F338748
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 226 | 159 | 452 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100002191|Ga0075431_10000219110 |
| Length | 411 |
| Sequence | MPASPYQDDRAGATSGVPGRGRQHGHLAFSLHDLPAHALIIRLVGRGLEVPGQVGLGMIGTEVCGVDADLTRPETARPAPHHVVDCAVYVDGRRLPAEWTHTEAMAELRRRGEGFIWIGLHEPDAGDLLTLAETFGLHELAVEDAITAHQRPKLQRFDDMLFTVLKTVKYVEHESPSTANEIVESGEIMAFLGNDFIITVRHGQHASLRDLRKELEADPERLRAGPAAVLHAIADRIVDNYLSVTEAFEDDIDEIERLVFAPRSPISPEQMYLMKREVLELRRAVMPLATPMHQLVEEDTPLIPPQVRSYFRDVEDHLSTVAEEVAGFDSLLTTLVDATLAKVTLQQSTDMRKITAWAAIIAVPTMVVGVYGMNFDHMPELHWRFGYPLVMVVIVGACLVLHRIFVRNKWL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 23 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 32 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 33 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 34 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 35 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 36 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 37 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 50 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 79 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 80 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 81 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 82 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 83 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 84 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 85 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 86 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 87 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 88 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 89 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 90 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 91 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 92 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 93 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 94 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 95 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 96 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 97 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 98 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 99 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 100 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 101 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 102 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 103 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 104 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 105 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 106 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 107 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 108 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 117 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 118 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 121 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 122 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 123 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 124 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 126 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 127 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 128 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 129 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 138 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 139 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 140 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 141 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 142 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 143 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 144 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 145 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 146 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 147 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 148 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 149 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 150 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 151 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 152 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 153 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 154 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 155 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 156 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 157 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 158 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 159 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.71 |
| Metatranscriptomes | 0 |
| Isolates | 9.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.87 |
| Nodule | 0 |
| Rhizoplane | 7.52 |
| Rhizosphere | 80.09 |
| Stem | 0 |
| Stem Tuber | 0.44 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075431_100002191 | 3300006847 | Bacteria | 18691 |
| 2 | LJQas_1003442 | 3300000549 | Bacteria | 2117 |
| 3 | JGI24750J21931_1009892 | 3300002070 | Bacteria | 1235 |
| 4 | JGI25406J46586_10001558 | 3300003203 | Bacteria | 10824 |
| 5 | JGI25406J46586_10008969 | 3300003203 | Bacteria | 4498 |
| 6 | Ga0055540_1005125 | 3300003792 | Bacteria | 5635 |
| 7 | Ga0070683_100410771 | 3300005329 | Bacteria | 1291 |
| 8 | Ga0070682_100081215 | 3300005337 | Bacteria | 2098 |
| 9 | Ga0068868_100023607 | 3300005338 | Bacteria | 4656 |
| 10 | Ga0070689_100084464 | 3300005340 | Bacteria | 2495 |
| 11 | Ga0070691_10049900 | 3300005341 | Bacteria | 1995 |
| 12 | Ga0070668_100033187 | 3300005347 | Bacteria | 3929 |
| 13 | Ga0070668_100039745 | 3300005347 | Bacteria | 3597 |
| 14 | Ga0070671_100000655 | 3300005355 | Bacteria | 24851 |
| 15 | Ga0070659_100016526 | 3300005366 | Bacteria | 5540 |
| 16 | Ga0070659_100085466 | 3300005366 | Bacteria | 2523 |
| 17 | Ga0070667_100013536 | 3300005367 | Bacteria | 6741 |
| 18 | Ga0070667_100056099 | 3300005367 | Bacteria | 3327 |
| 19 | Ga0070705_100075345 | 3300005440 | Bacteria | 2054 |
| 20 | Ga0070662_100110952 | 3300005457 | Bacteria | 2089 |
| 21 | Ga0070662_100168034 | 3300005457 | Bacteria | 1720 |
| 22 | Ga0070679_100299802 | 3300005530 | Bacteria | 1558 |
| 23 | Ga0068853_100082502 | 3300005539 | Bacteria | 2816 |
| 24 | Ga0070665_100008289 | 3300005548 | Bacteria | 10509 |
| 25 | Ga0070665_100011089 | 3300005548 | Bacteria | 9106 |
| 26 | Ga0070665_100093604 | 3300005548 | Bacteria | 3010 |
| 27 | Ga0068856_100225075 | 3300005614 | Bacteria | 1891 |
| 28 | Ga0068852_100086388 | 3300005616 | Bacteria | 2796 |
| 29 | Ga0068859_100224877 | 3300005617 | Bacteria | 1965 |
| 30 | Ga0068870_10138712 | 3300005840 | Bacteria | 1420 |
| 31 | Ga0068863_100002458 | 3300005841 | Bacteria | 18417 |
| 32 | Ga0068863_100146395 | 3300005841 | Bacteria | 2259 |
| 33 | Ga0068863_100281409 | 3300005841 | Bacteria | 1612 |
| 34 | Ga0068858_100219482 | 3300005842 | Bacteria | 1800 |
| 35 | Ga0068860_100064334 | 3300005843 | Bacteria | 3484 |
| 36 | Ga0068860_100086991 | 3300005843 | Bacteria | 2975 |
| 37 | Ga0068862_100059912 | 3300005844 | Bacteria | 3270 |
| 38 | Ga0068862_100304001 | 3300005844 | Bacteria | 1468 |
| 39 | Ga0081455_10000397 | 3300005937 | Bacteria | 57358 |
| 40 | Ga0081455_10071960 | 3300005937 | Bacteria | 2864 |
| 41 | Ga0081539_10000085 | 3300005985 | Bacteria | 217816 |
| 42 | Ga0081539_10000132 | 3300005985 | Bacteria | 175454 |
| 43 | Ga0075364_10005545 | 3300006051 | Bacteria | 7350 |
| 44 | Ga0075364_10101766 | 3300006051 | Bacteria | 1913 |
| 45 | Ga0075367_10103445 | 3300006178 | Bacteria | 1743 |
| 46 | Ga0075369_10041713 | 3300006186 | Bacteria | 1965 |
| 47 | Ga0075428_100000373 | 3300006844 | Bacteria | 44416 |
| 48 | Ga0075430_100037420 | 3300006846 | Bacteria | 4113 |
| 49 | Ga0075431_100002589 | 3300006847 | Bacteria | 17468 |
| 50 | Ga0075431_100013192 | 3300006847 | Bacteria | 8347 |
| 51 | Ga0075433_10001096 | 3300006852 | Bacteria | 19545 |
| 52 | Ga0075434_100040509 | 3300006871 | Bacteria | 4612 |
| 53 | Ga0075429_100003816 | 3300006880 | Bacteria | 12863 |
| 54 | Ga0075429_100031061 | 3300006880 | Bacteria | 4643 |
| 55 | Ga0075429_100056848 | 3300006880 | Bacteria | 3406 |
| 56 | Ga0068865_100016953 | 3300006881 | Bacteria | 4675 |
| 57 | Ga0097620_100224887 | 3300006931 | Bacteria | 1965 |
| 58 | Ga0075435_100042044 | 3300007076 | Bacteria | 3655 |
| 59 | Ga0111539_10006512 | 3300009094 | Bacteria | 15041 |
| 60 | Ga0111539_10008725 | 3300009094 | Bacteria | 12859 |
| 61 | Ga0114129_10014452 | 3300009147 | Bacteria | 11249 |
| 62 | Ga0114129_10014587 | 3300009147 | Bacteria | 11195 |
| 63 | Ga0114129_10620805 | 3300009147 | Bacteria | 1398 |
| 64 | Ga0105242_10280388 | 3300009176 | Bacteria | 1513 |
| 65 | Ga0105248_10139118 | 3300009177 | Bacteria | 2739 |
| 66 | Ga0105249_10054030 | 3300009553 | Bacteria | 3672 |
| 67 | Ga0105249_10091553 | 3300009553 | Bacteria | 2845 |
| 68 | Ga0105249_10243956 | 3300009553 | Bacteria | 1777 |
| 69 | Ga0105249_10335991 | 3300009553 | Bacteria | 1526 |
| 70 | Ga0105239_10064233 | 3300010375 | Bacteria | 4029 |
| 71 | Ga0157377_10046855 | 3300014745 | Bacteria | 2420 |
| 72 | Ga0163161_10101983 | 3300017792 | Bacteria | 2137 |
| 73 | Ga0163161_10159446 | 3300017792 | Bacteria | 1720 |
| 74 | Ga0213875_10000917 | 3300021388 | Bacteria | 21338 |
| 75 | Ga0209051_1005059 | 3300025303 | Bacteria | 7846 |
| 76 | Ga0207688_10050593 | 3300025901 | Bacteria | 2326 |
| 77 | Ga0207688_10133614 | 3300025901 | Bacteria | 1456 |
| 78 | Ga0207647_10102458 | 3300025904 | Bacteria | 1697 |
| 79 | Ga0207645_10010501 | 3300025907 | Bacteria | 6359 |
| 80 | Ga0207643_10015348 | 3300025908 | Bacteria | 4169 |
| 81 | Ga0207654_10052736 | 3300025911 | Bacteria | 2345 |
| 82 | Ga0207662_10112817 | 3300025918 | Bacteria | 1697 |
| 83 | Ga0207657_10027295 | 3300025919 | Bacteria | 5230 |
| 84 | Ga0207652_10247957 | 3300025921 | Bacteria | 1606 |
| 85 | Ga0207681_10164415 | 3300025923 | Bacteria | 1676 |
| 86 | Ga0207644_10005414 | 3300025931 | Bacteria | 8323 |
| 87 | Ga0207690_10085571 | 3300025932 | Bacteria | 2213 |
| 88 | Ga0207706_10024449 | 3300025933 | Bacteria | 5416 |
| 89 | Ga0207706_10031864 | 3300025933 | Bacteria | 4696 |
| 90 | Ga0207709_10042726 | 3300025935 | Bacteria | 2728 |
| 91 | Ga0207709_10110281 | 3300025935 | Bacteria | 1838 |
| 92 | Ga0207661_10369985 | 3300025944 | Bacteria | 1296 |
| 93 | Ga0207667_10253649 | 3300025949 | Bacteria | 1800 |
| 94 | Ga0207712_10141288 | 3300025961 | Bacteria | 1848 |
| 95 | Ga0207668_10057035 | 3300025972 | Bacteria | 2723 |
| 96 | Ga0207668_10115780 | 3300025972 | Bacteria | 2020 |
| 97 | Ga0207668_10198921 | 3300025972 | Bacteria | 1594 |
| 98 | Ga0207640_10065701 | 3300025981 | Bacteria | 2421 |
| 99 | Ga0207658_10008494 | 3300025986 | Bacteria | 6988 |
| 100 | Ga0207658_10341732 | 3300025986 | Bacteria | 1301 |
| 101 | Ga0207641_10009378 | 3300026088 | Bacteria | 8065 |
| 102 | Ga0207641_10086661 | 3300026088 | Bacteria | 2731 |
| 103 | Ga0207648_10156830 | 3300026089 | Bacteria | 2009 |
| 104 | Ga0207675_100304916 | 3300026118 | Bacteria | 1552 |
| 105 | Ga0207683_10068504 | 3300026121 | Bacteria | 3133 |
| 106 | Ga0207428_10000496 | 3300027907 | Bacteria | 47043 |
| 107 | Ga0268266_10014399 | 3300028379 | Bacteria | 6800 |
| 108 | Ga0268266_10035268 | 3300028379 | Bacteria | 4255 |
| 109 | Ga0268266_10092205 | 3300028379 | Bacteria | 2658 |
| 110 | Ga0268265_10121561 | 3300028380 | Bacteria | 2152 |
| 111 | Ga0268264_10003187 | 3300028381 | Bacteria | 14212 |
| 112 | Ga0268264_10123432 | 3300028381 | Bacteria | 2286 |
| 113 | Ga0268264_10161456 | 3300028381 | Bacteria | 2019 |
| 114 | Ga0265327_10002217 | 3300031251 | Bacteria | 21198 |
| 115 | Ga0307513_10034081 | 3300031456 | Bacteria | 5717 |
| 116 | Ga0307408_100044733 | 3300031548 | Bacteria | 3157 |
| 117 | Ga0307405_10017262 | 3300031731 | Bacteria | 3956 |
| 118 | Ga0307518_10000112 | 3300031838 | Bacteria | 56876 |
| 119 | Ga0307518_10058201 | 3300031838 | Bacteria | 2807 |
| 120 | Ga0307410_10062400 | 3300031852 | Bacteria | 2553 |
| 121 | Ga0307406_10069015 | 3300031901 | Bacteria | 2309 |
| 122 | Ga0307412_10081899 | 3300031911 | Bacteria | 2233 |
| 123 | Ga0307409_100258367 | 3300031995 | Bacteria | 1597 |
| 124 | Ga0307414_10070163 | 3300032004 | Bacteria | 2522 |
| 125 | Ga0307415_100115097 | 3300032126 | Bacteria | 2004 |
| 126 | Ga0307507_10067703 | 3300033179 | Bacteria | 3263 |
| 127 | Ga0307507_10121196 | 3300033179 | Bacteria | 2091 |
| 128 | Ga0373956_0012279 | 3300035119 | Bacteria | 3548 |
| 129 | Ga0395899_0035177 | 3300037312 | Bacteria | 3761 |
| 130 | Ga0395899_0051022 | 3300037312 | Bacteria | 3071 |
| 131 | Ga0395900_0024605 | 3300037418 | Bacteria | 6163 |
| 132 | Ga0395900_0067337 | 3300037418 | Bacteria | 3679 |
| 133 | Ga0395900_0152784 | 3300037418 | Bacteria | 2358 |
| 134 | Ga0395898_0018886 | 3300037466 | Bacteria | 7024 |
| 135 | Ga0395898_0139667 | 3300037466 | Bacteria | 2319 |
| 136 | Ga0395898_0243763 | 3300037466 | Bacteria | 1714 |
| 137 | Ga0395905_0001912 | 3300037471 | Bacteria | 23920 |
| 138 | Ga0395905_0074287 | 3300037471 | Bacteria | 3186 |
| 139 | Ga0436364_0199487 | 3300037853 | Bacteria | 23161 |
| 140 | Ga0395901_0015509 | 3300038443 | Bacteria | 7759 |
| 141 | Ga0395901_0068504 | 3300038443 | Bacteria | 3696 |
| 142 | Ga0466972_0019216 | 3300044658 | Bacteria | 3418 |
| 143 | Ga0466972_0101212 | 3300044658 | Bacteria | 1363 |
| 144 | Ga0466965_0000817 | 3300044683 | Bacteria | 11741 |
| 145 | Ga0466965_0004645 | 3300044683 | Bacteria | 6120 |
| 146 | Ga0466965_0016165 | 3300044683 | Bacteria | 3547 |
| 147 | Ga0466966_0057212 | 3300044684 | Bacteria | 2465 |
| 148 | Ga0466961_0026058 | 3300044693 | Bacteria | 3759 |
| 149 | Ga0466971_0016391 | 3300044719 | Bacteria | 3269 |
| 150 | Ga0466968_0005313 | 3300044735 | Bacteria | 4822 |
| 151 | Ga0466968_0051054 | 3300044735 | Bacteria | 1766 |
| 152 | Ga0466970_0033865 | 3300044765 | Bacteria | 2702 |
| 153 | Ga0466957_0065004 | 3300044842 | Bacteria | 2245 |
| 154 | Ga0466957_0065644 | 3300044842 | Bacteria | 2235 |
| 155 | Ga0466957_0092578 | 3300044842 | Bacteria | 1896 |
| 156 | Ga0466960_0000806 | 3300044901 | Bacteria | 10999 |
| 157 | Ga0466960_0003220 | 3300044901 | Bacteria | 6259 |
| 158 | Ga0466960_0011799 | 3300044901 | Bacteria | 3669 |
| 159 | Ga0466959_0077181 | 3300045049 | Bacteria | 2404 |
| 160 | Ga0466967_0635775 | 3300045976 | Bacteria | 1055 |
| 161 | Ga0495603_0025984 | 3300046455 | Bacteria | 3540 |
| 162 | Ga0495629_0041806 | 3300046459 | Bacteria | 3223 |
| 163 | Ga0495653_0029530 | 3300046463 | Bacteria | 4376 |
| 164 | Ga0495594_0065356 | 3300046499 | Bacteria | 2017 |
| 165 | Ga0495588_0007706 | 3300046674 | Bacteria | 4916 |
| 166 | Ga0495636_0001393 | 3300047318 | Bacteria | 9127 |
| 167 | Ga0495687_019278 | 3300047443 | Bacteria | 3352 |
| 168 | Ga0495685_021219 | 3300047447 | Bacteria | 2235 |
| 169 | Ga0496102_0018913 | 3300048905 | Bacteria | 6061 |
| 170 | Ga0496102_0367918 | 3300048905 | Bacteria | 1353 |
| 171 | Ga0496105_0263663 | 3300048908 | Bacteria | 1393 |
| 172 | Ga0496108_0022865 | 3300048911 | Bacteria | 5144 |
| 173 | Ga0496108_0153968 | 3300048911 | Bacteria | 1984 |
| 174 | Ga0496108_0184010 | 3300048911 | Bacteria | 1810 |
| 175 | Ga0496108_0252551 | 3300048911 | Bacteria | 1534 |
| 176 | Ga0496109_0014875 | 3300048912 | Bacteria | 6771 |
| 177 | Ga0496109_0102680 | 3300048912 | Bacteria | 2653 |
| 178 | Ga0496109_0144323 | 3300048912 | Bacteria | 2226 |
| 179 | Ga0496110_0013479 | 3300048913 | Bacteria | 6761 |
| 180 | Ga0496110_0313542 | 3300048913 | Bacteria | 1428 |
| 181 | Ga0496110_0441347 | 3300048913 | Bacteria | 1186 |
| 182 | Ga0496112_0020695 | 3300048915 | Bacteria | 6240 |
| 183 | Ga0496113_0022556 | 3300048916 | Bacteria | 4455 |
| 184 | Ga0496113_0188625 | 3300048916 | Bacteria | 1636 |
| 185 | Ga0496115_0229367 | 3300048918 | Bacteria | 1532 |
| 186 | Ga0501069_0174226 | 3300049585 | Bacteria | 1242 |
| 187 | Ga0501202_004684 | 3300049652 | Bacteria | 2397 |
| 188 | nmdc:mga00v17_139201_c1 | 3300050491 | Bacteria | 1555 |
| 189 | nmdc:mga00v17_2959_c1 | 3300050491 | Bacteria | 8721 |
| 190 | nmdc:mga06z11_17313_c1 | 3300050494 | Bacteria | 3268 |
| 191 | nmdc:mga07m45_92598_c1 | 3300050496 | Bacteria | 1732 |
| 192 | nmdc:mga05p37_15040_c1 | 3300050507 | Bacteria | 9290 |
| 193 | nmdc:mga05p37_351587_c1 | 3300050507 | Bacteria | 1735 |
| 194 | nmdc:mga05p37_43799_c1 | 3300050507 | Bacteria | 5507 |
| 195 | nmdc:mga09592_58510_c1 | 3300050508 | Bacteria | 3259 |
| 196 | nmdc:mga09592_82_c1 | 3300050508 | Bacteria | 55790 |
| 197 | nmdc:mga0qj67_30444_c1 | 3300050509 | Bacteria | 4202 |
| 198 | nmdc:mga06r32_3723_c1 | 3300050510 | Bacteria | 13642 |
| 199 | nmdc:mga06r32_80562_c1 | 3300050510 | Bacteria | 3169 |
| 200 | nmdc:mga08y16_2057_c1 | 3300050511 | Bacteria | 20602 |
| 201 | nmdc:mga0n895_1607_c1 | 3300050512 | Bacteria | 17015 |
| 202 | nmdc:mga0rr50_7529_c1 | 3300050513 | Bacteria | 6724 |
| 203 | nmdc:mga0a205_5269_c1 | 3300050515 | Bacteria | 11647 |
| 204 | nmdc:mga0sz30_1979_c1 | 3300050516 | Bacteria | 7329 |
| 205 | Ga0466962_0009781 | 3300061719 | Bacteria | 4601 |
| 206 | 2523387665 | 2523231044 | Bacteria | 6434991 |
| 207 | 2548698671 | 2547132424 | Bacteria | 8348532 |
| 208 | 2586064126 | 2585427649 | Bacteria | 9053857 |
| 209 | 2644631571 | 2643221714 | Bacteria | 9015452 |
| 210 | 2744954659 | 2744054611 | Bacteria | 5611514 |
| 211 | 2776371754 | 2775506925 | Bacteria | 7237746 |
| 212 | 2791913086 | 2791354901 | Bacteria | 8322202 |
| 213 | 2795785810 | 2795385470 | Bacteria | 8317180 |
| 214 | 2795791470 | 2795385472 | Bacteria | 6627535 |
| 215 | 2809586631 | 2808606522 | Bacteria | 9488490 |
| 216 | 2863068892 | 2863067949 | Bacteria | 8541735 |
| 217 | 2866553083 | 2866552031 | Bacteria | 5824618 |
| 218 | 2866618710 | 2866612099 | Bacteria | 7543886 |
| 219 | 2891328020 | 2891326441 | Bacteria | 6439512 |
| 220 | 2899360248 | 2899359706 | Bacteria | 10940472 |
| 221 | 2899372802 | 2899370129 | Bacteria | 6781179 |
| 222 | 2915772425 | 2915768154 | Bacteria | 8424322 |
| 223 | 2919719345 | 2919713450 | Bacteria | 7431245 |
| 224 | 2946079267 | 2946072368 | Bacteria | 8999607 |
| 225 | 8054475493 | 8054472261 | Bacteria | 7464355 |
| 226 | 8056215387 | 8056207758 | Bacteria | 8639239 |
| 227 | Ga0075431_100002191 | |||
| 228 | LJQas_1003442 | |||
| 229 | JGI24750J21931_1009892 | |||
| 230 | JGI25406J46586_10001558 | |||
| 231 | JGI25406J46586_10008969 | |||
| 232 | Ga0055540_1005125 | |||
| 233 | Ga0070683_100410771 | |||
| 234 | Ga0070682_100081215 | |||
| 235 | Ga0068868_100023607 | |||
| 236 | Ga0070689_100084464 | |||
| 237 | Ga0070691_10049900 | |||
| 238 | Ga0070668_100033187 | |||
| 239 | Ga0070668_100039745 | |||
| 240 | Ga0070671_100000655 | |||
| 241 | Ga0070659_100016526 | |||
| 242 | Ga0070659_100085466 | |||
| 243 | Ga0070667_100013536 | |||
| 244 | Ga0070667_100056099 | |||
| 245 | Ga0070705_100075345 | |||
| 246 | Ga0070662_100110952 | |||
| 247 | Ga0070662_100168034 | |||
| 248 | Ga0070679_100299802 | |||
| 249 | Ga0068853_100082502 | |||
| 250 | Ga0070665_100008289 | |||
| 251 | Ga0070665_100011089 | |||
| 252 | Ga0070665_100093604 | |||
| 253 | Ga0068856_100225075 | |||
| 254 | Ga0068852_100086388 | |||
| 255 | Ga0068859_100224877 | |||
| 256 | Ga0068870_10138712 | |||
| 257 | Ga0068863_100002458 | |||
| 258 | Ga0068863_100146395 | |||
| 259 | Ga0068863_100281409 | |||
| 260 | Ga0068858_100219482 | |||
| 261 | Ga0068860_100064334 | |||
| 262 | Ga0068860_100086991 | |||
| 263 | Ga0068862_100059912 | |||
| 264 | Ga0068862_100304001 | |||
| 265 | Ga0081455_10000397 | |||
| 266 | Ga0081455_10071960 | |||
| 267 | Ga0081539_10000085 | |||
| 268 | Ga0081539_10000132 | |||
| 269 | Ga0075364_10005545 | |||
| 270 | Ga0075364_10101766 | |||
| 271 | Ga0075367_10103445 | |||
| 272 | Ga0075369_10041713 | |||
| 273 | Ga0075428_100000373 | |||
| 274 | Ga0075430_100037420 | |||
| 275 | Ga0075431_100002589 | |||
| 276 | Ga0075431_100013192 | |||
| 277 | Ga0075433_10001096 | |||
| 278 | Ga0075434_100040509 | |||
| 279 | Ga0075429_100003816 | |||
| 280 | Ga0075429_100031061 | |||
| 281 | Ga0075429_100056848 | |||
| 282 | Ga0068865_100016953 | |||
| 283 | Ga0097620_100224887 | |||
| 284 | Ga0075435_100042044 | |||
| 285 | Ga0111539_10006512 | |||
| 286 | Ga0111539_10008725 | |||
| 287 | Ga0114129_10014452 | |||
| 288 | Ga0114129_10014587 | |||
| 289 | Ga0114129_10620805 | |||
| 290 | Ga0105242_10280388 | |||
| 291 | Ga0105248_10139118 | |||
| 292 | Ga0105249_10054030 | |||
| 293 | Ga0105249_10091553 | |||
| 294 | Ga0105249_10243956 | |||
| 295 | Ga0105249_10335991 | |||
| 296 | Ga0105239_10064233 | |||
| 297 | Ga0157377_10046855 | |||
| 298 | Ga0163161_10101983 | |||
| 299 | Ga0163161_10159446 | |||
| 300 | Ga0213875_10000917 | |||
| 301 | Ga0209051_1005059 | |||
| 302 | Ga0207688_10050593 | |||
| 303 | Ga0207688_10133614 | |||
| 304 | Ga0207647_10102458 | |||
| 305 | Ga0207645_10010501 | |||
| 306 | Ga0207643_10015348 | |||
| 307 | Ga0207654_10052736 | |||
| 308 | Ga0207662_10112817 | |||
| 309 | Ga0207657_10027295 | |||
| 310 | Ga0207652_10247957 | |||
| 311 | Ga0207681_10164415 | |||
| 312 | Ga0207644_10005414 | |||
| 313 | Ga0207690_10085571 | |||
| 314 | Ga0207706_10024449 | |||
| 315 | Ga0207706_10031864 | |||
| 316 | Ga0207709_10042726 | |||
| 317 | Ga0207709_10110281 | |||
| 318 | Ga0207661_10369985 | |||
| 319 | Ga0207667_10253649 | |||
| 320 | Ga0207712_10141288 | |||
| 321 | Ga0207668_10057035 | |||
| 322 | Ga0207668_10115780 | |||
| 323 | Ga0207668_10198921 | |||
| 324 | Ga0207640_10065701 | |||
| 325 | Ga0207658_10008494 | |||
| 326 | Ga0207658_10341732 | |||
| 327 | Ga0207641_10009378 | |||
| 328 | Ga0207641_10086661 | |||
| 329 | Ga0207648_10156830 | |||
| 330 | Ga0207675_100304916 | |||
| 331 | Ga0207683_10068504 | |||
| 332 | Ga0207428_10000496 | |||
| 333 | Ga0268266_10014399 | |||
| 334 | Ga0268266_10035268 | |||
| 335 | Ga0268266_10092205 | |||
| 336 | Ga0268265_10121561 | |||
| 337 | Ga0268264_10003187 | |||
| 338 | Ga0268264_10123432 | |||
| 339 | Ga0268264_10161456 | |||
| 340 | Ga0265327_10002217 | |||
| 341 | Ga0307513_10034081 | |||
| 342 | Ga0307408_100044733 | |||
| 343 | Ga0307405_10017262 | |||
| 344 | Ga0307518_10000112 | |||
| 345 | Ga0307518_10058201 | |||
| 346 | Ga0307410_10062400 | |||
| 347 | Ga0307406_10069015 | |||
| 348 | Ga0307412_10081899 | |||
| 349 | Ga0307409_100258367 | |||
| 350 | Ga0307414_10070163 | |||
| 351 | Ga0307415_100115097 | |||
| 352 | Ga0307507_10067703 | |||
| 353 | Ga0307507_10121196 | |||
| 354 | Ga0373956_0012279 | |||
| 355 | Ga0395899_0035177 | |||
| 356 | Ga0395899_0051022 | |||
| 357 | Ga0395900_0024605 | |||
| 358 | Ga0395900_0067337 | |||
| 359 | Ga0395900_0152784 | |||
| 360 | Ga0395898_0018886 | |||
| 361 | Ga0395898_0139667 | |||
| 362 | Ga0395898_0243763 | |||
| 363 | Ga0395905_0001912 | |||
| 364 | Ga0395905_0074287 | |||
| 365 | Ga0436364_0199487 | |||
| 366 | Ga0395901_0015509 | |||
| 367 | Ga0395901_0068504 | |||
| 368 | Ga0466972_0019216 | |||
| 369 | Ga0466972_0101212 | |||
| 370 | Ga0466965_0000817 | |||
| 371 | Ga0466965_0004645 | |||
| 372 | Ga0466965_0016165 | |||
| 373 | Ga0466966_0057212 | |||
| 374 | Ga0466961_0026058 | |||
| 375 | Ga0466971_0016391 | |||
| 376 | Ga0466968_0005313 | |||
| 377 | Ga0466968_0051054 | |||
| 378 | Ga0466970_0033865 | |||
| 379 | Ga0466957_0065004 | |||
| 380 | Ga0466957_0065644 | |||
| 381 | Ga0466957_0092578 | |||
| 382 | Ga0466960_0000806 | |||
| 383 | Ga0466960_0003220 | |||
| 384 | Ga0466960_0011799 | |||
| 385 | Ga0466959_0077181 | |||
| 386 | Ga0466967_0635775 | |||
| 387 | Ga0495603_0025984 | |||
| 388 | Ga0495629_0041806 | |||
| 389 | Ga0495653_0029530 | |||
| 390 | Ga0495594_0065356 | |||
| 391 | Ga0495588_0007706 | |||
| 392 | Ga0495636_0001393 | |||
| 393 | Ga0495687_019278 | |||
| 394 | Ga0495685_021219 | |||
| 395 | Ga0496102_0018913 | |||
| 396 | Ga0496102_0367918 | |||
| 397 | Ga0496105_0263663 | |||
| 398 | Ga0496108_0022865 | |||
| 399 | Ga0496108_0153968 | |||
| 400 | Ga0496108_0184010 | |||
| 401 | Ga0496108_0252551 | |||
| 402 | Ga0496109_0014875 | |||
| 403 | Ga0496109_0102680 | |||
| 404 | Ga0496109_0144323 | |||
| 405 | Ga0496110_0013479 | |||
| 406 | Ga0496110_0313542 | |||
| 407 | Ga0496110_0441347 | |||
| 408 | Ga0496112_0020695 | |||
| 409 | Ga0496113_0022556 | |||
| 410 | Ga0496113_0188625 | |||
| 411 | Ga0496115_0229367 | |||
| 412 | Ga0501069_0174226 | |||
| 413 | Ga0501202_004684 | |||
| 414 | nmdc:mga00v17_139201_c1 | |||
| 415 | nmdc:mga00v17_2959_c1 | |||
| 416 | nmdc:mga06z11_17313_c1 | |||
| 417 | nmdc:mga07m45_92598_c1 | |||
| 418 | nmdc:mga05p37_15040_c1 | |||
| 419 | nmdc:mga05p37_351587_c1 | |||
| 420 | nmdc:mga05p37_43799_c1 | |||
| 421 | nmdc:mga09592_58510_c1 | |||
| 422 | nmdc:mga09592_82_c1 | |||
| 423 | nmdc:mga0qj67_30444_c1 | |||
| 424 | nmdc:mga06r32_3723_c1 | |||
| 425 | nmdc:mga06r32_80562_c1 | |||
| 426 | nmdc:mga08y16_2057_c1 | |||
| 427 | nmdc:mga0n895_1607_c1 | |||
| 428 | nmdc:mga0rr50_7529_c1 | |||
| 429 | nmdc:mga0a205_5269_c1 | |||
| 430 | nmdc:mga0sz30_1979_c1 | |||
| 431 | Ga0466962_0009781 | |||
| 432 | 2523387665 | |||
| 433 | 2548698671 | |||
| 434 | 2586064126 | |||
| 435 | 2644631571 | |||
| 436 | 2744954659 | |||
| 437 | 2776371754 | |||
| 438 | 2791913086 | |||
| 439 | 2795785810 | |||
| 440 | 2795791470 | |||
| 441 | 2809586631 | |||
| 442 | 2863068892 | |||
| 443 | 2866553083 | |||
| 444 | 2866618710 | |||
| 445 | 2891328020 | |||
| 446 | 2899360248 | |||
| 447 | 2899372802 | |||
| 448 | 2915772425 | |||
| 449 | 2919719345 | |||
| 450 | 2946079267 | |||
| 451 | 8054475493 | |||
| 452 | 8056215387 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4eeb-assembly1.cif.gz_C | cora coiled-coil mutant under mg2+ absence | 0.8378 | 36 | 361 |
| 4egw-assembly1.cif.gz_B | the structure of the soluble domain of cora from methanocaldococcus jannaschii | 0.8338 | 36 | 295 |
| 4eeb-assembly1.cif.gz_C | cora coiled-coil mutant under mg2+ absence | 0.8282 | 36 | 361 |
| 5jtg-assembly1.cif.gz_E | crystal structure of thermotoga maritima mutant d89k/d253k | 0.8258 | 36 | 361 |
| 8slb-assembly1.cif.gz_A | x-ray structure of cora n-terminal domain in complex with conformation-specific synthetic antibody c12 | 0.8245 | 36 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O50455_48_179_3.30.460.20 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;CorA soluble domain-like | 0.9938 | 51 | 177 | 3.30.460.20 |
| af_O50455_180_293_1.20.58.340 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.964 | 179 | 291 | 1.20.58.340 |
| af_O50455_48_179_3.30.460.20 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;CorA soluble domain-like | 0.9491 | 51 | 177 | 3.30.460.20 |
| af_O50455_180_293_1.20.58.340 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.9476 | 179 | 291 | 1.20.58.340 |
| af_Q58439_132_258_1.20.58.340 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.9344 | 181 | 305 | 1.20.58.340 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y3G1W9-F1-model_v4 | Magnesium and cobalt transport protein CorA | 0.955 | 37 | 333 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
| AF-X8DYD1-F1-model_v4 | CorA-like Mg2+ transporter family protein | 0.9541 | 53 | 177 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
| AF-X8F1S0-F1-model_v4 | deleted | 0.9457 | 59 | 171 |
|
| AF-A0A7Y3G1W9-F1-model_v4 | Magnesium and cobalt transport protein CorA | 0.9455 | 37 | 333 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
| AF-A0A529L5Y1-F1-model_v4 | Magnesium transporter | 0.9426 | 69 | 286 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |