F335270

General Info

Members Datasets Scaffolds Average Seq Length
223 184 446 122

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10000301|Ga0070703_100003019
Length 134
Sequence MPTLASSASVAAGRGTVRPLVWMGKSRQDLKQFPDDVQDEMGYGLFLAQSGEKHHKAKLLRGFAGAGTMEMISDHRGNTYRAVYTVRLAHAVYVLHAFQKKSKRGFSTPRRELDLIRRRLKDAEAADAAVDSRE

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
145 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
146 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
147 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
157 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
158 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
159 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
160 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
161 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
162 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
163 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
164 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
179 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
180 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0.9
Rhizoplane 2.69
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 30.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10000301 3300005406 Bacteria 22608
2 MRS1b_contig_5246865 2162886011 Bacteria 3559
3 rootL2_10216498 3300003322 Bacteria 1182
4 Ga0065714_10064422 3300005288 Bacteria 270668
5 Ga0065704_10825336 3300005289 Bacteria 517
6 Ga0065712_10000122 3300005290 Bacteria 92508
7 Ga0065715_10098294 3300005293 Bacteria 3568
8 Ga0065715_10401823 3300005293 Unclassified 880
9 Ga0065707_10265902 3300005295 Bacteria 1084
10 Ga0065707_10907253 3300005295 Unclassified 565
11 Ga0070683_100268040 3300005329 Bacteria 1624
12 Ga0070683_100476154 3300005329 Bacteria 1192
13 Ga0070680_100057942 3300005336 Bacteria 3168
14 Ga0070682_100179559 3300005337 Unclassified 1477
15 Ga0070689_100004627 3300005340 Bacteria 9316
16 Ga0070691_10312237 3300005341 Unclassified 862
17 Ga0070669_100795953 3300005353 Unclassified 803
18 Ga0070673_100296209 3300005364 Bacteria 1423
19 Ga0070700_100077185 3300005441 Unclassified 2141
20 Ga0070700_100472080 3300005441 Unclassified 959
21 Ga0070694_100081910 3300005444 Bacteria 2246
22 Ga0070694_100110839 3300005444 Unclassified 1955
23 Ga0070708_100023410 3300005445 Bacteria 5253
24 Ga0070663_100143428 3300005455 Bacteria 1825
25 Ga0070662_100219813 3300005457 Bacteria 1515
26 Ga0070681_10902461 3300005458 Unclassified 802
27 Ga0070681_11730065 3300005458 Bacteria 552
28 Ga0070706_100001521 3300005467 Bacteria 24331
29 Ga0070672_100327486 3300005543 Bacteria 1303
30 Ga0070686_100372382 3300005544 Bacteria 1079
31 Ga0070686_100607613 3300005544 Unclassified 862
32 Ga0070695_100027827 3300005545 Bacteria 3504
33 Ga0070695_100353311 3300005545 Bacteria 1102
34 Ga0070696_100114990 3300005546 Bacteria 1941
35 Ga0070693_100546506 3300005547 Unclassified 828
36 Ga0070665_100000926 3300005548 Bacteria 37576
37 Ga0070664_100189663 3300005564 Bacteria 1831
38 Ga0068857_101728101 3300005577 Unclassified 612
39 Ga0068856_102646180 3300005614 Bacteria 507
40 Ga0070702_100004460 3300005615 Bacteria 6394
41 Ga0068859_100021201 3300005617 Bacteria 6520
42 Ga0068859_100160083 3300005617 Bacteria 2330
43 Ga0068864_102626846 3300005618 Unclassified 509
44 Ga0068863_100096670 3300005841 Unclassified 2804
45 Ga0068860_100013166 3300005843 Bacteria 8117
46 Ga0068862_101919311 3300005844 Bacteria 602
47 Ga0081539_10018682 3300005985 Bacteria 4793
48 Ga0081539_10467906 3300005985 Unclassified 522
49 Ga0075362_10253644 3300006177 Bacteria 865
50 Ga0075433_10035966 3300006852 Bacteria 4262
51 Ga0075434_100937535 3300006871 Bacteria 880
52 Ga0075429_100076915 3300006880 Unclassified 2907
53 Ga0075436_100016355 3300006914 Bacteria 5078
54 Ga0097620_100021201 3300006931 Bacteria 6520
55 Ga0097620_100160079 3300006931 Bacteria 2330
56 Ga0079104_1001276 3300006946 Bacteria 17465
57 Ga0075435_100019574 3300007076 Bacteria 5174
58 Ga0099794_10026591 3300007265 Bacteria 2676
59 Ga0099794_10032816 3300007265 Bacteria 2439
60 Ga0099794_10378293 3300007265 Bacteria 738
61 Ga0099795_10060782 3300007788 Bacteria 1401
62 Ga0105240_10399219 3300009093 Bacteria 1549
63 Ga0111539_10002304 3300009094 Bacteria 25376
64 Ga0111539_10154587 3300009094 Bacteria 2685
65 Ga0105247_10010241 3300009101 Bacteria 5675
66 Ga0114129_11412977 3300009147 Bacteria 858
67 Ga0114129_11894845 3300009147 Unclassified 723
68 Ga0114129_12051008 3300009147 Unclassified 691
69 Ga0105243_10516189 3300009148 Unclassified 1135
70 Ga0105241_10243752 3300009174 Unclassified 1521
71 Ga0105241_10585543 3300009174 Unclassified 1006
72 Ga0105242_10491826 3300009176 Unclassified 1165
73 Ga0105242_11290228 3300009176 Bacteria 753
74 Ga0105248_10110774 3300009177 Bacteria 3096
75 Ga0105248_12347902 3300009177 Unclassified 607
76 Ga0105249_10000053 3300009553 Bacteria 168010
77 Ga0105249_11706290 3300009553 Unclassified 702
78 Ga0099796_10022048 3300010159 Bacteria 1971
79 Ga0105239_10969906 3300010375 Bacteria 977
80 Ga0105246_10503795 3300011119 Unclassified 1029
81 Ga0157374_12914733 3300013296 Bacteria 506
82 Ga0163162_12805895 3300013306 Unclassified 561
83 Ga0157375_12011904 3300013308 Unclassified 687
84 Ga0157380_10111257 3300014326 Bacteria 2302
85 Ga0157376_10102399 3300014969 Bacteria 2505
86 Ga0213872_10030074 3300021361 Bacteria 2490
87 Ga0213874_10271925 3300021377 Bacteria 630
88 Ga0213871_10058239 3300021441 Bacteria 1071
89 Ga0213871_10072404 3300021441 Bacteria 976
90 Ga0207653_10000153 3300025885 Bacteria 48484
91 Ga0207710_10009118 3300025900 Bacteria 4176
92 Ga0207684_10000405 3300025910 Bacteria 57735
93 Ga0207660_10254073 3300025917 Bacteria 1388
94 Ga0207650_11584700 3300025925 Unclassified 556
95 Ga0207706_10248201 3300025933 Bacteria 1555
96 Ga0207686_10073204 3300025934 Bacteria 2210
97 Ga0207670_10002328 3300025936 Bacteria 9945
98 Ga0207670_10895777 3300025936 Bacteria 743
99 Ga0207704_10577591 3300025938 Bacteria 917
100 Ga0207661_11052873 3300025944 Bacteria 749
101 Ga0207679_10234639 3300025945 Bacteria 1551
102 Ga0207651_10582438 3300025960 Bacteria 976
103 Ga0207712_10000045 3300025961 Bacteria 168093
104 Ga0207712_10000754 3300025961 Bacteria 24470
105 Ga0207708_10372325 3300026075 Bacteria 1176
106 Ga0207708_10546818 3300026075 Bacteria 976
107 Ga0207708_10658310 3300026075 Unclassified 892
108 Ga0207708_11124054 3300026075 Unclassified 685
109 Ga0207702_11389020 3300026078 Unclassified 696
110 Ga0207702_12074793 3300026078 Bacteria 558
111 Ga0207641_10034247 3300026088 Unclassified 4223
112 Ga0207674_10006744 3300026116 Bacteria 13481
113 Ga0207674_10587418 3300026116 Bacteria 1076
114 Ga0207675_101172005 3300026118 Unclassified 788
115 Ga0209281_1000405 3300027111 Bacteria 65772
116 Ga0209588_1046163 3300027671 Bacteria 1409
117 Ga0268266_10001629 3300028379 Bacteria 26120
118 Ga0268264_10005380 3300028381 Bacteria 10838
119 Ga0265330_10276093 3300031235 Bacteria 708
120 Ga0307513_10019042 3300031456 Bacteria 8183
121 Ga0307408_100269064 3300031548 Bacteria 1414
122 Ga0307405_10132823 3300031731 Bacteria 1723
123 Ga0307405_10202182 3300031731 Bacteria 1444
124 Ga0307413_10534771 3300031824 Bacteria 948
125 Ga0307410_10161657 3300031852 Bacteria 1679
126 Ga0307406_11258873 3300031901 Unclassified 644
127 Ga0307409_102204023 3300031995 Bacteria 580
128 Ga0307416_100040316 3300032002 Bacteria 3626
129 Ga0307416_101415068 3300032002 Bacteria 801
130 Ga0307414_10238776 3300032004 Bacteria 1503
131 Ga0307415_100019943 3300032126 Bacteria 4082
132 Ga0307415_100160745 3300032126 Bacteria 1741
133 Ga0307415_100900827 3300032126 Bacteria 815
134 Ga0373923_0319572 3300035111 Unclassified 737
135 Ga0373956_0357630 3300035119 Unclassified 696
136 Ga0373955_0055009 3300035172 Bacteria 2178
137 Ga0373933_0259596 3300035724 Bacteria 1120
138 Ga0373937_0140693 3300036401 Bacteria 2258
139 Ga0373925_0013683 3300037068 Bacteria 5875
140 Ga0395900_0227012 3300037418 Bacteria 1880
141 Ga0395905_0630895 3300037471 Bacteria 973
142 Ga0436365_0158022 3300039437 Bacteria 908
143 Ga0436365_0158194 3300039437 Bacteria 789
144 Ga0436360_0358341 3300039438 Bacteria 1017
145 Ga0436360_0673560 3300039438 Bacteria 708
146 Ga0436363_0339616 3300039450 Bacteria 2434
147 Ga0451855_0141537 3300041511 Bacteria 647
148 Ga0466966_0726841 3300044684 Bacteria 598
149 Ga0466961_0300129 3300044693 Bacteria 981
150 Ga0451576_1066696 3300045051 Unclassified 846
151 Ga0466967_0254671 3300045976 Bacteria 1678
152 Ga0466967_0702529 3300045976 Unclassified 1002
153 Ga0495592_0174641 3300046454 Bacteria 1468
154 Ga0495638_0041169 3300046460 Bacteria 2924
155 Ga0495618_0448395 3300046514 Unclassified 783
156 Ga0495643_0057321 3300046522 Bacteria 2076
157 Ga0495652_0341176 3300046529 Unclassified 1076
158 Ga0495640_0437357 3300046533 Unclassified 800
159 Ga0495587_0126121 3300046536 Unclassified 1464
160 Ga0495645_0091834 3300046543 Bacteria 2168
161 Ga0495667_0031651 3300046559 Bacteria 3549
162 Ga0495625_0013370 3300046660 Bacteria 6597
163 Ga0495635_0139744 3300046663 Bacteria 1650
164 Ga0495599_0126496 3300046678 Bacteria 1588
165 Ga0495623_0172934 3300046679 Unclassified 1260
166 Ga0495613_0282737 3300046689 Unclassified 1152
167 Ga0495624_0464359 3300046690 Unclassified 758
168 Ga0495604_0519666 3300047317 Unclassified 770
169 Ga0495636_0334552 3300047318 Bacteria 713
170 Ga0495674_0276104 3300047319 Bacteria 1378
171 Ga0495680_0116009 3300047322 Bacteria 1981
172 Ga0495684_0273860 3300047471 Unclassified 1220
173 Ga0495602_0397009 3300048088 Unclassified 984
174 Ga0496101_0189266 3300048904 Bacteria 1588
175 Ga0496103_0149609 3300048906 Unclassified 1495
176 Ga0496103_0385218 3300048906 Unclassified 901
177 Ga0496106_0120198 3300048909 Bacteria 2053
178 Ga0496107_0582659 3300048910 Unclassified 828
179 Ga0496115_0020183 3300048918 Bacteria 5137
180 Ga0501290_032006 3300049513 Bacteria 758
181 Ga0501291_002087 3300049514 Bacteria 2367
182 Ga0501296_007252 3300049519 Bacteria 1269
183 Ga0501297_025616 3300049520 Bacteria 760
184 Ga0501031_0643123 3300049568 Unclassified 682
185 Ga0501032_0225989 3300049569 Unclassified 1217
186 Ga0501033_0245218 3300049570 Unclassified 1270
187 Ga0501036_0079338 3300049572 Unclassified 2776
188 Ga0501037_0261777 3300049573 Unclassified 1208
189 Ga0501038_0389671 3300049574 Unclassified 1079
190 Ga0501039_0536417 3300049575 Unclassified 918
191 Ga0501043_0746859 3300049579 Unclassified 711
192 Ga0501202_041813 3300049652 Bacteria 992
193 Ga0501216_106394 3300049660 Bacteria 625
194 Ga0501224_056500 3300049664 Unclassified 607
195 Ga0501227_036522 3300049665 Bacteria 1199
196 Ga0501235_012996 3300049669 Bacteria 1831
197 Ga0501249_126999 3300049679 Bacteria 626
198 Ga0501260_017847 3300049689 Bacteria 753
199 Ga0501225_0056308 3300049705 Bacteria 1101
200 Ga0501234_029503 3300049707 Bacteria 884
201 Ga0501083_0104165 3300049744 Bacteria 1869
202 Ga0501268_152620 3300049765 Unclassified 534
203 Ga0501035_0000504 3300049822 Bacteria 44035
204 Ga0501045_0346945 3300049824 Unclassified 1105
205 Ga0501226_036579 3300049853 Bacteria 563
206 nmdc:mga03683_65686_c2 3300050489 Bacteria 890
207 nmdc:mga05p37_1347903_c1 3300050507 Unclassified 723
208 nmdc:mga05p37_848716_c1 3300050507 Bacteria 992
209 nmdc:mga09592_850874_c1 3300050508 Unclassified 769
210 nmdc:mga08y16_151323_c1 3300050511 Bacteria 2412
211 nmdc:mga08y16_62723_c1 3300050511 Bacteria 3882
212 nmdc:mga0rr50_61087_c1 3300050513 Unclassified 2838
213 nmdc:mga0a205_51232_c1 3300050515 Unclassified 3985
214 nmdc:mga0a205_737609_c1 3300050515 Unclassified 834
215 Ga0495601_0151518 3300053077 Bacteria 1514
216 Ga0495619_0085005 3300053085 Bacteria 2136
217 Ga0500647_0169054 3300053091 Bacteria 1010
218 Ga0500595_018370 3300053119 Bacteria 2559
219 Ga0500655_017586 3300053133 Bacteria 1324
220 Ga0500658_0269611 3300053134 Bacteria 783
221 Ga0500559_0257169 3300053136 Bacteria 822
222 Ga0500634_0125797 3300053161 Bacteria 1239
223 Ga0530510_1478659 3300061734 Bacteria 522
224 Ga0070703_10000301
225 MRS1b_contig_5246865
226 rootL2_10216498
227 Ga0065714_10064422
228 Ga0065704_10825336
229 Ga0065712_10000122
230 Ga0065715_10098294
231 Ga0065715_10401823
232 Ga0065707_10265902
233 Ga0065707_10907253
234 Ga0070683_100268040
235 Ga0070683_100476154
236 Ga0070680_100057942
237 Ga0070682_100179559
238 Ga0070689_100004627
239 Ga0070691_10312237
240 Ga0070669_100795953
241 Ga0070673_100296209
242 Ga0070700_100077185
243 Ga0070700_100472080
244 Ga0070694_100081910
245 Ga0070694_100110839
246 Ga0070708_100023410
247 Ga0070663_100143428
248 Ga0070662_100219813
249 Ga0070681_10902461
250 Ga0070681_11730065
251 Ga0070706_100001521
252 Ga0070672_100327486
253 Ga0070686_100372382
254 Ga0070686_100607613
255 Ga0070695_100027827
256 Ga0070695_100353311
257 Ga0070696_100114990
258 Ga0070693_100546506
259 Ga0070665_100000926
260 Ga0070664_100189663
261 Ga0068857_101728101
262 Ga0068856_102646180
263 Ga0070702_100004460
264 Ga0068859_100021201
265 Ga0068859_100160083
266 Ga0068864_102626846
267 Ga0068863_100096670
268 Ga0068860_100013166
269 Ga0068862_101919311
270 Ga0081539_10018682
271 Ga0081539_10467906
272 Ga0075362_10253644
273 Ga0075433_10035966
274 Ga0075434_100937535
275 Ga0075429_100076915
276 Ga0075436_100016355
277 Ga0097620_100021201
278 Ga0097620_100160079
279 Ga0079104_1001276
280 Ga0075435_100019574
281 Ga0099794_10026591
282 Ga0099794_10032816
283 Ga0099794_10378293
284 Ga0099795_10060782
285 Ga0105240_10399219
286 Ga0111539_10002304
287 Ga0111539_10154587
288 Ga0105247_10010241
289 Ga0114129_11412977
290 Ga0114129_11894845
291 Ga0114129_12051008
292 Ga0105243_10516189
293 Ga0105241_10243752
294 Ga0105241_10585543
295 Ga0105242_10491826
296 Ga0105242_11290228
297 Ga0105248_10110774
298 Ga0105248_12347902
299 Ga0105249_10000053
300 Ga0105249_11706290
301 Ga0099796_10022048
302 Ga0105239_10969906
303 Ga0105246_10503795
304 Ga0157374_12914733
305 Ga0163162_12805895
306 Ga0157375_12011904
307 Ga0157380_10111257
308 Ga0157376_10102399
309 Ga0213872_10030074
310 Ga0213874_10271925
311 Ga0213871_10058239
312 Ga0213871_10072404
313 Ga0207653_10000153
314 Ga0207710_10009118
315 Ga0207684_10000405
316 Ga0207660_10254073
317 Ga0207650_11584700
318 Ga0207706_10248201
319 Ga0207686_10073204
320 Ga0207670_10002328
321 Ga0207670_10895777
322 Ga0207704_10577591
323 Ga0207661_11052873
324 Ga0207679_10234639
325 Ga0207651_10582438
326 Ga0207712_10000045
327 Ga0207712_10000754
328 Ga0207708_10372325
329 Ga0207708_10546818
330 Ga0207708_10658310
331 Ga0207708_11124054
332 Ga0207702_11389020
333 Ga0207702_12074793
334 Ga0207641_10034247
335 Ga0207674_10006744
336 Ga0207674_10587418
337 Ga0207675_101172005
338 Ga0209281_1000405
339 Ga0209588_1046163
340 Ga0268266_10001629
341 Ga0268264_10005380
342 Ga0265330_10276093
343 Ga0307513_10019042
344 Ga0307408_100269064
345 Ga0307405_10132823
346 Ga0307405_10202182
347 Ga0307413_10534771
348 Ga0307410_10161657
349 Ga0307406_11258873
350 Ga0307409_102204023
351 Ga0307416_100040316
352 Ga0307416_101415068
353 Ga0307414_10238776
354 Ga0307415_100019943
355 Ga0307415_100160745
356 Ga0307415_100900827
357 Ga0373923_0319572
358 Ga0373956_0357630
359 Ga0373955_0055009
360 Ga0373933_0259596
361 Ga0373937_0140693
362 Ga0373925_0013683
363 Ga0395900_0227012
364 Ga0395905_0630895
365 Ga0436365_0158022
366 Ga0436365_0158194
367 Ga0436360_0358341
368 Ga0436360_0673560
369 Ga0436363_0339616
370 Ga0451855_0141537
371 Ga0466966_0726841
372 Ga0466961_0300129
373 Ga0451576_1066696
374 Ga0466967_0254671
375 Ga0466967_0702529
376 Ga0495592_0174641
377 Ga0495638_0041169
378 Ga0495618_0448395
379 Ga0495643_0057321
380 Ga0495652_0341176
381 Ga0495640_0437357
382 Ga0495587_0126121
383 Ga0495645_0091834
384 Ga0495667_0031651
385 Ga0495625_0013370
386 Ga0495635_0139744
387 Ga0495599_0126496
388 Ga0495623_0172934
389 Ga0495613_0282737
390 Ga0495624_0464359
391 Ga0495604_0519666
392 Ga0495636_0334552
393 Ga0495674_0276104
394 Ga0495680_0116009
395 Ga0495684_0273860
396 Ga0495602_0397009
397 Ga0496101_0189266
398 Ga0496103_0149609
399 Ga0496103_0385218
400 Ga0496106_0120198
401 Ga0496107_0582659
402 Ga0496115_0020183
403 Ga0501290_032006
404 Ga0501291_002087
405 Ga0501296_007252
406 Ga0501297_025616
407 Ga0501031_0643123
408 Ga0501032_0225989
409 Ga0501033_0245218
410 Ga0501036_0079338
411 Ga0501037_0261777
412 Ga0501038_0389671
413 Ga0501039_0536417
414 Ga0501043_0746859
415 Ga0501202_041813
416 Ga0501216_106394
417 Ga0501224_056500
418 Ga0501227_036522
419 Ga0501235_012996
420 Ga0501249_126999
421 Ga0501260_017847
422 Ga0501225_0056308
423 Ga0501234_029503
424 Ga0501083_0104165
425 Ga0501268_152620
426 Ga0501035_0000504
427 Ga0501045_0346945
428 Ga0501226_036579
429 nmdc:mga03683_65686_c2
430 nmdc:mga05p37_1347903_c1
431 nmdc:mga05p37_848716_c1
432 nmdc:mga09592_850874_c1
433 nmdc:mga08y16_151323_c1
434 nmdc:mga08y16_62723_c1
435 nmdc:mga0rr50_61087_c1
436 nmdc:mga0a205_51232_c1
437 nmdc:mga0a205_737609_c1
438 Ga0495601_0151518
439 Ga0495619_0085005
440 Ga0500647_0169054
441 Ga0500595_018370
442 Ga0500655_017586
443 Ga0500658_0269611
444 Ga0500559_0257169
445 Ga0500634_0125797
446 Ga0530510_1478659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05973

Gp49

Phage derived protein Gp49-like (DUF891)

28

121

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xs5-assembly1.cif.gz_A crystal structure of human vps29 complexed with rapid-derived cyclic peptide rt-d1 0.7888 58 92
5osi-assembly3.cif.gz_G structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176) 0.776 58 92
6tl0-assembly1.cif.gz_A solution structure and 1h, 13c and 15n chemical shift assignments for the complex of vps29 with varp 687-747 0.7752 58 91
8asw-assembly1.cif.gz_A cryo-em structure of yeast elp123 in complex with alanine trna 0.7745 47 91
5w8m-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7315 58 89
ID Description Score Start End Superfamily
3rpxC00 Alpha Beta;Roll;Mitochondrial Matrix Protein; Chain A;Mitochondrial glycoprotein 0.8566 55 77 3.10.280.10
af_Q57852_48_524_2.140.10.30 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Dipeptidylpeptidase IV, N-terminal domain 0.7774 58 88 2.140.10.30
af_F4I057_88_221_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7645 47 93 2.130.10.10
af_Q9UTI5_1_185_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.761 58 90 3.60.21.10
af_Q4G061_490_685_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7467 57 90 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A5J6N2D7-F1-model_v4 Addiction module toxin RelE 0.9947 8 123
AF-A0A5E7F2X0-F1-model_v4 Addiction module toxin RelE 0.9943 5 89
AF-A0A248JYS9-F1-model_v4 Addiction module toxin RelE 0.9934 7 124
AF-A0A3N1KXI5-F1-model_v4 Phage-related protein 0.9928 7 123
AF-A0A225DPS3-F1-model_v4 Phage-related protein 0.9905 3 124

Map