F335002

General Info

Members Datasets Scaffolds Average Seq Length
222 168 444 218

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_132667_c1|nmdc:mga0a205_132667_c1_77_739
Length 204
Sequence MHLGYMRVSKADGSQALDLQRDALLAAGVRPQHLYEDLASGRRDDRPGLAACLKALREGDVLVVWKLDRLGRDLRHLINTVHVLTTQGIGLKKLVFGIFAALAEFERDLIAERTRAGLAAARARGRKGGAPFKMTPAKLRLAMAAMGQPETKVSALCKELGITRQTLYRHVGPQGELRPDGHKLLGSRGVAEGGAGPRRVAPPG

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
36 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
41 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
64 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
81 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
88 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
109 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
110 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
111 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
112 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
113 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
114 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
115 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
155 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
156 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
159 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
160 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
161 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
162 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
163 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
164 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
165 2851153111 Caulobacter radicis 736 Isolate Unclassified
166 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
167 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
168 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 0.9
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.77
Nodule 2.25
Rhizoplane 0.9
Rhizosphere 66.22
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_132667_c1 3300050515 Bacteria 2391
2 JGI25155J39150_1001954 3300002704 Bacteria 1214
3 JGI25156J39149_1019574 3300002705 Bacteria 1215
4 JGI25154J39366_1009319 3300002738 Bacteria 1214
5 JGI25406J46586_10057933 3300003203 Bacteria 1265
6 JGI25406J46586_10070114 3300003203 Bacteria 1103
7 Ga0055538_1005984 3300003751 Bacteria 1214
8 Ga0055539_1009391 3300003752 Bacteria 1214
9 Ga0055533_1009016 3300003756 Bacteria 1214
10 Ga0055532_1009117 3300003758 Bacteria 1214
11 Ga0055525_1004395 3300003759 Bacteria 1214
12 Ga0055535_1009049 3300003761 Bacteria 1744
13 Ga0055541_1012520 3300003841 Bacteria 1214
14 Ga0070682_100147902 3300005337 Bacteria 1609
15 Ga0070682_100795012 3300005337 Bacteria 768
16 Ga0070709_10603778 3300005434 Bacteria 845
17 Ga0070707_100424507 3300005468 Bacteria 1290
18 Ga0070698_100086848 3300005471 Unclassified 3114
19 Ga0070699_100007105 3300005518 Bacteria 9726
20 Ga0070684_100315094 3300005535 Bacteria 1437
21 Ga0068856_100500812 3300005614 Bacteria 1236
22 Ga0081538_10015354 3300005981 Bacteria 5935
23 Ga0081539_10005716 3300005985 Bacteria 12441
24 Ga0070717_10175418 3300006028 Unclassified 1866
25 Ga0070717_10350701 3300006028 Bacteria 1319
26 Ga0075368_10000035 3300006042 Bacteria 31869
27 Ga0075368_10003403 3300006042 Bacteria 5308
28 Ga0075363_100029097 3300006048 Bacteria 2849
29 Ga0075367_10001426 3300006178 Bacteria 10249
30 Ga0075367_10003301 3300006178 Bacteria 7651
31 Ga0075427_10010018 3300006194 Unclassified 1415
32 Ga0075428_100054446 3300006844 Unclassified 4384
33 Ga0075428_100599524 3300006844 Bacteria 1177
34 Ga0075430_100247036 3300006846 Bacteria 1479
35 Ga0075431_100020336 3300006847 Bacteria 6781
36 Ga0075431_100361651 3300006847 Bacteria 1457
37 Ga0075433_10019887 3300006852 Bacteria 5604
38 Ga0075433_10043945 3300006852 Bacteria 3881
39 Ga0075433_10172317 3300006852 Bacteria 1926
40 Ga0075429_100034291 3300006880 Unclassified 4410
41 Ga0075429_100290847 3300006880 Bacteria 1430
42 Ga0079104_1010496 3300006946 Bacteria 3049
43 Ga0099794_10097955 3300007265 Bacteria 1462
44 Ga0114129_10012894 3300009147 Bacteria 11895
45 Ga0123340_1018668 3300009763 Bacteria 5619
46 Ga0123341_1002767 3300009765 Bacteria 14663
47 Ga0105246_10151411 3300011119 Bacteria 1756
48 Ga0163163_10455210 3300014325 Bacteria 1340
49 Ga0182007_10007054 3300015262 Bacteria 4760
50 Ga0183363_1009 3300015690 Bacteria 127797
51 Ga0183361_11426 3300016635 Bacteria 1228
52 Ga0213873_10032414 3300021358 Unclassified 1305
53 Ga0213873_10070284 3300021358 Bacteria 964
54 Ga0213872_10006965 3300021361 Bacteria 5614
55 Ga0213876_10016779 3300021384 Bacteria 3868
56 Ga0213876_10110784 3300021384 Bacteria 1457
57 Ga0213875_10152651 3300021388 Bacteria 1082
58 Ga0213871_10006898 3300021441 Bacteria 2429
59 Ga0213871_10055859 3300021441 Bacteria 1091
60 Ga0209435_106821 3300025206 Bacteria 1268
61 Ga0209784_100608 3300025224 Bacteria 11510
62 Ga0209566_101042 3300025225 Bacteria 11510
63 Ga0209674_100707 3300025226 Bacteria 11510
64 Ga0209147_100550 3300025229 Bacteria 21316
65 Ga0209147_100607 3300025229 Bacteria 19587
66 Ga0209147_107673 3300025229 Bacteria 1387
67 Ga0209563_100620 3300025230 Bacteria 11510
68 Ga0209437_112143 3300025233 Bacteria 1266
69 Ga0209258_101102 3300025242 Bacteria 11479
70 Ga0209646_1000737 3300025246 Bacteria 11510
71 Ga0209026_1016336 3300025250 Bacteria 1202
72 Ga0209677_101242 3300025253 Bacteria 11510
73 Ga0209759_1001684 3300025256 Bacteria 11506
74 Ga0207684_10251754 3300025910 Bacteria 1524
75 Ga0207684_10264601 3300025910 Bacteria 1484
76 Ga0207646_10336484 3300025922 Bacteria 1364
77 Ga0207700_10124856 3300025928 Bacteria 2092
78 Ga0207664_10088234 3300025929 Bacteria 2537
79 Ga0209281_1002384 3300027111 Bacteria 7660
80 Ga0209813_10000040 3300027866 Bacteria 53861
81 Ga0207428_10058938 3300027907 Bacteria 3045
82 Ga0265330_10016240 3300031235 Bacteria 3437
83 Ga0265332_10018187 3300031238 Bacteria 3100
84 Ga0265328_10008181 3300031239 Bacteria 4326
85 Ga0265328_10015804 3300031239 Bacteria 2951
86 Ga0265325_10016307 3300031241 Bacteria 4155
87 Ga0265329_10006390 3300031242 Bacteria 4677
88 Ga0265339_10024961 3300031249 Bacteria 3437
89 Ga0265331_10011254 3300031250 Bacteria 4906
90 Ga0265327_10021488 3300031251 Bacteria 3893
91 Ga0265316_10031724 3300031344 Bacteria 4317
92 Ga0265313_10120682 3300031595 Bacteria 1143
93 Ga0316579_10018611 3300031691 Bacteria 3059
94 Ga0316579_10073149 3300031691 Bacteria 1626
95 Ga0316579_10090106 3300031691 Bacteria 1464
96 Ga0316579_10121664 3300031691 Bacteria 1254
97 Ga0265314_10032866 3300031711 Bacteria 3811
98 Ga0265342_10024388 3300031712 Bacteria 3818
99 Ga0316576_10032453 3300031727 Unclassified 3711
100 Ga0316578_10037690 3300031728 Bacteria 2785
101 Ga0316578_10132975 3300031728 Bacteria 1497
102 Ga0316577_10306372 3300031733 Bacteria 900
103 Ga0307409_100322755 3300031995 Bacteria 1446
104 Ga0307415_101237152 3300032126 Bacteria 705
105 Ga0316580_10050405 3300032139 Bacteria 1283
106 Ga0316593_10159125 3300032168 Bacteria 824
107 Ga0316588_1033747 3300033528 Unclassified 1207
108 Ga0373926_0006313 3300035083 Bacteria 3934
109 Ga0373944_0002912 3300035089 Bacteria 4394
110 Ga0373923_0060079 3300035111 Bacteria 1613
111 Ga0373923_0067467 3300035111 Bacteria 1530
112 Ga0373936_0007795 3300035113 Bacteria 4022
113 Ga0373936_0029995 3300035113 Bacteria 2144
114 Ga0373945_0003493 3300035116 Bacteria 4948
115 Ga0373945_0017888 3300035116 Bacteria 2406
116 Ga0373943_0009183 3300035170 Bacteria 4430
117 Ga0373943_0053471 3300035170 Bacteria 1994
118 Ga0373946_0007630 3300035171 Bacteria 3961
119 Ga0373946_0027583 3300035171 Bacteria 2247
120 Ga0373955_0360545 3300035172 Bacteria 881
121 Ga0316574_0013557 3300035398 Bacteria 4689
122 Ga0373924_0007431 3300035410 Bacteria 3957
123 Ga0373931_0097216 3300035691 Unclassified 1651
124 Ga0373935_0016188 3300035692 Bacteria 4512
125 Ga0373927_0020390 3300035695 Bacteria 4346
126 Ga0373927_0086529 3300035695 Bacteria 2034
127 Ga0373947_0010388 3300035725 Bacteria 5341
128 Ga0373947_0011975 3300035725 Bacteria 4969
129 Ga0373947_0035779 3300035725 Bacteria 2941
130 Ga0373937_0120004 3300036401 Bacteria 2450
131 Ga0316582_0014432 3300036647 Bacteria 4483
132 Ga0316582_0339279 3300036647 Bacteria 1033
133 Ga0316582_0653528 3300036647 Bacteria 723
134 Ga0373925_0013683 3300037068 Bacteria 5875
135 Ga0373925_0020619 3300037068 Bacteria 4801
136 Ga0395899_0068119 3300037312 Bacteria 2610
137 Ga0395900_0083348 3300037418 Unclassified 3285
138 Ga0436364_0983651 3300037853 Bacteria 1451
139 Ga0395901_0064837 3300038443 Bacteria 3803
140 Ga0400484_04703 3300038725 Bacteria 2292
141 Ga0400484_05016 3300038725 Bacteria 2583
142 Ga0400484_15785 3300038725 Bacteria 7244
143 Ga0400490_19776 3300038726 Bacteria 10373
144 Ga0400490_55847 3300038726 Bacteria 14932
145 Ga0400491_18328 3300038727 Bacteria 2292
146 Ga0400491_25921 3300038727 Bacteria 1078
147 Ga0400485_07316 3300038735 Bacteria 4130
148 Ga0400488_28857 3300038741 Bacteria 1596
149 Ga0400486_06824 3300038742 Bacteria 9219
150 Ga0400486_19942 3300038742 Bacteria 12160
151 Ga0400486_24608 3300038742 Bacteria 1809
152 Ga0400483_000797 3300039062 Bacteria 7677
153 Ga0400483_126212 3300039062 Bacteria 3539
154 Ga0400483_275916 3300039062 Bacteria 4099
155 Ga0400489_19550 3300039093 Bacteria 11883
156 Ga0436365_0267491 3300039437 Bacteria 4574
157 Ga0436365_1885583 3300039437 Bacteria 2901
158 Ga0436360_0074606 3300039438 Bacteria 1875
159 Ga0436360_0229806 3300039438 Bacteria 4697
160 Ga0436360_0873618 3300039438 Bacteria 1399
161 Ga0436360_1156333 3300039438 Bacteria 3777
162 Ga0436361_0148746 3300039447 Bacteria 5907
163 Ga0436362_0145138 3300039453 Bacteria 1822
164 Ga0436362_0481944 3300039453 Bacteria 3190
165 Ga0436362_1161636 3300039453 Bacteria 2428
166 Ga0436362_1169136 3300039453 Unclassified 1478
167 Ga0439461_0062898 3300041410 Bacteria 846
168 Ga0451577_0017280 3300042876 Bacteria 6666
169 Ga0453684_0036405 3300044712 Bacteria 6783
170 Ga0495629_0357144 3300046459 Bacteria 996
171 Ga0495641_0105325 3300046461 Bacteria 1258
172 Ga0495582_0007660 3300046473 Bacteria 5969
173 Ga0495662_0142877 3300046476 Bacteria 1178
174 Ga0495583_0038352 3300046506 Bacteria 2264
175 Ga0495666_0137915 3300046526 Bacteria 1138
176 Ga0495640_0129098 3300046533 Bacteria 1637
177 Ga0495633_0001232 3300046558 Bacteria 20531
178 Ga0495667_0227503 3300046559 Unclassified 1189
179 Ga0495647_0092128 3300046681 Bacteria 1244
180 Ga0495658_0013811 3300046683 Bacteria 4115
181 Ga0495604_0033654 3300047317 Bacteria 4055
182 Ga0495604_0046160 3300047317 Bacteria 3397
183 Ga0495676_0037802 3300047321 Bacteria 4014
184 Ga0495593_0236524 3300047673 Bacteria 915
185 Ga0495614_0072124 3300048089 Bacteria 1489
186 Ga0496107_0268471 3300048910 Bacteria 1270
187 Ga0496114_0189084 3300048917 Bacteria 1801
188 Ga0501033_0227442 3300049570 Bacteria 1326
189 Ga0501037_0007279 3300049573 Bacteria 8088
190 Ga0501035_0036433 3300049822 Bacteria 4458
191 nmdc:mga03n38_45355_c1 3300050490 Bacteria 1935
192 nmdc:mga06z11_181_c1 3300050494 Bacteria 25032
193 nmdc:mga06z11_1954_c1 3300050494 Bacteria 7777
194 nmdc:mga04h51_2688_c1 3300050495 Bacteria 4236
195 nmdc:mga04h51_45_c1 3300050495 Bacteria 40312
196 nmdc:mga07m45_148691_c1 3300050496 Bacteria 1358
197 nmdc:mga05p37_115839_c1 3300050507 Bacteria 2995
198 nmdc:mga05p37_8875_c1 3300050507 Bacteria 11875
199 nmdc:mga09592_290427_c1 3300050508 Bacteria 1418
200 nmdc:mga09592_31160_c1 3300050508 Unclassified 4442
201 nmdc:mga0qj67_188306_c1 3300050509 Bacteria 1677
202 nmdc:mga06r32_13770_c1 3300050510 Bacteria 7335
203 nmdc:mga06r32_352197_c1 3300050510 Bacteria 1457
204 nmdc:mga08y16_221916_c1 3300050511 Bacteria 1956
205 nmdc:mga0rr50_325879_c1 3300050513 Bacteria 1288
206 nmdc:mga0a205_241544_c1 3300050515 Bacteria 1687
207 Ga0495601_0002051 3300053077 Bacteria 11289
208 Ga0500643_026005 3300053087 Bacteria 1838
209 Ga0500555_036514 3300053103 Bacteria 1378
210 Ga0500618_008734 3300053125 Bacteria 2805
211 Ga0500622_0001506 3300053156 Bacteria 18478
212 Ga0500624_000069 3300053157 Bacteria 60896
213 Ga0500636_0009585 3300053177 Bacteria 5634
214 2545672173 2545555834 Bacteria 8130841
215 2792459360 2791355048 Bacteria 5832535
216 2809081331 2808606404 Bacteria 4652788
217 2842875546 2842871566 Bacteria 4827117
218 2843744715 2843744320 Bacteria 5659202
219 2851156822 2851153111 Bacteria 5542585
220 2885433082 2885429604 Bacteria 3642894
221 2894819257 2894817345 Bacteria 4892941
222 640486183 640427133 Bacteria 4567418
223 nmdc:mga0a205_132667_c1
224 JGI25155J39150_1001954
225 JGI25156J39149_1019574
226 JGI25154J39366_1009319
227 JGI25406J46586_10057933
228 JGI25406J46586_10070114
229 Ga0055538_1005984
230 Ga0055539_1009391
231 Ga0055533_1009016
232 Ga0055532_1009117
233 Ga0055525_1004395
234 Ga0055535_1009049
235 Ga0055541_1012520
236 Ga0070682_100147902
237 Ga0070682_100795012
238 Ga0070709_10603778
239 Ga0070707_100424507
240 Ga0070698_100086848
241 Ga0070699_100007105
242 Ga0070684_100315094
243 Ga0068856_100500812
244 Ga0081538_10015354
245 Ga0081539_10005716
246 Ga0070717_10175418
247 Ga0070717_10350701
248 Ga0075368_10000035
249 Ga0075368_10003403
250 Ga0075363_100029097
251 Ga0075367_10001426
252 Ga0075367_10003301
253 Ga0075427_10010018
254 Ga0075428_100054446
255 Ga0075428_100599524
256 Ga0075430_100247036
257 Ga0075431_100020336
258 Ga0075431_100361651
259 Ga0075433_10019887
260 Ga0075433_10043945
261 Ga0075433_10172317
262 Ga0075429_100034291
263 Ga0075429_100290847
264 Ga0079104_1010496
265 Ga0099794_10097955
266 Ga0114129_10012894
267 Ga0123340_1018668
268 Ga0123341_1002767
269 Ga0105246_10151411
270 Ga0163163_10455210
271 Ga0182007_10007054
272 Ga0183363_1009
273 Ga0183361_11426
274 Ga0213873_10032414
275 Ga0213873_10070284
276 Ga0213872_10006965
277 Ga0213876_10016779
278 Ga0213876_10110784
279 Ga0213875_10152651
280 Ga0213871_10006898
281 Ga0213871_10055859
282 Ga0209435_106821
283 Ga0209784_100608
284 Ga0209566_101042
285 Ga0209674_100707
286 Ga0209147_100550
287 Ga0209147_100607
288 Ga0209147_107673
289 Ga0209563_100620
290 Ga0209437_112143
291 Ga0209258_101102
292 Ga0209646_1000737
293 Ga0209026_1016336
294 Ga0209677_101242
295 Ga0209759_1001684
296 Ga0207684_10251754
297 Ga0207684_10264601
298 Ga0207646_10336484
299 Ga0207700_10124856
300 Ga0207664_10088234
301 Ga0209281_1002384
302 Ga0209813_10000040
303 Ga0207428_10058938
304 Ga0265330_10016240
305 Ga0265332_10018187
306 Ga0265328_10008181
307 Ga0265328_10015804
308 Ga0265325_10016307
309 Ga0265329_10006390
310 Ga0265339_10024961
311 Ga0265331_10011254
312 Ga0265327_10021488
313 Ga0265316_10031724
314 Ga0265313_10120682
315 Ga0316579_10018611
316 Ga0316579_10073149
317 Ga0316579_10090106
318 Ga0316579_10121664
319 Ga0265314_10032866
320 Ga0265342_10024388
321 Ga0316576_10032453
322 Ga0316578_10037690
323 Ga0316578_10132975
324 Ga0316577_10306372
325 Ga0307409_100322755
326 Ga0307415_101237152
327 Ga0316580_10050405
328 Ga0316593_10159125
329 Ga0316588_1033747
330 Ga0373926_0006313
331 Ga0373944_0002912
332 Ga0373923_0060079
333 Ga0373923_0067467
334 Ga0373936_0007795
335 Ga0373936_0029995
336 Ga0373945_0003493
337 Ga0373945_0017888
338 Ga0373943_0009183
339 Ga0373943_0053471
340 Ga0373946_0007630
341 Ga0373946_0027583
342 Ga0373955_0360545
343 Ga0316574_0013557
344 Ga0373924_0007431
345 Ga0373931_0097216
346 Ga0373935_0016188
347 Ga0373927_0020390
348 Ga0373927_0086529
349 Ga0373947_0010388
350 Ga0373947_0011975
351 Ga0373947_0035779
352 Ga0373937_0120004
353 Ga0316582_0014432
354 Ga0316582_0339279
355 Ga0316582_0653528
356 Ga0373925_0013683
357 Ga0373925_0020619
358 Ga0395899_0068119
359 Ga0395900_0083348
360 Ga0436364_0983651
361 Ga0395901_0064837
362 Ga0400484_04703
363 Ga0400484_05016
364 Ga0400484_15785
365 Ga0400490_19776
366 Ga0400490_55847
367 Ga0400491_18328
368 Ga0400491_25921
369 Ga0400485_07316
370 Ga0400488_28857
371 Ga0400486_06824
372 Ga0400486_19942
373 Ga0400486_24608
374 Ga0400483_000797
375 Ga0400483_126212
376 Ga0400483_275916
377 Ga0400489_19550
378 Ga0436365_0267491
379 Ga0436365_1885583
380 Ga0436360_0074606
381 Ga0436360_0229806
382 Ga0436360_0873618
383 Ga0436360_1156333
384 Ga0436361_0148746
385 Ga0436362_0145138
386 Ga0436362_0481944
387 Ga0436362_1161636
388 Ga0436362_1169136
389 Ga0439461_0062898
390 Ga0451577_0017280
391 Ga0453684_0036405
392 Ga0495629_0357144
393 Ga0495641_0105325
394 Ga0495582_0007660
395 Ga0495662_0142877
396 Ga0495583_0038352
397 Ga0495666_0137915
398 Ga0495640_0129098
399 Ga0495633_0001232
400 Ga0495667_0227503
401 Ga0495647_0092128
402 Ga0495658_0013811
403 Ga0495604_0033654
404 Ga0495604_0046160
405 Ga0495676_0037802
406 Ga0495593_0236524
407 Ga0495614_0072124
408 Ga0496107_0268471
409 Ga0496114_0189084
410 Ga0501033_0227442
411 Ga0501037_0007279
412 Ga0501035_0036433
413 nmdc:mga03n38_45355_c1
414 nmdc:mga06z11_181_c1
415 nmdc:mga06z11_1954_c1
416 nmdc:mga04h51_2688_c1
417 nmdc:mga04h51_45_c1
418 nmdc:mga07m45_148691_c1
419 nmdc:mga05p37_115839_c1
420 nmdc:mga05p37_8875_c1
421 nmdc:mga09592_290427_c1
422 nmdc:mga09592_31160_c1
423 nmdc:mga0qj67_188306_c1
424 nmdc:mga06r32_13770_c1
425 nmdc:mga06r32_352197_c1
426 nmdc:mga08y16_221916_c1
427 nmdc:mga0rr50_325879_c1
428 nmdc:mga0a205_241544_c1
429 Ga0495601_0002051
430 Ga0500643_026005
431 Ga0500555_036514
432 Ga0500618_008734
433 Ga0500622_0001506
434 Ga0500624_000069
435 Ga0500636_0009585
436 2545672173
437 2792459360
438 2809081331
439 2842875546
440 2843744715
441 2851156822
442 2885433082
443 2894819257
444 640486183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00239

Resolvase

Resolvase, N terminal domain

2

127

0.94

Map