0207641_10009378
328 Ga0207641_10086661
329 Ga0207648_10156830
330 Ga0207675_100304916
331 Ga0207683_10068504
332 Ga0207428_10000496
333 Ga0268266_10014399
334 Ga0268266_10035268
335 Ga0268266_10092205
336 Ga0268265_10121561
337 Ga0268264_10003187
338 Ga0268264_10123432
339 Ga0268264_10161456
340 Ga0265327_10002217
341 Ga0307513_10034081
342 Ga0307408_100044733
343 Ga0307405_10017262
344 Ga0307518_10000112
345 Ga0307518_10058201
346 Ga0307410_10062400
347 Ga0307406_10069015
348 Ga0307412_10081899
349 Ga0307409_100258367
350 Ga0307414_10070163
351 Ga0307415_100115097
352 Ga0307507_10067703
353 Ga0307507_10121196
354 Ga0373956_0012279
355 Ga0395899_0035177
356 Ga0395899_0051022
357 Ga0395900_0024605
358 Ga0395900_0067337
359 Ga0395900_0152784
360 Ga0395898_0018886
361 Ga0395898_0139667
362 Ga0395898_0243763
363 Ga0395905_0001912
364 Ga0395905_0074287
365 Ga0436364_0199487
366 Ga0395901_0015509
367 Ga0395901_0068504
368 Ga0466972_0019216
369 Ga0466972_0101212
370 Ga0466965_0000817
371 Ga0466965_0004645
372 Ga0466965_0016165
373 Ga0466966_0057212
374 Ga0466961_0026058
375 Ga0466971_0016391
376 Ga0466968_0005313
377 Ga0466968_0051054
378 Ga0466970_0033865
379 Ga0466957_0065004
380 Ga0466957_0065644
381 Ga0466957_0092578
382 Ga0466960_0000806
383 Ga0466960_0003220
384 Ga0466960_0011799
385 Ga0466959_0077181
386 Ga0466967_0635775
387 Ga0495603_0025984
388 Ga0495629_0041806
389 Ga0495653_0029530
390 Ga0495594_0065356
391 Ga0495588_0007706
392 Ga0495636_0001393
393 Ga0495687_019278
394 Ga0495685_021219
395 Ga0496102_0018913
396 Ga0496102_0367918
397 Ga0496105_0263663
398 Ga0496108_0022865
399 Ga0496108_0153968
400 Ga0496108_0184010
401 Ga0496108_0252551
402 Ga0496109_0014875
403 Ga0496109_0102680
404 Ga0496109_0144323
405 Ga0496110_0013479
406 Ga0496110_0313542
407 Ga0496110_0441347
408 Ga0496112_0020695
409 Ga0496113_0022556
410 Ga0496113_0188625
411 Ga0496115_0229367
412 Ga0501069_0174226
413 Ga0501202_004684
414 nmdc:mga00v17_139201_c1
415 nmdc:mga00v17_2959_c1
416 nmdc:mga06z11_17313_c1
417 nmdc:mga07m45_92598_c1
418 nmdc:mga05p37_15040_c1
419 nmdc:mga05p37_351587_c1
420 nmdc:mga05p37_43799_c1
421 nmdc:mga09592_58510_c1
422 nmdc:mga09592_82_c1
423 nmdc:mga0qj67_30444_c1
424 nmdc:mga06r32_3723_c1
425 nmdc:mga06r32_80562_c1
426 nmdc:mga08y16_2057_c1
427 nmdc:mga0n895_1607_c1
428 nmdc:mga0rr50_7529_c1
429 nmdc:mga0a205_5269_c1
430 nmdc:mga0sz30_1979_c1
431 Ga0466962_0009781
432 2523387665
433 2548698671
434 2586064126
435 2644631571
436 2744954659
437 2776371754
438 2791913086
439 2795785810
440 2795791470
441 2809586631
442 2863068892
443 2866553083
444 2866618710
445 2891328020
446 2899360248
447 2899372802
448 2915772425
449 2919719345
450 2946079267
451 8054475493
452 8056215387

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01544

CorA

CorA-like Mg2+ transporter protein

112

407

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eeb-assembly1.cif.gz_C cora coiled-coil mutant under mg2+ absence 0.8378 36 361
4egw-assembly1.cif.gz_B the structure of the soluble domain of cora from methanocaldococcus jannaschii 0.8338 36 295
4eeb-assembly1.cif.gz_C cora coiled-coil mutant under mg2+ absence 0.8282 36 361
5jtg-assembly1.cif.gz_E crystal structure of thermotoga maritima mutant d89k/d253k 0.8258 36 361
8slb-assembly1.cif.gz_A x-ray structure of cora n-terminal domain in complex with conformation-specific synthetic antibody c12 0.8245 36 272
ID Description Score Start End Superfamily
af_O50455_48_179_3.30.460.20 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;CorA soluble domain-like 0.9938 51 177 3.30.460.20
af_O50455_180_293_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.964 179 291 1.20.58.340
af_O50455_48_179_3.30.460.20 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;CorA soluble domain-like 0.9491 51 177 3.30.460.20
af_O50455_180_293_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9476 179 291 1.20.58.340
af_Q58439_132_258_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9344 181 305 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A7Y3G1W9-F1-model_v4 Magnesium and cobalt transport protein CorA 0.955 37 333 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-X8DYD1-F1-model_v4 CorA-like Mg2+ transporter family protein 0.9541 53 177 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-X8F1S0-F1-model_v4 deleted 0.9457 59 171
AF-A0A7Y3G1W9-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9455 37 333 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A529L5Y1-F1-model_v4 Magnesium transporter 0.9426 69 286 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897

Map