F337084

General Info

Members Datasets Scaffolds Average Seq Length
224 174 448 300

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0035949|Ga0495597_0035949_241_1314
Length 357
Sequence LVAKAVGEEIAGVIGKPVYEWFTNLPRMVYHYKANLLAAFLRLGHHRGLCLFFGAPTMSGTPPKQTTNDFHPEVLKLFDSYVHGGIDRRGFLDGAARFAVGGISAAALLEALSPKFAQAQQVAPTDARIKAEWVEFESPRGYAKVRGYLVRPANASGPLPCVLVVHENRGLNPHIEDITRRLALDNFIAFAPDALFPLGGYPGDEDKARELFAKLDPVKTQEDFVAAATWLRGVSGANGKLGAVGFCWGGGVVNMLATRVPELAAAVPFYGNAPALDKVGAVKAQLMLMFAENDERINAAWPPYEAALKRAKVRYEAFMYPGTQHGFNNDTTPRYDTDAAKQAWQRTVAFFNKTLRG

Samples

Sample ID Description Type Environment
1 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
114 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
147 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
148 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
149 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
159 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
160 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
161 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
162 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
163 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
164 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
165 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
166 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
167 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
168 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.55
Nodule 0
Rhizoplane 0.45
Rhizosphere 70.09
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495597_0035949 3300046542 Bacteria 2232
2 JGI25152J39213_1000202 3300002773 Bacteria 39928
3 JGI25150J39212_1000146 3300002774 Bacteria 39961
4 JGI25150J39212_1014112 3300002774 Bacteria 1365
5 JGI25151J46595_10019339 3300003187 Bacteria 2895
6 JGI25153J46596_10001631 3300003215 Bacteria 13301
7 rootH1_10026113 3300003316 Bacteria 6929
8 rootL2_10034900 3300003322 Bacteria 14171
9 Ga0055524_1000223 3300003775 Bacteria 60211
10 Ga0065707_10241574 3300005295 Bacteria 1154
11 Ga0070680_100028371 3300005336 Bacteria 4489
12 Ga0068868_100087699 3300005338 Bacteria 2503
13 Ga0070660_100350559 3300005339 Bacteria 1215
14 Ga0070659_100149531 3300005366 Bacteria 1904
15 Ga0070694_100044070 3300005444 Bacteria 2985
16 Ga0070708_100073609 3300005445 Bacteria 3080
17 Ga0070681_10094456 3300005458 Bacteria 2939
18 Ga0068867_100056754 3300005459 Bacteria 2898
19 Ga0070706_100018128 3300005467 Bacteria 6494
20 Ga0070706_100062704 3300005467 Bacteria 3435
21 Ga0070707_100021939 3300005468 Bacteria 6038
22 Ga0070699_100028610 3300005518 Bacteria 4805
23 Ga0070679_100011269 3300005530 Bacteria 8523
24 Ga0070697_100100694 3300005536 Unclassified 2400
25 Ga0070697_100403418 3300005536 Bacteria 1186
26 Ga0068853_100002388 3300005539 Bacteria 14035
27 Ga0068853_100054498 3300005539 Bacteria 3446
28 Ga0070695_100012905 3300005545 Bacteria 5016
29 Ga0070696_100032794 3300005546 Bacteria 3565
30 Ga0070704_100060518 3300005549 Bacteria 2706
31 Ga0068855_100196290 3300005563 Bacteria 2274
32 Ga0070664_100009749 3300005564 Bacteria 7784
33 Ga0068857_100135231 3300005577 Bacteria 2225
34 Ga0068854_100011817 3300005578 Bacteria 5701
35 Ga0068852_100044481 3300005616 Bacteria 3771
36 Ga0068852_100045291 3300005616 Bacteria 3741
37 Ga0068864_100044673 3300005618 Bacteria 3799
38 Ga0068861_100065060 3300005719 Bacteria 2807
39 Ga0068861_100477961 3300005719 Bacteria 1122
40 Ga0068851_10231698 3300005834 Bacteria 1041
41 Ga0068862_100333279 3300005844 Bacteria 1404
42 Ga0081455_10053997 3300005937 Bacteria 3428
43 Ga0075363_100029575 3300006048 Bacteria 2830
44 Ga0075363_100085460 3300006048 Bacteria 1731
45 Ga0075432_10054944 3300006058 Bacteria 1410
46 Ga0075362_10016514 3300006177 Bacteria 3024
47 Ga0075362_10017490 3300006177 Bacteria 2954
48 Ga0075367_10036108 3300006178 Bacteria 2863
49 Ga0075367_10100589 3300006178 Bacteria 1767
50 Ga0075369_10008933 3300006186 Bacteria 3876
51 Ga0075366_10020505 3300006195 Bacteria 3836
52 Ga0075366_10040815 3300006195 Bacteria 2745
53 Ga0075366_10052967 3300006195 Bacteria 2411
54 Ga0075366_10107887 3300006195 Bacteria 1674
55 Ga0075370_10013398 3300006353 Bacteria 4357
56 Ga0075370_10029322 3300006353 Bacteria 3065
57 Ga0075370_10034104 3300006353 Bacteria 2853
58 Ga0075370_10079342 3300006353 Bacteria 1885
59 Ga0075431_100411674 3300006847 Bacteria 1352
60 Ga0075429_100599775 3300006880 Bacteria 965
61 Ga0068865_100162487 3300006881 Bacteria 1705
62 Ga0105240_10033898 3300009093 Bacteria 6593
63 Ga0105245_10381270 3300009098 Bacteria 1404
64 Ga0105237_10619481 3300009545 Bacteria 1089
65 Ga0105249_10083700 3300009553 Bacteria 2970
66 Ga0105239_10087337 3300010375 Bacteria 3437
67 Ga0157379_10105751 3300014968 Bacteria 2526
68 Ga0207425_1000001 3300025245 Bacteria 2525432
69 Ga0207425_1008287 3300025245 Bacteria 2672
70 Ga0209129_1000001 3300025258 Bacteria 1452436
71 Ga0209676_1002678 3300025292 Bacteria 12081
72 Ga0209564_1024909 3300025295 Bacteria 2031
73 Ga0209758_1000020 3300025297 Bacteria 734220
74 Ga0209256_1000028 3300025299 Bacteria 420213
75 Ga0209051_1005788 3300025303 Bacteria 7116
76 Ga0209051_1018779 3300025303 Bacteria 3045
77 Ga0209257_1007406 3300025304 Bacteria 6634
78 Ga0207684_10004791 3300025910 Bacteria 12673
79 Ga0207671_10007304 3300025914 Bacteria 9603
80 Ga0207657_10075655 3300025919 Bacteria 2841
81 Ga0207652_10054734 3300025921 Bacteria 3430
82 Ga0207646_10043570 3300025922 Bacteria 4029
83 Ga0207650_10293559 3300025925 Bacteria 1326
84 Ga0207659_10147599 3300025926 Bacteria 1833
85 Ga0207659_10155100 3300025926 Bacteria 1792
86 Ga0207670_10471947 3300025936 Bacteria 1015
87 Ga0207704_10061076 3300025938 Bacteria 2336
88 Ga0207679_10075917 3300025945 Bacteria 2552
89 Ga0207679_10598964 3300025945 Bacteria 993
90 Ga0207651_10576633 3300025960 Bacteria 981
91 Ga0207712_10039796 3300025961 Bacteria 3222
92 Ga0207640_10070157 3300025981 Bacteria 2355
93 Ga0207639_10000263 3300026041 Bacteria 37984
94 Ga0207639_10029568 3300026041 Bacteria 4013
95 Ga0207678_10219807 3300026067 Bacteria 1626
96 Ga0207648_10017126 3300026089 Bacteria 6604
97 Ga0207674_10000748 3300026116 Bacteria 42600
98 Ga0207674_10086279 3300026116 Bacteria 3133
99 Ga0207675_100088616 3300026118 Bacteria 2907
100 Ga0207675_100431713 3300026118 Bacteria 1303
101 Ga0207698_10287770 3300026142 Bacteria 1523
102 Ga0209996_1015969 3300027395 Bacteria 1028
103 Ga0209995_1000691 3300027471 Bacteria 5165
104 Ga0209971_1009533 3300027682 Bacteria 2300
105 Ga0209966_1004492 3300027695 Bacteria 2366
106 Ga0209998_10000134 3300027717 Bacteria 28816
107 Ga0209974_10059826 3300027876 Bacteria 1288
108 Ga0268265_10732331 3300028380 Bacteria 958
109 Ga0307517_10005566 3300028786 Bacteria 18930
110 Ga0307517_10121216 3300028786 Bacteria 1932
111 Ga0307515_10000358 3300028794 Bacteria 112133
112 Ga0307511_10026743 3300030521 Bacteria 5286
113 Ga0265320_10038814 3300031240 Bacteria 2386
114 Ga0265331_10065360 3300031250 Bacteria 1711
115 Ga0265327_10016209 3300031251 Bacteria 4752
116 Ga0265327_10101717 3300031251 Bacteria 1386
117 Ga0307513_10089326 3300031456 Bacteria 3146
118 Ga0307513_10136312 3300031456 Bacteria 2390
119 Ga0307408_100036952 3300031548 Bacteria 3436
120 Ga0307514_10062532 3300031649 Bacteria 2831
121 Ga0316576_10019264 3300031727 Bacteria 4675
122 Ga0307516_10036619 3300031730 Bacteria 4910
123 Ga0307516_10169325 3300031730 Bacteria 1926
124 Ga0307405_10008424 3300031731 Bacteria 5227
125 Ga0307405_10101928 3300031731 Bacteria 1927
126 Ga0307405_10110406 3300031731 Bacteria 1862
127 Ga0307413_10001534 3300031824 Bacteria 8864
128 Ga0307413_10247889 3300031824 Bacteria 1319
129 Ga0307410_10003488 3300031852 Bacteria 7894
130 Ga0307407_10138305 3300031903 Bacteria 1568
131 Ga0307412_10052005 3300031911 Bacteria 2711
132 Ga0307412_10272765 3300031911 Bacteria 1324
133 Ga0307409_100007113 3300031995 Bacteria 6661
134 Ga0307409_100030741 3300031995 Bacteria 3864
135 Ga0307409_100083093 3300031995 Bacteria 2595
136 Ga0307409_100190616 3300031995 Bacteria 1825
137 Ga0307416_100031476 3300032002 Bacteria 3994
138 Ga0307416_100190556 3300032002 Bacteria 1933
139 Ga0307416_100509853 3300032002 Bacteria 1269
140 Ga0307411_10022275 3300032005 Bacteria 3726
141 Ga0307415_100133730 3300032126 Bacteria 1882
142 Ga0307415_100406274 3300032126 Bacteria 1164
143 Ga0373961_0000010 3300035241 Bacteria 129237
144 Ga0373927_0306656 3300035695 Bacteria 1045
145 Ga0373947_0052495 3300035725 Bacteria 2456
146 Ga0395905_0439576 3300037471 Bacteria 1202
147 Ga0436361_0256657 3300039447 Bacteria 4289
148 Ga0439448_0060057 3300042005 Bacteria 1256
149 Ga0439455_0004219 3300042012 Bacteria 2831
150 Ga0450914_006760 3300042118 Bacteria 1016
151 Ga0451577_0145703 3300042876 Bacteria 2129
152 Ga0453683_0279135 3300044673 Bacteria 1067
153 Ga0453684_0063255 3300044712 Bacteria 4735
154 Ga0466971_0119491 3300044719 Bacteria 1219
155 Ga0466957_0039718 3300044842 Bacteria 2840
156 Ga0451576_0006555 3300045051 Bacteria 14245
157 Ga0466958_0000911 3300045836 Bacteria 13275
158 Ga0495590_0009776 3300046457 Bacteria 3632
159 Ga0495606_0155556 3300046507 Bacteria 1338
160 Ga0495606_0187072 3300046507 Bacteria 1190
161 Ga0495620_0049017 3300046515 Bacteria 1810
162 Ga0495632_0005045 3300046519 Bacteria 8836
163 Ga0495637_0000061 3300046520 Bacteria 95460
164 Ga0495643_0000088 3300046522 Bacteria 155458
165 Ga0495663_0000013 3300046525 Bacteria 155493
166 Ga0495621_0021759 3300046539 Bacteria 2117
167 Ga0495633_0000212 3300046558 Bacteria 73041
168 Ga0495611_0052069 3300046648 Bacteria 1846
169 Ga0495625_0014804 3300046660 Bacteria 6208
170 Ga0495671_0000048 3300046692 Bacteria 155712
171 Ga0495649_0002553 3300046694 Bacteria 12758
172 Ga0495687_000722 3300047443 Bacteria 36591
173 Ga0495687_001915 3300047443 Bacteria 17872
174 Ga0495687_015778 3300047443 Bacteria 3825
175 Ga0495681_0003669 3300047470 Bacteria 10663
176 Ga0495686_0067961 3300047472 Bacteria 2199
177 Ga0495626_0077570 3300048091 Bacteria 1481
178 Ga0496106_0017642 3300048909 Bacteria 5280
179 Ga0501040_0065385 3300049576 Bacteria 2505
180 Ga0501041_0172466 3300049577 Bacteria 1354
181 Ga0501041_0243999 3300049577 Bacteria 1129
182 Ga0501042_0210338 3300049578 Bacteria 1403
183 Ga0501071_0075906 3300049587 Bacteria 2454
184 Ga0501072_0144712 3300049588 Bacteria 1895
185 Ga0501076_0097885 3300049592 Bacteria 2363
186 Ga0501076_0129902 3300049592 Bacteria 2043
187 Ga0501249_003453 3300049679 Bacteria 3174
188 Ga0501249_020510 3300049679 Unclassified 1438
189 Ga0501221_002730 3300049704 Bacteria 2904
190 Ga0501225_0010392 3300049705 Bacteria 2636
191 Ga0501225_0013948 3300049705 Bacteria 2247
192 Ga0501234_005558 3300049707 Bacteria 1974
193 Ga0501081_0014685 3300049743 Bacteria 5167
194 Ga0501279_018335 3300049775 Bacteria 985
195 Ga0501045_0120876 3300049824 Bacteria 1945
196 nmdc:mga03683_3684_c1 3300050489 Bacteria 4989
197 nmdc:mga0k408_209206_c1 3300050493 Bacteria 1165
198 nmdc:mga0k408_28346_c1 3300050493 Bacteria 3183
199 nmdc:mga0k408_5946_c1 3300050493 Bacteria 6510
200 nmdc:mga0k408_85832_c1 3300050493 Bacteria 1848
201 nmdc:mga06z11_118175_c1 3300050494 Bacteria 1476
202 nmdc:mga06z11_2304_c1 3300050494 Bacteria 7258
203 nmdc:mga07m45_11457_c1 3300050496 Bacteria 4659
204 nmdc:mga07m45_4560_c1 3300050496 Bacteria 6785
205 nmdc:mga07m45_9421_c1 3300050496 Bacteria 5067
206 nmdc:mga06r32_390185_c1 3300050510 Bacteria 1375
207 Ga0500578_0021748 3300053086 Bacteria 4119
208 Ga0500643_000584 3300053087 Bacteria 25245
209 Ga0500644_0003046 3300053088 Bacteria 4154
210 Ga0500566_0002381 3300053094 Bacteria 11125
211 Ga0500640_005580 3300053095 Bacteria 4711
212 Ga0500554_000363 3300053102 Bacteria 9800
213 Ga0500572_006361 3300053111 Bacteria 2702
214 Ga0500593_010853 3300053117 Bacteria 3831
215 Ga0500595_000441 3300053119 Bacteria 25944
216 Ga0500614_000023 3300053123 Bacteria 36107
217 Ga0500559_0046392 3300053136 Bacteria 1905
218 Ga0500568_0007900 3300053139 Bacteria 5178
219 Ga0500603_004074 3300053150 Bacteria 3126
220 Ga0501084_0316047 3300054114 Bacteria 1319
221 Ga0500661_002726 3300055283 Bacteria 3336
222 Ga0501082_0108736 3300060353 Bacteria 2400
223 Ga0501082_0133152 3300060353 Bacteria 2157
224 2511244065 2511231002 Bacteria 5042903
225 Ga0495597_0035949
226 JGI25152J39213_1000202
227 JGI25150J39212_1000146
228 JGI25150J39212_1014112
229 JGI25151J46595_10019339
230 JGI25153J46596_10001631
231 rootH1_10026113
232 rootL2_10034900
233 Ga0055524_1000223
234 Ga0065707_10241574
235 Ga0070680_100028371
236 Ga0068868_100087699
237 Ga0070660_100350559
238 Ga0070659_100149531
239 Ga0070694_100044070
240 Ga0070708_100073609
241 Ga0070681_10094456
242 Ga0068867_100056754
243 Ga0070706_100018128
244 Ga0070706_100062704
245 Ga0070707_100021939
246 Ga0070699_100028610
247 Ga0070679_100011269
248 Ga0070697_100100694
249 Ga0070697_100403418
250 Ga0068853_100002388
251 Ga0068853_100054498
252 Ga0070695_100012905
253 Ga0070696_100032794
254 Ga0070704_100060518
255 Ga0068855_100196290
256 Ga0070664_100009749
257 Ga0068857_100135231
258 Ga0068854_100011817
259 Ga0068852_100044481
260 Ga0068852_100045291
261 Ga0068864_100044673
262 Ga0068861_100065060
263 Ga0068861_100477961
264 Ga0068851_10231698
265 Ga0068862_100333279
266 Ga0081455_10053997
267 Ga0075363_100029575
268 Ga0075363_100085460
269 Ga0075432_10054944
270 Ga0075362_10016514
271 Ga0075362_10017490
272 Ga0075367_10036108
273 Ga0075367_10100589
274 Ga0075369_10008933
275 Ga0075366_10020505
276 Ga0075366_10040815
277 Ga0075366_10052967
278 Ga0075366_10107887
279 Ga0075370_10013398
280 Ga0075370_10029322
281 Ga0075370_10034104
282 Ga0075370_10079342
283 Ga0075431_100411674
284 Ga0075429_100599775
285 Ga0068865_100162487
286 Ga0105240_10033898
287 Ga0105245_10381270
288 Ga0105237_10619481
289 Ga0105249_10083700
290 Ga0105239_10087337
291 Ga0157379_10105751
292 Ga0207425_1000001
293 Ga0207425_1008287
294 Ga0209129_1000001
295 Ga0209676_1002678
296 Ga0209564_1024909
297 Ga0209758_1000020
298 Ga0209256_1000028
299 Ga0209051_1005788
300 Ga0209051_1018779
301 Ga0209257_1007406
302 Ga0207684_10004791
303 Ga0207671_10007304
304 Ga0207657_10075655
305 Ga0207652_10054734
306 Ga0207646_10043570
307 Ga0207650_10293559
308 Ga0207659_10147599
309 Ga0207659_10155100
310 Ga0207670_10471947
311 Ga0207704_10061076
312 Ga0207679_10075917
313 Ga0207679_10598964
314 Ga0207651_10576633
315 Ga0207712_10039796
316 Ga0207640_10070157
317 Ga0207639_10000263
318 Ga0207639_10029568
319 Ga0207678_10219807
320 Ga0207648_10017126
321 Ga0207674_10000748
322 Ga0207674_10086279
323 Ga0207675_100088616
324 Ga0207675_100431713
325 Ga0207698_10287770
326 Ga0209996_1015969
327 Ga0209995_1000691
328 Ga0209971_1009533
329 Ga0209966_1004492
330 Ga0209998_10000134
331 Ga0209974_10059826
332 Ga0268265_10732331
333 Ga0307517_10005566
334 Ga0307517_10121216
335 Ga0307515_10000358
336 Ga0307511_10026743
337 Ga0265320_10038814
338 Ga0265331_10065360
339 Ga0265327_10016209
340 Ga0265327_10101717
341 Ga0307513_10089326
342 Ga0307513_10136312
343 Ga0307408_100036952
344 Ga0307514_10062532
345 Ga0316576_10019264
346 Ga0307516_10036619
347 Ga0307516_10169325
348 Ga0307405_10008424
349 Ga0307405_10101928
350 Ga0307405_10110406
351 Ga0307413_10001534
352 Ga0307413_10247889
353 Ga0307410_10003488
354 Ga0307407_10138305
355 Ga0307412_10052005
356 Ga0307412_10272765
357 Ga0307409_100007113
358 Ga0307409_100030741
359 Ga0307409_100083093
360 Ga0307409_100190616
361 Ga0307416_100031476
362 Ga0307416_100190556
363 Ga0307416_100509853
364 Ga0307411_10022275
365 Ga0307415_100133730
366 Ga0307415_100406274
367 Ga0373961_0000010
368 Ga0373927_0306656
369 Ga0373947_0052495
370 Ga0395905_0439576
371 Ga0436361_0256657
372 Ga0439448_0060057
373 Ga0439455_0004219
374 Ga0450914_006760
375 Ga0451577_0145703
376 Ga0453683_0279135
377 Ga0453684_0063255
378 Ga0466971_0119491
379 Ga0466957_0039718
380 Ga0451576_0006555
381 Ga0466958_0000911
382 Ga0495590_0009776
383 Ga0495606_0155556
384 Ga0495606_0187072
385 Ga0495620_0049017
386 Ga0495632_0005045
387 Ga0495637_0000061
388 Ga0495643_0000088
389 Ga0495663_0000013
390 Ga0495621_0021759
391 Ga0495633_0000212
392 Ga0495611_0052069
393 Ga0495625_0014804
394 Ga0495671_0000048
395 Ga0495649_0002553
396 Ga0495687_000722
397 Ga0495687_001915
398 Ga0495687_015778
399 Ga0495681_0003669
400 Ga0495686_0067961
401 Ga0495626_0077570
402 Ga0496106_0017642
403 Ga0501040_0065385
404 Ga0501041_0172466
405 Ga0501041_0243999
406 Ga0501042_0210338
407 Ga0501071_0075906
408 Ga0501072_0144712
409 Ga0501076_0097885
410 Ga0501076_0129902
411 Ga0501249_003453
412 Ga0501249_020510
413 Ga0501221_002730
414 Ga0501225_0010392
415 Ga0501225_0013948
416 Ga0501234_005558
417 Ga0501081_0014685
418 Ga0501279_018335
419 Ga0501045_0120876
420 nmdc:mga03683_3684_c1
421 nmdc:mga0k408_209206_c1
422 nmdc:mga0k408_28346_c1
423 nmdc:mga0k408_5946_c1
424 nmdc:mga0k408_85832_c1
425 nmdc:mga06z11_118175_c1
426 nmdc:mga06z11_2304_c1
427 nmdc:mga07m45_11457_c1
428 nmdc:mga07m45_4560_c1
429 nmdc:mga07m45_9421_c1
430 nmdc:mga06r32_390185_c1
431 Ga0500578_0021748
432 Ga0500643_000584
433 Ga0500644_0003046
434 Ga0500566_0002381
435 Ga0500640_005580
436 Ga0500554_000363
437 Ga0500572_006361
438 Ga0500593_010853
439 Ga0500595_000441
440 Ga0500614_000023
441 Ga0500559_0046392
442 Ga0500568_0007900
443 Ga0500603_004074
444 Ga0501084_0316047
445 Ga0500661_002726
446 Ga0501082_0108736
447 Ga0501082_0133152
448 2511244065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

145

355

0.93

PF23678

62

100

0.93

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

213

349

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9888 60 292
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9642 60 292
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8851 67 291
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.8799 72 294
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8785 72 294
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9876 60 292 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9626 60 292 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8909 68 292 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8845 70 288 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8837 67 288 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2N1UQI7-F1-model_v4 Dienelactone hydrolase 0.9992 178 294 GO:0016787
AF-A0A1Q7Z4Z1-F1-model_v4 Carboxymethylenebutenolidase 0.9979 101 293 GO:0016787
AF-A0A378BQ54-F1-model_v4 Putative enzyme 0.9976 198 292 GO:0016787
AF-A0A6N3QHR6-F1-model_v4 Putative enzyme 0.9975 180 294 GO:0016787
AF-A0A3M3ATE5-F1-model_v4 Dienelactone hydrolase-related enzyme 0.9965 183 276 GO:0016787

Map