F337393

General Info

Members Datasets Scaffolds Average Seq Length
225 181 217 111

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10326401|Ga0065704_103264011
Length 114
Sequence VTSSKPARYGVLLSAGAEQDLEAIHDYIAEFDCVANANYVLDQLMEVVESLSQFPERGSYPKELVALGIKEYRQTSFKPYRVIYRVAGSQVIIYLIADGRRDMQSVLARRLLGA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
4 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
5 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
6 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
7 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
8 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
9 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
10 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
75 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
76 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
77 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
78 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
82 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
94 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
98 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
99 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
100 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
101 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
104 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
105 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
106 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
107 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
108 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
166 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
179 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
180 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
181 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.22
Nodule 0
Rhizoplane 1.78
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 5.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1665328 2162886006 Bacteria 2413
2 MRS1b_contig_9332685 2162886011 Bacteria 1474
3 JGI24740J21852_10000035 3300001979 Bacteria 44922
4 rootH2_10172490 3300003320 Bacteria 3428
5 Ga0065704_10326401 3300005289 Bacteria 844
6 Ga0065707_10081730 3300005295 Bacteria 59162
7 Ga0068869_101698352 3300005334 Unclassified 563
8 Ga0070660_100402607 3300005339 Bacteria 1132
9 Ga0070660_101596843 3300005339 Bacteria 555
10 Ga0070668_100481187 3300005347 Bacteria 1072
11 Ga0070675_101638145 3300005354 Unclassified 594
12 Ga0070674_100091401 3300005356 Bacteria 2198
13 Ga0070674_101584497 3300005356 Bacteria 590
14 Ga0070688_100113931 3300005365 Bacteria 1802
15 Ga0070701_10819041 3300005438 Bacteria 636
16 Ga0070705_101436490 3300005440 Unclassified 576
17 Ga0070663_100170907 3300005455 Bacteria 1680
18 Ga0068867_100334268 3300005459 Bacteria 1259
19 Ga0070698_100485315 3300005471 Bacteria 1173
20 Ga0068853_100663063 3300005539 Bacteria 993
21 Ga0070672_101260314 3300005543 Bacteria 659
22 Ga0070686_100768038 3300005544 Unclassified 774
23 Ga0070665_100003659 3300005548 Bacteria 16287
24 Ga0070665_100046337 3300005548 Bacteria 4368
25 Ga0068855_100179773 3300005563 Bacteria 2392
26 Ga0068855_100799355 3300005563 Bacteria 1003
27 Ga0070664_101094750 3300005564 Unclassified 750
28 Ga0068856_100023031 3300005614 Bacteria 6056
29 Ga0070702_100504721 3300005615 Bacteria 889
30 Ga0068861_101098666 3300005719 Bacteria 764
31 Ga0068862_102397415 3300005844 Unclassified 539
32 Ga0075365_10338363 3300006038 Bacteria 1060
33 Ga0075362_10006402 3300006177 Bacteria 4389
34 Ga0075370_10002770 3300006353 Bacteria 8211
35 Ga0068865_100434169 3300006881 Bacteria 1082
36 Ga0105247_10028485 3300009101 Bacteria 3380
37 Ga0105243_10126299 3300009148 Bacteria 2164
38 Ga0105237_10371775 3300009545 Bacteria 1434
39 Ga0105249_10718821 3300009553 Bacteria 1060
40 Ga0157370_10030592 3300013104 Bacteria 5275
41 Ga0157378_11232352 3300013297 Bacteria 788
42 Ga0157375_13012217 3300013308 Bacteria 562
43 Ga0157380_10000227 3300014326 Bacteria 33644
44 Ga0157380_11434567 3300014326 Bacteria 742
45 Ga0157377_10213947 3300014745 Bacteria 1230
46 Ga0157376_11948549 3300014969 Bacteria 625
47 Ga0213872_10006423 3300021361 Bacteria 5905
48 Ga0213872_10008692 3300021361 Bacteria 4905
49 Ga0207710_10014993 3300025900 Bacteria 3273
50 Ga0207657_10276928 3300025919 Bacteria 1333
51 Ga0207690_10056273 3300025932 Bacteria 2652
52 Ga0207706_10735280 3300025933 Bacteria 841
53 Ga0207709_10152939 3300025935 Bacteria 1600
54 Ga0207669_10029328 3300025937 Bacteria 3042
55 Ga0207704_10158090 3300025938 Bacteria 1609
56 Ga0207691_10490849 3300025940 Bacteria 1043
57 Ga0207691_10616904 3300025940 Bacteria 918
58 Ga0207689_10824534 3300025942 Bacteria 783
59 Ga0207679_11948834 3300025945 Unclassified 535
60 Ga0207667_10067061 3300025949 Bacteria 3739
61 Ga0207668_10479744 3300025972 Bacteria 1066
62 Ga0207639_11334125 3300026041 Bacteria 673
63 Ga0207678_10816065 3300026067 Bacteria 824
64 Ga0207702_10186619 3300026078 Bacteria 1913
65 Ga0207674_12103987 3300026116 Unclassified 528
66 Ga0209970_1031545 3300027614 Bacteria 922
67 Ga0209983_1033556 3300027665 Bacteria 1098
68 Ga0209974_10178610 3300027876 Bacteria 777
69 Ga0268266_10025609 3300028379 Bacteria 5018
70 Ga0268266_10050419 3300028379 Bacteria 3571
71 Ga0265327_10001173 3300031251 Bacteria 35562
72 Ga0265327_10088174 3300031251 Bacteria 1518
73 Ga0307509_10508595 3300031507 Bacteria 888
74 Ga0307408_100550995 3300031548 Bacteria 1017
75 Ga0307408_100652257 3300031548 Bacteria 941
76 Ga0316575_10006896 3300031665 Bacteria 4111
77 Ga0316579_10020094 3300031691 Bacteria 2956
78 Ga0316576_10002403 3300031727 Bacteria 10628
79 Ga0316578_10018853 3300031728 Bacteria 3789
80 Ga0316577_10001141 3300031733 Bacteria 12150
81 Ga0307412_10577160 3300031911 Bacteria 948
82 Ga0307412_10614003 3300031911 Bacteria 923
83 Ga0307416_100065111 3300032002 Bacteria 2993
84 Ga0316585_10000060 3300032137 Bacteria 17679
85 Ga0316580_10005606 3300032139 Bacteria 3672
86 Ga0373934_0080752 3300035086 Bacteria 1306
87 Ga0373923_0126164 3300035111 Bacteria 1147
88 Ga0373954_0002548 3300035118 Bacteria 7648
89 Ga0373955_0150158 3300035172 Bacteria 1371
90 Ga0316574_0000004 3300035398 Bacteria 49638
91 Ga0373933_0017313 3300035724 Bacteria 4042
92 Ga0373933_0326262 3300035724 Bacteria 996
93 Ga0373937_0000786 3300036401 Bacteria 27181
94 Ga0316582_0000432 3300036647 Bacteria 15379
95 Ga0316584_0000070 3300036712 Bacteria 40891
96 Ga0436361_0019489 3300039447 Bacteria 5249
97 Ga0436361_0418957 3300039447 Bacteria 1708
98 Ga0436361_0735830 3300039447 Bacteria 5931
99 Ga0439436_0007558 3300041404 Bacteria 3344
100 Ga0439436_0044635 3300041404 Bacteria 1262
101 Ga0439439_0039237 3300041406 Bacteria 1223
102 Ga0439439_0095456 3300041406 Bacteria 815
103 Ga0439461_0061393 3300041410 Bacteria 854
104 Ga0439466_0022340 3300041411 Bacteria 2234
105 Ga0439466_0081421 3300041411 Bacteria 1021
106 Ga0451807_0077485 3300041486 Bacteria 1382
107 Ga0439431_0011768 3300041997 Bacteria 2003
108 Ga0439431_0084555 3300041997 Bacteria 859
109 Ga0439431_0192950 3300041997 Bacteria 591
110 Ga0439433_0001584 3300041999 Bacteria 4725
111 Ga0439445_0016302 3300042004 Bacteria 1826
112 Ga0439432_006764 3300042006 Bacteria 4083
113 Ga0439432_029432 3300042006 Bacteria 1785
114 Ga0439449_0004040 3300042007 Bacteria 5681
115 Ga0439449_0005417 3300042007 Bacteria 4889
116 Ga0439452_006518 3300042010 Bacteria 3654
117 Ga0439452_054284 3300042010 Bacteria 910
118 Ga0439457_029774 3300042014 Bacteria 1210
119 Ga0439457_143161 3300042014 Bacteria 572
120 Ga0439462_0007168 3300042015 Bacteria 2789
121 Ga0439462_0012763 3300042015 Bacteria 2149
122 Ga0450920_044817 3300042122 Bacteria 884
123 Ga0450921_033998 3300042123 Bacteria 528
124 Ga0450898_010192 3300042134 Bacteria 1518
125 Ga0439446_0023137 3300042156 Bacteria 1766
126 Ga0439434_0006713 3300042435 Bacteria 3363
127 Ga0450918_038621 3300042531 Bacteria 854
128 Ga0466969_0106040 3300044656 Bacteria 1319
129 Ga0453683_0495574 3300044673 Bacteria 792
130 Ga0453683_0528463 3300044673 Bacteria 767
131 Ga0466961_0582616 3300044693 Bacteria 673
132 Ga0466963_0028204 3300044694 Bacteria 3602
133 Ga0466968_0041444 3300044735 Bacteria 1943
134 Ga0466970_0015503 3300044765 Bacteria 3920
135 Ga0466957_0123411 3300044842 Bacteria 1653
136 Ga0466959_0215112 3300045049 Bacteria 1334
137 Ga0451576_0795005 3300045051 Bacteria 993
138 Ga0466967_0209286 3300045976 Bacteria 1849
139 Ga0466967_0256017 3300045976 Bacteria 1673
140 Ga0495638_0012887 3300046460 Bacteria 5712
141 Ga0495605_0073484 3300046474 Bacteria 1610
142 Ga0495584_0016342 3300046491 Bacteria 3784
143 Ga0495584_0130953 3300046491 Bacteria 1272
144 Ga0495584_0356876 3300046491 Bacteria 742
145 Ga0495585_0156837 3300046492 Bacteria 1183
146 Ga0495583_0000441 3300046506 Bacteria 62379
147 Ga0495606_0195581 3300046507 Bacteria 1156
148 Ga0495587_0536742 3300046536 Unclassified 646
149 Ga0495609_0002156 3300046538 Bacteria 12370
150 Ga0495597_0151396 3300046542 Bacteria 951
151 Ga0495645_0549277 3300046543 Bacteria 716
152 Ga0495667_0300655 3300046559 Bacteria 1017
153 Ga0495611_0077495 3300046648 Bacteria 1524
154 Ga0495611_0198378 3300046648 Bacteria 936
155 Ga0495625_0004867 3300046660 Bacteria 12520
156 Ga0495661_0078312 3300046665 Bacteria 1912
157 Ga0495661_0235341 3300046665 Bacteria 942
158 Ga0495588_0332515 3300046674 Bacteria 799
159 Ga0495657_0120723 3300046675 Bacteria 1651
160 Ga0495670_0023419 3300046691 Bacteria 3047
161 Ga0495604_0054687 3300047317 Bacteria 3079
162 Ga0495672_0157246 3300047320 Bacteria 1172
163 Ga0495676_0119807 3300047321 Unclassified 1916
164 Ga0495602_0893902 3300048088 Unclassified 591
165 Ga0496100_0062357 3300048903 Bacteria 2460
166 Ga0496108_1611360 3300048911 Bacteria 537
167 Ga0496114_0323486 3300048917 Bacteria 1363
168 Ga0496118_0014630 3300048921 Bacteria 7334
169 Ga0496118_0051942 3300048921 Bacteria 3132
170 Ga0496121_0019198 3300048924 Bacteria 6847
171 Ga0496125_0377928 3300048928 Bacteria 836
172 Ga0496126_0019765 3300048929 Bacteria 6627
173 Ga0501031_0645229 3300049568 Bacteria 680
174 Ga0501032_0034310 3300049569 Bacteria 3474
175 Ga0501032_0153330 3300049569 Bacteria 1514
176 Ga0501033_0004533 3300049570 Bacteria 11122
177 Ga0501034_0000826 3300049571 Bacteria 46024
178 Ga0501036_0157488 3300049572 Bacteria 1915
179 Ga0501036_0198661 3300049572 Bacteria 1687
180 Ga0501037_0163014 3300049573 Unclassified 1589
181 Ga0501037_0282131 3300049573 Bacteria 1157
182 Ga0501037_0373175 3300049573 Bacteria 981
183 Ga0501037_0412428 3300049573 Bacteria 925
184 Ga0501038_0080146 3300049574 Bacteria 2752
185 Ga0501038_0131064 3300049574 Bacteria 2058
186 Ga0501039_0039681 3300049575 Bacteria 3636
187 Ga0501046_0058361 3300049580 Bacteria 3026
188 Ga0501046_0058890 3300049580 Bacteria 3010
189 Ga0501068_0008166 3300049584 Bacteria 5816
190 Ga0501069_0608577 3300049585 Bacteria 656
191 Ga0501070_0023706 3300049586 Bacteria 5142
192 Ga0501070_0094030 3300049586 Bacteria 2480
193 Ga0501073_0621171 3300049589 Bacteria 746
194 Ga0501074_0081194 3300049590 Bacteria 2325
195 Ga0501075_1467388 3300049591 Bacteria 516
196 Ga0501249_185195 3300049679 Unclassified 540
197 Ga0501225_0059418 3300049705 Bacteria 1074
198 Ga0501080_0318665 3300049742 Bacteria 1408
199 Ga0501081_1205088 3300049743 Unclassified 574
200 Ga0501035_0044277 3300049822 Bacteria 4008
201 Ga0501035_0115783 3300049822 Bacteria 2346
202 Ga0501044_0015489 3300049823 Bacteria 8212
203 Ga0501044_0156514 3300049823 Bacteria 2258
204 Ga0501045_0321923 3300049824 Bacteria 1151
205 Ga0501045_0770728 3300049824 Bacteria 709
206 nmdc:mga03683_2893_c1 3300050489 Bacteria 5415
207 nmdc:mga03n38_177542_c1 3300050490 Bacteria 1089
208 nmdc:mga03n38_305647_c1 3300050490 Bacteria 855
209 nmdc:mga0yw44_732145_c1 3300050492 Bacteria 672
210 nmdc:mga0k408_188115_c1 3300050493 Bacteria 1232
211 nmdc:mga0k408_917237_c1 3300050493 Bacteria 508
212 nmdc:mga07m45_38573_c1 3300050496 Bacteria 2666
213 Ga0500595_058353 3300053119 Bacteria 1173
214 Ga0500559_0117512 3300053136 Bacteria 1235
215 Ga0500634_0075836 3300053161 Bacteria 1747
216 Ga0500609_007483 3300053731 Bacteria 1476
217 Ga0590071_002412 3300059421 Bacteria 4698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0014630 Ga0496118_0014630_3590_3916 94
2 3300053731 Ga0500609_007483 Ga0500609_007483_348_674 95
3 3300053136 Ga0500559_0117512 Ga0500559_0117512_437_808 102
4 3300050490 nmdc:mga03n38_305647_c1 nmdc:mga03n38_305647_c1_461_790 104
5 3300050493 nmdc:mga0k408_188115_c1 nmdc:mga0k408_188115_c1_11_340 104
6 3300049743 Ga0501081_1205088 Ga0501081_1205088_174_494 106
7 3300005339 Ga0070660_101596843 Ga0070660_1015968432 107
8 3300044673 Ga0453683_0528463 Ga0453683_0528463_121_459 107
9 3300046491 Ga0495584_0356876 Ga0495584_0356876_114_452 107
10 iso_pu_bacteria 2989392574 2989393729 107
11 2162886006 SwRhRL3b_contig_1665328 SwRhRL3b_0291.00002170 108
12 2162886011 MRS1b_contig_9332685 MRS1b_0507.00001080 108
13 3300001979 JGI24740J21852_10000035 JGI24740J21852_100000357 108
14 3300003320 rootH2_10172490 rootH2_101724902 108
15 3300005289 Ga0065704_10326401 Ga0065704_103264011 108
16 3300005295 Ga0065707_10081730 Ga0065707_1008173029 108
17 3300005334 Ga0068869_101698352 Ga0068869_1016983521 108
18 3300005339 Ga0070660_100402607 Ga0070660_1004026072 108
19 3300005347 Ga0070668_100481187 Ga0070668_1004811872 108
20 3300005354 Ga0070675_101638145 Ga0070675_1016381451 108
21 3300005356 Ga0070674_100091401 Ga0070674_1000914012 108
22 3300005356 Ga0070674_101584497 Ga0070674_1015844972 108
23 3300005365 Ga0070688_100113931 Ga0070688_1001139312 108
24 3300005438 Ga0070701_10819041 Ga0070701_108190411 108
25 3300005440 Ga0070705_101436490 Ga0070705_1014364902 108
26 3300005455 Ga0070663_100170907 Ga0070663_1001709071 108
27 3300005459 Ga0068867_100334268 Ga0068867_1003342681 108
28 3300005471 Ga0070698_100485315 Ga0070698_1004853152 108
29 3300005539 Ga0068853_100663063 Ga0068853_1006630633 108
30 3300005543 Ga0070672_101260314 Ga0070672_1012603141 108
31 3300005544 Ga0070686_100768038 Ga0070686_1007680382 108
32 3300005548 Ga0070665_100003659 Ga0070665_10000365913 108
33 3300005548 Ga0070665_100046337 Ga0070665_1000463374 108
34 3300005563 Ga0068855_100179773 Ga0068855_1001797732 108
35 3300005563 Ga0068855_100799355 Ga0068855_1007993552 108
36 3300005564 Ga0070664_101094750 Ga0070664_1010947501 108
37 3300005614 Ga0068856_100023031 Ga0068856_1000230318 108
38 3300005615 Ga0070702_100504721 Ga0070702_1005047211 108
39 3300005719 Ga0068861_101098666 Ga0068861_1010986661 108
40 3300005844 Ga0068862_102397415 Ga0068862_1023974151 108
41 3300006038 Ga0075365_10338363 Ga0075365_103383633 108
42 3300006177 Ga0075362_10006402 Ga0075362_100064026 108
43 3300006353 Ga0075370_10002770 Ga0075370_100027703 108
44 3300006881 Ga0068865_100434169 Ga0068865_1004341692 108
45 3300009101 Ga0105247_10028485 Ga0105247_100284852 108
46 3300009148 Ga0105243_10126299 Ga0105243_101262993 108
47 3300009545 Ga0105237_10371775 Ga0105237_103717752 108
48 3300009553 Ga0105249_10718821 Ga0105249_107188211 108
49 3300013104 Ga0157370_10030592 Ga0157370_100305928 108
50 3300013297 Ga0157378_11232352 Ga0157378_112323521 108
51 3300013308 Ga0157375_13012217 Ga0157375_130122171 108
52 3300014326 Ga0157380_10000227 Ga0157380_1000022720 108
53 3300014326 Ga0157380_11434567 Ga0157380_114345672 108
54 3300014745 Ga0157377_10213947 Ga0157377_102139472 108
55 3300014969 Ga0157376_11948549 Ga0157376_119485492 108
56 3300021361 Ga0213872_10006423 Ga0213872_100064239 108
57 3300021361 Ga0213872_10008692 Ga0213872_100086924 108
58 3300025900 Ga0207710_10014993 Ga0207710_100149935 108
59 3300025919 Ga0207657_10276928 Ga0207657_102769282 108
60 3300025932 Ga0207690_10056273 Ga0207690_100562734 108
61 3300025933 Ga0207706_10735280 Ga0207706_107352801 108
62 3300025935 Ga0207709_10152939 Ga0207709_101529392 108
63 3300025937 Ga0207669_10029328 Ga0207669_100293284 108
64 3300025938 Ga0207704_10158090 Ga0207704_101580903 108
65 3300025940 Ga0207691_10490849 Ga0207691_104908491 108
66 3300025940 Ga0207691_10616904 Ga0207691_106169042 108
67 3300025942 Ga0207689_10824534 Ga0207689_108245342 108
68 3300025945 Ga0207679_11948834 Ga0207679_119488341 108
69 3300025949 Ga0207667_10067061 Ga0207667_100670615 108
70 3300025972 Ga0207668_10479744 Ga0207668_104797442 108
71 3300026041 Ga0207639_11334125 Ga0207639_113341251 108
72 3300026067 Ga0207678_10816065 Ga0207678_108160652 108
73 3300026078 Ga0207702_10186619 Ga0207702_101866193 108
74 3300026116 Ga0207674_12103987 Ga0207674_121039871 108
75 3300027614 Ga0209970_1031545 Ga0209970_10315452 108
76 3300027665 Ga0209983_1033556 Ga0209983_10335562 108
77 3300027876 Ga0209974_10178610 Ga0209974_101786102 108
78 3300028379 Ga0268266_10025609 Ga0268266_100256094 108
79 3300028379 Ga0268266_10050419 Ga0268266_100504194 108
80 3300031251 Ga0265327_10001173 Ga0265327_1000117310 108
81 3300031251 Ga0265327_10088174 Ga0265327_100881741 108
82 3300031507 Ga0307509_10508595 Ga0307509_105085952 108
83 3300031548 Ga0307408_100550995 Ga0307408_1005509952 108
84 3300031548 Ga0307408_100652257 Ga0307408_1006522572 108
85 3300031665 Ga0316575_10006896 Ga0316575_100068962 108
86 3300031691 Ga0316579_10020094 Ga0316579_100200945 108
87 3300031727 Ga0316576_10002403 Ga0316576_100024034 108
88 3300031728 Ga0316578_10018853 Ga0316578_100188532 108
89 3300031733 Ga0316577_10001141 Ga0316577_100011416 108
90 3300031911 Ga0307412_10577160 Ga0307412_105771602 108
91 3300031911 Ga0307412_10614003 Ga0307412_106140032 108
92 3300032002 Ga0307416_100065111 Ga0307416_1000651112 108
93 3300032137 Ga0316585_10000060 Ga0316585_100000605 108
94 3300032139 Ga0316580_10005606 Ga0316580_100056062 108
95 3300035086 Ga0373934_0080752 Ga0373934_0080752_291_617 108
96 3300035111 Ga0373923_0126164 Ga0373923_0126164_345_671 108
97 3300035118 Ga0373954_0002548 Ga0373954_0002548_7024_7350 108
98 3300035172 Ga0373955_0150158 Ga0373955_0150158_570_896 108
99 3300035398 Ga0316574_0000004 Ga0316574_0000004_48084_48425 108
100 3300035724 Ga0373933_0017313 Ga0373933_0017313_1964_2290 108
101 3300035724 Ga0373933_0326262 Ga0373933_0326262_175_507 108
102 3300036401 Ga0373937_0000786 Ga0373937_0000786_1333_1659 108
103 3300036647 Ga0316582_0000432 Ga0316582_0000432_2809_3150 108
104 3300036712 Ga0316584_0000070 Ga0316584_0000070_1214_1555 108
105 3300039447 Ga0436361_0019489 Ga0436361_0019489_3661_4002 108
106 3300039447 Ga0436361_0418957 Ga0436361_0418957_698_1039 108
107 3300039447 Ga0436361_0735830 Ga0436361_0735830_5520_5861 108
108 3300041404 Ga0439436_0007558 Ga0439436_0007558_2844_3182 108
109 3300041404 Ga0439436_0044635 Ga0439436_0044635_493_834 108
110 3300041406 Ga0439439_0039237 Ga0439439_0039237_555_893 108
111 3300041406 Ga0439439_0095456 Ga0439439_0095456_248_589 108
112 3300041410 Ga0439461_0061393 Ga0439461_0061393_298_636 108
113 3300041411 Ga0439466_0022340 Ga0439466_0022340_760_1098 108
114 3300041411 Ga0439466_0081421 Ga0439466_0081421_333_674 108
115 3300041486 Ga0451807_0077485 Ga0451807_0077485_572_904 108
116 3300041997 Ga0439431_0011768 Ga0439431_0011768_466_804 108
117 3300041997 Ga0439431_0084555 Ga0439431_0084555_311_652 108
118 3300041997 Ga0439431_0192950 Ga0439431_0192950_232_573 108
119 3300041999 Ga0439433_0001584 Ga0439433_0001584_1152_1490 108
120 3300042004 Ga0439445_0016302 Ga0439445_0016302_1137_1475 108
121 3300042006 Ga0439432_006764 Ga0439432_006764_1142_1480 108
122 3300042006 Ga0439432_029432 Ga0439432_029432_1116_1457 108
123 3300042007 Ga0439449_0004040 Ga0439449_0004040_4888_5229 108
124 3300042007 Ga0439449_0005417 Ga0439449_0005417_2763_3101 108
125 3300042010 Ga0439452_006518 Ga0439452_006518_2276_2614 108
126 3300042010 Ga0439452_054284 Ga0439452_054284_263_604 108
127 3300042014 Ga0439457_029774 Ga0439457_029774_811_1149 108
128 3300042014 Ga0439457_143161 Ga0439457_143161_193_537 108
129 3300042015 Ga0439462_0007168 Ga0439462_0007168_603_944 108
130 3300042015 Ga0439462_0012763 Ga0439462_0012763_1168_1506 108
131 3300042122 Ga0450920_044817 Ga0450920_044817_317_658 108
132 3300042123 Ga0450921_033998 Ga0450921_033998_88_429 108
133 3300042134 Ga0450898_010192 Ga0450898_010192_175_516 108
134 3300042156 Ga0439446_0023137 Ga0439446_0023137_409_750 108
135 3300042435 Ga0439434_0006713 Ga0439434_0006713_866_1204 108
136 3300042531 Ga0450918_038621 Ga0450918_038621_478_819 108
137 3300044656 Ga0466969_0106040 Ga0466969_0106040_557_898 108
138 3300044673 Ga0453683_0495574 Ga0453683_0495574_438_779 108
139 3300044693 Ga0466961_0582616 Ga0466961_0582616_203_532 108
140 3300044694 Ga0466963_0028204 Ga0466963_0028204_3160_3489 108
141 3300044735 Ga0466968_0041444 Ga0466968_0041444_398_739 108
142 3300044765 Ga0466970_0015503 Ga0466970_0015503_1890_2231 108
143 3300044842 Ga0466957_0123411 Ga0466957_0123411_109_438 108
144 3300045049 Ga0466959_0215112 Ga0466959_0215112_377_718 108
145 3300045051 Ga0451576_0795005 Ga0451576_0795005_411_752 108
146 3300045976 Ga0466967_0209286 Ga0466967_0209286_1056_1397 108
147 3300045976 Ga0466967_0256017 Ga0466967_0256017_701_1030 108
148 3300046460 Ga0495638_0012887 Ga0495638_0012887_3581_3907 108
149 3300046474 Ga0495605_0073484 Ga0495605_0073484_191_532 108
150 3300046491 Ga0495584_0016342 Ga0495584_0016342_600_941 108
151 3300046491 Ga0495584_0130953 Ga0495584_0130953_489_830 108
152 3300046492 Ga0495585_0156837 Ga0495585_0156837_199_540 108
153 3300046506 Ga0495583_0000441 Ga0495583_0000441_14730_15071 108
154 3300046507 Ga0495606_0195581 Ga0495606_0195581_139_465 108
155 3300046536 Ga0495587_0536742 Ga0495587_0536742_105_431 108
156 3300046538 Ga0495609_0002156 Ga0495609_0002156_11074_11415 108
157 3300046542 Ga0495597_0151396 Ga0495597_0151396_296_637 108
158 3300046543 Ga0495645_0549277 Ga0495645_0549277_345_686 108
159 3300046559 Ga0495667_0300655 Ga0495667_0300655_437_763 108
160 3300046648 Ga0495611_0077495 Ga0495611_0077495_726_1067 108
161 3300046648 Ga0495611_0198378 Ga0495611_0198378_431_772 108
162 3300046660 Ga0495625_0004867 Ga0495625_0004867_8319_8645 108
163 3300046665 Ga0495661_0078312 Ga0495661_0078312_511_852 108
164 3300046665 Ga0495661_0235341 Ga0495661_0235341_232_573 108
165 3300046674 Ga0495588_0332515 Ga0495588_0332515_421_762 108
166 3300046675 Ga0495657_0120723 Ga0495657_0120723_1167_1493 108
167 3300046691 Ga0495670_0023419 Ga0495670_0023419_515_856 108
168 3300047317 Ga0495604_0054687 Ga0495604_0054687_69_410 108
169 3300047320 Ga0495672_0157246 Ga0495672_0157246_544_885 108
170 3300047321 Ga0495676_0119807 Ga0495676_0119807_1540_1881 108
171 3300048088 Ga0495602_0893902 Ga0495602_0893902_64_390 108
172 3300048903 Ga0496100_0062357 Ga0496100_0062357_1622_1954 108
173 3300048911 Ga0496108_1611360 Ga0496108_1611360_28_369 108
174 3300048917 Ga0496114_0323486 Ga0496114_0323486_563_895 108
175 3300048921 Ga0496118_0051942 Ga0496118_0051942_1989_2315 108
176 3300048924 Ga0496121_0019198 Ga0496121_0019198_4940_5266 108
177 3300048928 Ga0496125_0377928 Ga0496125_0377928_485_826 108
178 3300048929 Ga0496126_0019765 Ga0496126_0019765_3388_3729 108
179 3300049568 Ga0501031_0645229 Ga0501031_0645229_251_592 108
180 3300049569 Ga0501032_0034310 Ga0501032_0034310_1342_1686 108
181 3300049569 Ga0501032_0153330 Ga0501032_0153330_770_1111 108
182 3300049570 Ga0501033_0004533 Ga0501033_0004533_8181_8522 108
183 3300049571 Ga0501034_0000826 Ga0501034_0000826_27864_28193 108
184 3300049572 Ga0501036_0157488 Ga0501036_0157488_1150_1491 108
185 3300049572 Ga0501036_0198661 Ga0501036_0198661_1046_1375 108
186 3300049573 Ga0501037_0163014 Ga0501037_0163014_851_1192 108
187 3300049573 Ga0501037_0282131 Ga0501037_0282131_440_784 108
188 3300049573 Ga0501037_0373175 Ga0501037_0373175_343_672 108
189 3300049573 Ga0501037_0412428 Ga0501037_0412428_266_607 108
190 3300049574 Ga0501038_0080146 Ga0501038_0080146_925_1266 108
191 3300049574 Ga0501038_0131064 Ga0501038_0131064_92_436 108
192 3300049575 Ga0501039_0039681 Ga0501039_0039681_1306_1650 108
193 3300049580 Ga0501046_0058361 Ga0501046_0058361_950_1279 108
194 3300049580 Ga0501046_0058890 Ga0501046_0058890_2511_2852 108
195 3300049584 Ga0501068_0008166 Ga0501068_0008166_1712_2041 108
196 3300049585 Ga0501069_0608577 Ga0501069_0608577_109_450 108
197 3300049586 Ga0501070_0023706 Ga0501070_0023706_3075_3416 108
198 3300049586 Ga0501070_0094030 Ga0501070_0094030_1391_1720 108
199 3300049589 Ga0501073_0621171 Ga0501073_0621171_323_664 108
200 3300049590 Ga0501074_0081194 Ga0501074_0081194_659_1000 108
201 3300049591 Ga0501075_1467388 Ga0501075_1467388_64_393 108
202 3300049679 Ga0501249_185195 Ga0501249_185195_158_499 108
203 3300049705 Ga0501225_0059418 Ga0501225_0059418_525_863 108
204 3300049742 Ga0501080_0318665 Ga0501080_0318665_175_516 108
205 3300049822 Ga0501035_0044277 Ga0501035_0044277_2190_2534 108
206 3300049822 Ga0501035_0115783 Ga0501035_0115783_1536_1880 108
207 3300049823 Ga0501044_0015489 Ga0501044_0015489_1378_1707 108
208 3300049823 Ga0501044_0156514 Ga0501044_0156514_380_709 108
209 3300049824 Ga0501045_0321923 Ga0501045_0321923_675_1019 108
210 3300049824 Ga0501045_0770728 Ga0501045_0770728_60_389 108
211 3300050489 nmdc:mga03683_2893_c1 nmdc:mga03683_2893_c1_2754_3095 108
212 3300050490 nmdc:mga03n38_177542_c1 nmdc:mga03n38_177542_c1_21_362 108
213 3300050492 nmdc:mga0yw44_732145_c1 nmdc:mga0yw44_732145_c1_201_530 108
214 3300050493 nmdc:mga0k408_917237_c1 nmdc:mga0k408_917237_c1_92_433 108
215 3300050496 nmdc:mga07m45_38573_c1 nmdc:mga07m45_38573_c1_505_846 108
216 3300053119 Ga0500595_058353 Ga0500595_058353_670_1011 108
217 3300053161 Ga0500634_0075836 Ga0500634_0075836_286_627 108
218 3300059421 Ga0590071_002412 Ga0590071_002412_545_886 108
219 iso_pu_bacteria 2526164512 2526211984 108
220 iso_pu_bacteria 2574179768 2574430287 108
221 iso_pu_bacteria 2738543020 2739289074 108
222 iso_pu_bacteria 2738543021 2739294386 108
223 iso_pu_bacteria 2891633521 2891634107 108
224 iso_pu_bacteria 2900577576 2900581903 108
225 iso_pu_bacteria 2901300506 2901305861 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

11

103

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w2b-assembly1.cif.gz_A crystal structure of c-terminal domain of ebola (reston) nucleoprotein in complex with fab fragment 0.9392 12 40
5cze-assembly1.cif.gz_J crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.9159 3 95
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.9085 1 95
7ycu-assembly1.cif.gz_C-2 heterotetramer of antitoxin prpa together with toxin prpt from pseudoalteromonas rubra 0.9082 3 96
6x0a-assembly17.cif.gz_Q x-ray structure of a chimeric parde toxin-antitoxin complex from mesorhizobium opportunistum 0.9047 5 96
ID Description Score Start End Superfamily
af_Q5AAP8_56_244_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9159 12 46 1.20.1250.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9157 4 95 3.30.2310.20
af_O01735_368_566_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.913 15 48 1.20.1250.20
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9012 5 105 3.30.2310.20
2b5nD00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8898 65 92 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1F4ATE3-F1-model_v4 Plasmid stabilization protein 1.002 14 108
AF-A0A4Z1R5J2-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9981 1 106
AF-A0A7U6Y955-F1-model_v4 Plasmid stabilization system protein 0.9976 1 108
AF-A0A1G5QRW1-F1-model_v4 Toxin ParE1/3/4 0.9973 1 108
AF-M3A849-F1-model_v4 Plasmid stabilization system protein 0.997 25 106

Feature Viewer

pLDDT pTM Quality
90.16 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map