F334699

General Info

Members Datasets Scaffolds Average Seq Length
222 170 193 524

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0089417|Ga0436361_0089417_325_2184
Length 619
Sequence MLPIDGSTTDSRLPQGAIAGAHPDALTLRVASGSLREPSRASLTNSRFANSPSKANELQIQATDKKELNDFLEQVLMRIPSKTSILAEVILRRTVAFALLFAVTPAAVHAQQPAKKPNILVIFGDDVGYWNISAYNLGMTGYKTPNLDRIAKEGAIFTDYYAQQSCTAGRAAFITGQSPFRTGLLKVGLPGATLGLQAADPTIADLLKNEGYLTFQYGKNHLGDRNEFLPTVHGFDEFFGNLYHLNAEEEPENVDYPKDPAFRAKFGPRGVLRCKASEIDDPTVDPRFGKVGKQTIEDTGPLTRKRMETADEEFLNSTLDAMSRAVKAGKPFFLWHNTTRMHIWTHLQPKYKELVAEKGLYGAGMTELDDNVGVLLNKLDELGIADNTILIFSSDNGAEVMSWPDGGGTPFRGEKNTNWEGGYRVPCLVRWPGVVKPGTIINDIVAHEDWLPTLLAAAGKPGVKEKLLVGYEANGRTFKVHLDGYDQTDLLSGNATSARKEFFYFTDDGDLCGLRYNRWKAVFMEQQQHGMDVWRYPLIPLRVPKLEDLRADPFERGEIEGIDYDHWMIDRAFLFVPAQAIVGQFLMSFREFPPRQRPASFSVDQAMEALLKATGAGGD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
4 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
5 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
6 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
7 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
8 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
9 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
10 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
11 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
12 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
13 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
14 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
15 2738543024 Aminobacter sp. AP02 Isolate Unclassified
16 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
17 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
18 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
19 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
20 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
21 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
22 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
23 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
24 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
25 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
26 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
54 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
58 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
72 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
80 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
93 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
104 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
105 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
106 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
107 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
163 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
166 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
167 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
168 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
169 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
170 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.04
Metatranscriptomes 0.9
Isolates 13.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 4.95
Rhizoplane 5.41
Rhizosphere 75.68
Stem 0
Stem Tuber 0
Unclassified 11.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_407357 2162886007 Bacteria 3027
2 JGI24744J21845_10001804 3300002077 Bacteria 4296
3 Ga0058692_1000747 3300003856 Bacteria 13065
4 Ga0065714_10007007 3300005288 Bacteria 3591
5 Ga0065704_10074587 3300005289 Bacteria 6155
6 Ga0070709_10017290 3300005434 Bacteria 4134
7 Ga0070697_100128335 3300005536 Bacteria 2125
8 Ga0070672_100094794 3300005543 Bacteria 2413
9 Ga0070665_100000413 3300005548 Bacteria 62505
10 Ga0068859_100005639 3300005617 Bacteria 12761
11 Ga0068864_100065517 3300005618 Bacteria 3152
12 Ga0068862_100048402 3300005844 Bacteria 3629
13 Ga0081455_10001131 3300005937 Bacteria 33367
14 Ga0081455_10008819 3300005937 Bacteria 10434
15 Ga0081455_10018883 3300005937 Bacteria 6541
16 Ga0081538_10066849 3300005981 Bacteria 2011
17 Ga0081540_1028349 3300005983 Bacteria 3146
18 Ga0081539_10001131 3300005985 Bacteria 48406
19 Ga0070712_100059011 3300006175 Bacteria 2700
20 Ga0070712_100106061 3300006175 Bacteria 2088
21 Ga0075428_100064649 3300006844 Bacteria 4007
22 Ga0075430_100029048 3300006846 Bacteria 4694
23 Ga0075430_100094202 3300006846 Bacteria 2504
24 Ga0075431_100010687 3300006847 Bacteria 9223
25 Ga0075429_100005388 3300006880 Bacteria 11008
26 Ga0075429_100009489 3300006880 Bacteria 8443
27 Ga0097620_100005639 3300006931 Bacteria 12761
28 Ga0079104_1001810 3300006946 Bacteria 13196
29 Ga0079104_1002891 3300006946 Bacteria 8572
30 Ga0105251_10000503 3300009011 Bacteria 37047
31 Ga0105244_10000024 3300009036 Bacteria 218628
32 Ga0105244_10000394 3300009036 Bacteria 40564
33 Ga0111539_10000096 3300009094 Bacteria 92188
34 Ga0111539_10000146 3300009094 Bacteria 81417
35 Ga0114129_10011862 3300009147 Bacteria 12395
36 Ga0114129_10020771 3300009147 Bacteria 9332
37 Ga0105249_10196963 3300009553 Bacteria 1969
38 Ga0123341_1000038 3300009765 Bacteria 60679
39 Ga0171463_1003 3300013249 Bacteria 695693
40 Ga0157374_10020915 3300013296 Bacteria 5813
41 Ga0157374_10052462 3300013296 Bacteria 3798
42 Ga0157380_10023305 3300014326 Bacteria 4668
43 Ga0183363_1093 3300015690 Bacteria 25804
44 Ga0228598_1002484 3300024227 Bacteria 4015
45 Ga0207655_1000042 3300025728 Bacteria 333039
46 Ga0207655_1000660 3300025728 Bacteria 40826
47 Ga0207682_10025995 3300025893 Bacteria 2324
48 Ga0207645_10032822 3300025907 Bacteria 3337
49 Ga0207707_10071379 3300025912 Bacteria 3026
50 Ga0207693_10071599 3300025915 Bacteria 2714
51 Ga0207663_10047182 3300025916 Bacteria 2658
52 Ga0207652_10057569 3300025921 Bacteria 3348
53 Ga0207650_10112099 3300025925 Bacteria 2113
54 Ga0207659_10069076 3300025926 Bacteria 2572
55 Ga0207659_10083544 3300025926 Bacteria 2368
56 Ga0207706_10035465 3300025933 Bacteria 4435
57 Ga0207691_10060729 3300025940 Bacteria 3434
58 Ga0207675_100061462 3300026118 Bacteria 3506
59 Ga0209281_1001071 3300027111 Bacteria 20355
60 Ga0209281_1001702 3300027111 Bacteria 11417
61 Ga0209371_1007803 3300027312 Bacteria 3657
62 Ga0209371_1013280 3300027312 Bacteria 2325
63 Ga0207428_10000120 3300027907 Bacteria 106231
64 Ga0207428_10005113 3300027907 Bacteria 12305
65 Ga0265354_1000450 3300028016 Bacteria 7156
66 Ga0268266_10000631 3300028379 Bacteria 47858
67 Ga0268264_10045148 3300028381 Bacteria 3658
68 Ga0265338_10000140 3300028800 Bacteria 133666
69 Ga0265338_10036173 3300028800 Bacteria 4731
70 Ga0265338_10051587 3300028800 Bacteria 3701
71 Ga0265324_10025622 3300029957 Bacteria 2090
72 Ga0268256_1008061 3300030500 Bacteria 3657
73 Ga0265770_1000237 3300030878 Bacteria 7316
74 Ga0265765_1000004 3300030879 Bacteria 11005
75 Ga0265340_10001555 3300031247 Bacteria 13173
76 Ga0265340_10014537 3300031247 Bacteria 4108
77 Ga0265339_10000051 3300031249 Bacteria 101716
78 Ga0265339_10002223 3300031249 Bacteria 14071
79 Ga0265331_10026103 3300031250 Bacteria 2942
80 Ga0265327_10021288 3300031251 Bacteria 3917
81 Ga0265327_10053231 3300031251 Bacteria 2102
82 Ga0307408_100001359 3300031548 Bacteria 18268
83 Ga0265313_10000011 3300031595 Bacteria 166182
84 Ga0265313_10009258 3300031595 Bacteria 6413
85 Ga0265314_10039866 3300031711 Bacteria 3378
86 Ga0316576_10000088 3300031727 Bacteria 32387
87 Ga0316576_10000330 3300031727 Bacteria 21244
88 Ga0316576_10098314 3300031727 Bacteria 2185
89 Ga0316578_10093909 3300031728 Bacteria 1794
90 Ga0316578_10094296 3300031728 Bacteria 1790
91 Ga0307516_10002210 3300031730 Bacteria 26352
92 Ga0316577_10041719 3300031733 Bacteria 2568
93 Ga0316212_1000239 3300033547 Bacteria 6402
94 Ga0373934_0027575 3300035086 Bacteria 2208
95 Ga0373953_0031438 3300035117 Bacteria 2065
96 Ga0373956_0013949 3300035119 Bacteria 3350
97 Ga0373955_0011965 3300035172 Bacteria 4158
98 Ga0316574_0020288 3300035398 Bacteria 3933
99 Ga0316574_0041252 3300035398 Bacteria 2845
100 Ga0373924_0065829 3300035410 Bacteria 1522
101 Ga0373927_0096944 3300035695 Bacteria 1917
102 Ga0373933_0002634 3300035724 Bacteria 10054
103 Ga0373937_0000236 3300036401 Bacteria 53991
104 Ga0316584_0066938 3300036712 Bacteria 2692
105 Ga0400490_22206 3300038726 Bacteria 4454
106 Ga0400490_48758 3300038726 Bacteria 1769
107 Ga0400488_11927 3300038741 Bacteria 2874
108 Ga0400488_50357 3300038741 Bacteria 3622
109 Ga0400489_52985 3300039093 Bacteria 19748
110 Ga0400487_48677 3300039110 Bacteria 5582
111 Ga0436365_1559723 3300039437 Bacteria 6563
112 Ga0436360_0673536 3300039438 Bacteria 8912
113 Ga0436361_0027708 3300039447 Bacteria 4543
114 Ga0436361_0089417 3300039447 Bacteria 4596
115 Ga0451577_0000336 3300042876 Bacteria 87609
116 Ga0453684_0000052 3300044712 Bacteria 546732
117 Ga0495591_000796 3300046458 Bacteria 22334
118 Ga0495591_001691 3300046458 Bacteria 13187
119 Ga0495638_0001019 3300046460 Bacteria 27876
120 Ga0495651_0040798 3300046462 Bacteria 3606
121 Ga0495650_0000026 3300046471 Bacteria 476029
122 Ga0495650_0002585 3300046471 Bacteria 14257
123 Ga0495580_0019131 3300046472 Bacteria 5090
124 Ga0495596_0000053 3300046500 Bacteria 84061
125 Ga0495596_0005529 3300046500 Bacteria 5950
126 Ga0495606_0000203 3300046507 Bacteria 103887
127 Ga0495606_0015080 3300046507 Bacteria 5980
128 Ga0495606_0054523 3300046507 Bacteria 2589
129 Ga0495616_0042937 3300046513 Bacteria 2299
130 Ga0495620_0019008 3300046515 Bacteria 3390
131 Ga0495643_0001274 3300046522 Bacteria 24163
132 Ga0495648_0007650 3300046524 Bacteria 8616
133 Ga0495648_0044072 3300046524 Bacteria 2788
134 Ga0495654_0000077 3300046530 Bacteria 112515
135 Ga0495654_0008590 3300046530 Bacteria 5629
136 Ga0495609_0010966 3300046538 Bacteria 4329
137 Ga0495671_0003808 3300046692 Bacteria 9170
138 Ga0495649_0000056 3300046694 Bacteria 103426
139 Ga0495649_0001248 3300046694 Bacteria 19573
140 Ga0495660_0000029 3300046810 Bacteria 228905
141 Ga0495604_0015729 3300047317 Bacteria 6038
142 Ga0495674_0077388 3300047319 Bacteria 2860
143 Ga0495672_0000001 3300047320 Bacteria 1458820
144 Ga0495672_0000059 3300047320 Bacteria 217302
145 Ga0495683_0005932 3300047323 Bacteria 6712
146 Ga0495683_0006712 3300047323 Bacteria 6267
147 Ga0495679_000797 3300047446 Bacteria 20006
148 Ga0495679_003233 3300047446 Bacteria 7914
149 Ga0495673_0000648 3300047469 Bacteria 34166
150 Ga0495673_0002200 3300047469 Bacteria 14105
151 Ga0495686_0022347 3300047472 Bacteria 4186
152 Ga0495602_0005518 3300048088 Bacteria 13269
153 Ga0496104_0018241 3300048907 Bacteria 6402
154 Ga0496106_0185436 3300048909 Bacteria 1653
155 Ga0496117_0000436 3300048920 Bacteria 69452
156 Ga0496117_0003982 3300048920 Bacteria 16686
157 Ga0496118_0003834 3300048921 Bacteria 18499
158 Ga0496119_0000438 3300048922 Bacteria 57088
159 Ga0496120_0001291 3300048923 Bacteria 31191
160 Ga0496120_0001589 3300048923 Bacteria 26413
161 Ga0496121_0000925 3300048924 Bacteria 53089
162 Ga0496121_0004324 3300048924 Bacteria 19227
163 Ga0496121_0024191 3300048924 Bacteria 5818
164 Ga0496122_0028717 3300048925 Bacteria 4710
165 Ga0496124_0000322 3300048927 Bacteria 88424
166 Ga0495678_001627 3300049459 Bacteria 17097
167 Ga0495682_0000001 3300049460 Bacteria 1559116
168 Ga0501037_0046500 3300049573 Bacteria 3182
169 Ga0501046_0079036 3300049580 Bacteria 2544
170 Ga0501047_0033317 3300049581 Bacteria 4972
171 Ga0501070_0049452 3300049586 Bacteria 3491
172 Ga0501072_0070748 3300049588 Bacteria 2756
173 Ga0501074_0143493 3300049590 Bacteria 1708
174 Ga0501080_0035781 3300049742 Bacteria 4635
175 Ga0501044_0088247 3300049823 Bacteria 3131
176 nmdc:mga05p37_160121_c1 3300050507 Bacteria 2750
177 nmdc:mga05p37_39084_c1 3300050507 Bacteria 5822
178 nmdc:mga05p37_8124_c1 3300050507 Bacteria 12403
179 nmdc:mga09592_24166_c1 3300050508 Bacteria 3469
180 nmdc:mga09592_732_c1 3300050508 Bacteria 25260
181 nmdc:mga09592_9483_c1 3300050508 Bacteria 7911
182 nmdc:mga0qj67_117881_c1 3300050509 Bacteria 2146
183 nmdc:mga0qj67_1794_c1 3300050509 Bacteria 15182
184 nmdc:mga0qj67_35303_c1 3300050509 Bacteria 3908
185 nmdc:mga0qj67_9406_c1 3300050509 Bacteria 7270
186 nmdc:mga06r32_21929_c1 3300050510 Bacteria 5898
187 nmdc:mga06r32_3892_c1 3300050510 Bacteria 13380
188 nmdc:mga08y16_96_c1 3300050511 Bacteria 74719
189 Ga0500643_000707 3300053087 Bacteria 22129
190 Ga0500641_0003857 3300053096 Bacteria 5302
191 Ga0500654_066505 3300053099 Bacteria 1795
192 Ga0500595_008349 3300053119 Bacteria 4235
193 Ga0500621_000003 3300053126 Bacteria 596975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0022347 Ga0495686_0022347_2892_4169 402
2 3300035410 Ga0373924_0065829 Ga0373924_0065829_105_1502 416
3 3300005548 Ga0070665_100000413 Ga0070665_10000041336 475
4 3300028379 Ga0268266_10000631 Ga0268266_1000063123 475
5 3300053119 Ga0500595_008349 Ga0500595_008349_714_2225 475
6 3300048924 Ga0496121_0024191 Ga0496121_0024191_3837_5345 478
7 3300046507 Ga0495606_0000203 Ga0495606_0000203_88005_89519 479
8 3300048924 Ga0496121_0004324 Ga0496121_0004324_17212_18726 479
9 3300035117 Ga0373953_0031438 Ga0373953_0031438_520_2025 480
10 iso_pu_bacteria 2510917021 2511126955 481
11 3300006847 Ga0075431_100010687 Ga0075431_1000106872 482
12 3300006880 Ga0075429_100005388 Ga0075429_10000538817 482
13 3300006880 Ga0075429_100009489 Ga0075429_1000094897 482
14 3300009147 Ga0114129_10011862 Ga0114129_100118624 482
15 3300050507 nmdc:mga05p37_39084_c1 nmdc:mga05p37_39084_c1_2789_4303 482
16 3300050507 nmdc:mga05p37_8124_c1 nmdc:mga05p37_8124_c1_8519_10033 482
17 3300050508 nmdc:mga09592_732_c1 nmdc:mga09592_732_c1_12861_14375 482
18 3300050508 nmdc:mga09592_9483_c1 nmdc:mga09592_9483_c1_4381_5895 482
19 3300050509 nmdc:mga0qj67_1794_c1 nmdc:mga0qj67_1794_c1_11298_12812 482
20 3300050509 nmdc:mga0qj67_9406_c1 nmdc:mga0qj67_9406_c1_3159_4673 482
21 3300050510 nmdc:mga06r32_21929_c1 nmdc:mga06r32_21929_c1_2341_3855 482
22 3300050510 nmdc:mga06r32_3892_c1 nmdc:mga06r32_3892_c1_9496_11010 482
23 iso_pu_bacteria 2718218334 2721026867 482
24 3300048909 Ga0496106_0185436 Ga0496106_0185436_140_1630 483
25 3300046507 Ga0495606_0054523 Ga0495606_0054523_729_2237 484
26 3300049573 Ga0501037_0046500 Ga0501037_0046500_1484_2998 485
27 3300049581 Ga0501047_0033317 Ga0501047_0033317_2264_3778 485
28 3300049586 Ga0501070_0049452 Ga0501070_0049452_1408_2922 485
29 3300049742 Ga0501080_0035781 Ga0501080_0035781_431_1945 485
30 3300049823 Ga0501044_0088247 Ga0501044_0088247_759_2273 485
31 3300031727 Ga0316576_10000088 Ga0316576_100000883 487
32 3300046500 Ga0495596_0000053 Ga0495596_0000053_25870_27393 487
33 3300046538 Ga0495609_0010966 Ga0495609_0010966_1620_3143 487
34 3300035398 Ga0316574_0020288 Ga0316574_0020288_683_2203 488
35 3300039437 Ga0436365_1559723 Ga0436365_1559723_1876_3540 488
36 3300046472 Ga0495580_0019131 Ga0495580_0019131_1084_2697 488
37 3300047319 Ga0495674_0077388 Ga0495674_0077388_672_2285 488
38 3300005937 Ga0081455_10001131 Ga0081455_1000113114 489
39 3300005937 Ga0081455_10008819 Ga0081455_100088194 489
40 3300047469 Ga0495673_0002200 Ga0495673_0002200_2286_3821 489
41 3300002077 JGI24744J21845_10001804 JGI24744J21845_100018043 490
42 3300048920 Ga0496117_0000436 Ga0496117_0000436_43320_44903 490
43 3300048924 Ga0496121_0000925 Ga0496121_0000925_27669_29252 490
44 3300049580 Ga0501046_0079036 Ga0501046_0079036_154_1872 490
45 3300049590 Ga0501074_0143493 Ga0501074_0143493_46_1590 490
46 3300009094 Ga0111539_10000146 Ga0111539_1000014628 491
47 3300013296 Ga0157374_10052462 Ga0157374_100524623 491
48 3300031728 Ga0316578_10093909 Ga0316578_100939091 491
49 3300035398 Ga0316574_0041252 Ga0316574_0041252_299_1819 491
50 3300035695 Ga0373927_0096944 Ga0373927_0096944_47_1588 492
51 3300049588 Ga0501072_0070748 Ga0501072_0070748_76_1620 492
52 3300035086 Ga0373934_0027575 Ga0373934_0027575_240_1898 493
53 3300048923 Ga0496120_0001589 Ga0496120_0001589_11816_13399 494
54 3300006846 Ga0075430_100029048 Ga0075430_1000290482 495
55 3300050508 nmdc:mga09592_24166_c1 nmdc:mga09592_24166_c1_406_1947 495
56 3300050509 nmdc:mga0qj67_35303_c1 nmdc:mga0qj67_35303_c1_1423_2964 495
57 3300027907 Ga0207428_10005113 Ga0207428_100051136 496
58 3300028800 Ga0265338_10051587 Ga0265338_100515872 496
59 3300031249 Ga0265339_10000051 Ga0265339_1000005190 496
60 3300031595 Ga0265313_10000011 Ga0265313_1000001123 496
61 3300053087 Ga0500643_000707 Ga0500643_000707_13771_15426 496
62 iso_pu_bacteria 2836160341 2836164133 496
63 3300035172 Ga0373955_0011965 Ga0373955_0011965_873_2501 497
64 3300038726 Ga0400490_22206 Ga0400490_22206_233_1783 497
65 3300038741 Ga0400488_50357 Ga0400488_50357_615_2165 497
66 3300009147 Ga0114129_10020771 Ga0114129_100207712 498
67 3300038741 Ga0400488_11927 Ga0400488_11927_90_1655 498
68 3300039110 Ga0400487_48677 Ga0400487_48677_2443_3996 498
69 3300050507 nmdc:mga05p37_160121_c1 nmdc:mga05p37_160121_c1_588_2135 498
70 3300028800 Ga0265338_10000140 Ga0265338_1000014025 499
71 3300031727 Ga0316576_10098314 Ga0316576_100983141 499
72 3300031733 Ga0316577_10041719 Ga0316577_100417192 499
73 3300006846 Ga0075430_100094202 Ga0075430_1000942022 500
74 3300050509 nmdc:mga0qj67_117881_c1 nmdc:mga0qj67_117881_c1_182_1768 500
75 3300009011 Ga0105251_10000503 Ga0105251_1000050335 501
76 3300025912 Ga0207707_10071379 Ga0207707_100713792 501
77 3300025921 Ga0207652_10057569 Ga0207652_100575692 501
78 3300031249 Ga0265339_10002223 Ga0265339_1000222314 502
79 3300039093 Ga0400489_52985 Ga0400489_52985_14415_15977 502
80 3300046513 Ga0495616_0042937 Ga0495616_0042937_717_2264 503
81 3300047320 Ga0495672_0000001 Ga0495672_0000001_40686_42233 503
82 3300005985 Ga0081539_10001131 Ga0081539_100011315 504
83 3300035119 Ga0373956_0013949 Ga0373956_0013949_32_1633 504
84 3300035724 Ga0373933_0002634 Ga0373933_0002634_2874_4475 504
85 3300036401 Ga0373937_0000236 Ga0373937_0000236_36819_38420 504
86 3300046462 Ga0495651_0040798 Ga0495651_0040798_1344_2945 504
87 3300047317 Ga0495604_0015729 Ga0495604_0015729_2620_4221 504
88 3300048088 Ga0495602_0005518 Ga0495602_0005518_9962_11563 504
89 3300048925 Ga0496122_0028717 Ga0496122_0028717_41_1576 504
90 3300053096 Ga0500641_0003857 Ga0500641_0003857_1054_2598 504
91 3300005937 Ga0081455_10018883 Ga0081455_100188831 505
92 3300005981 Ga0081538_10066849 Ga0081538_100668492 505
93 3300005983 Ga0081540_1028349 Ga0081540_10283492 505
94 3300029957 Ga0265324_10025622 Ga0265324_100256221 505
95 3300031727 Ga0316576_10000330 Ga0316576_100003304 505
96 3300031728 Ga0316578_10094296 Ga0316578_100942961 505
97 3300036712 Ga0316584_0066938 Ga0316584_0066938_598_2157 505
98 3300038726 Ga0400490_48758 Ga0400490_48758_57_1658 505
99 3300005617 Ga0068859_100005639 Ga0068859_1000056398 506
100 3300006844 Ga0075428_100064649 Ga0075428_1000646493 506
101 3300006931 Ga0097620_100005639 Ga0097620_1000056398 506
102 3300013296 Ga0157374_10020915 Ga0157374_100209153 506
103 3300014326 Ga0157380_10023305 Ga0157380_100233053 506
104 3300025926 Ga0207659_10083544 Ga0207659_100835442 506
105 3300031548 Ga0307408_100001359 Ga0307408_1000013595 506
106 3300042876 Ga0451577_0000336 Ga0451577_0000336_53255_54832 506
107 3300044712 Ga0453684_0000052 Ga0453684_0000052_263189_264766 506
108 3300005536 Ga0070697_100128335 Ga0070697_1001283352 508
109 3300009036 Ga0105244_10000394 Ga0105244_100003942 508
110 3300024227 Ga0228598_1002484 Ga0228598_10024842 508
111 3300046522 Ga0495643_0001274 Ga0495643_0001274_20131_21711 508
112 3300047320 Ga0495672_0000059 Ga0495672_0000059_75445_77004 508
113 iso_pu_bacteria 2932784394 2932788451 508
114 3300009094 Ga0111539_10000096 Ga0111539_1000009691 509
115 3300027907 Ga0207428_10000120 Ga0207428_100001206 509
116 3300050511 nmdc:mga08y16_96_c1 nmdc:mga08y16_96_c1_61391_63046 509
117 iso_pu_bacteria 2509276033 2509444333 509
118 iso_pu_bacteria 2738543024 2739307042 509
119 iso_pu_bacteria 2791355123 2792748342 509
120 iso_pu_bacteria 2791355259 2793313968 509
121 iso_pu_bacteria 2841864319 2841866334 509
122 iso_pu_bacteria 2842341865 2842342305 509
123 iso_pu_bacteria 2881665667 2881672229 509
124 3300003856 Ga0058692_1000747 Ga0058692_100074714 510
125 3300027312 Ga0209371_1007803 Ga0209371_10078032 510
126 3300027312 Ga0209371_1013280 Ga0209371_10132801 510
127 3300028016 Ga0265354_1000450 Ga0265354_10004505 510
128 3300030500 Ga0268256_1008061 Ga0268256_10080612 510
129 3300030878 Ga0265770_1000237 Ga0265770_10002372 510
130 3300030879 Ga0265765_1000004 Ga0265765_10000042 510
131 3300031251 Ga0265327_10021288 Ga0265327_100212883 510
132 3300033547 Ga0316212_1000239 Ga0316212_10002395 510
133 3300053099 Ga0500654_066505 Ga0500654_066505_35_1702 510
134 iso_pu_bacteria 2775506902 2776271655 510
135 iso_pu_bacteria 2775506904 2776279832 510
136 3300005288 Ga0065714_10007007 Ga0065714_100070073 511
137 3300005434 Ga0070709_10017290 Ga0070709_100172902 511
138 3300005618 Ga0068864_100065517 Ga0068864_1000655172 511
139 3300005844 Ga0068862_100048402 Ga0068862_1000484022 511
140 3300006175 Ga0070712_100059011 Ga0070712_1000590113 511
141 3300006175 Ga0070712_100106061 Ga0070712_1001060612 511
142 3300009553 Ga0105249_10196963 Ga0105249_101969631 511
143 3300025907 Ga0207645_10032822 Ga0207645_100328222 511
144 3300025915 Ga0207693_10071599 Ga0207693_100715992 511
145 3300025916 Ga0207663_10047182 Ga0207663_100471823 511
146 3300025925 Ga0207650_10112099 Ga0207650_101120992 511
147 3300025926 Ga0207659_10069076 Ga0207659_100690762 511
148 3300025933 Ga0207706_10035465 Ga0207706_100354652 511
149 3300025940 Ga0207691_10060729 Ga0207691_100607292 511
150 3300026118 Ga0207675_100061462 Ga0207675_1000614622 511
151 3300028381 Ga0268264_10045148 Ga0268264_100451484 511
152 3300028800 Ga0265338_10036173 Ga0265338_100361733 511
153 3300031247 Ga0265340_10014537 Ga0265340_100145373 511
154 3300039447 Ga0436361_0027708 Ga0436361_0027708_2159_3790 511
155 3300005543 Ga0070672_100094794 Ga0070672_1000947942 512
156 3300009765 Ga0123341_1000038 Ga0123341_100003819 512
157 3300013249 Ga0171463_1003 Ga0171463_1003233 512
158 3300015690 Ga0183363_1093 Ga0183363_10933 512
159 3300031247 Ga0265340_10001555 Ga0265340_100015558 512
160 3300031250 Ga0265331_10026103 Ga0265331_100261032 512
161 3300031251 Ga0265327_10053231 Ga0265327_100532311 512
162 3300031595 Ga0265313_10009258 Ga0265313_100092585 512
163 3300031711 Ga0265314_10039866 Ga0265314_100398662 512
164 3300031730 Ga0307516_10002210 Ga0307516_1000221013 512
165 3300039438 Ga0436360_0673536 Ga0436360_0673536_836_2470 512
166 3300039447 Ga0436361_0089417 Ga0436361_0089417_325_2184 512
167 iso_pu_bacteria 2602042109 2603865591 512
168 iso_pu_bacteria 8055092621 8055092766 513
169 iso_pu_bacteria 2600255287 2601642674 514
170 iso_pu_bacteria 2600255291 2601662495 514
171 iso_pu_bacteria 2600255298 2601695452 514
172 iso_pu_bacteria 2600255299 2601700128 514
173 iso_pu_bacteria 2600255303 2601720479 514
174 iso_pu_bacteria 2602042052 2603659867 514
175 iso_pu_bacteria 2602042053 2603665144 514
176 iso_pu_bacteria 2602042111 2603875831 514
177 iso_pu_bacteria 2603880184 2606069574 514
178 iso_pu_bacteria 2919108558 2919111381 514
179 iso_pu_bacteria 8054844752 8054844782 514
180 iso_pu_bacteria 8054849141 8054850567 514
181 iso_pu_bacteria 8057304971 8057306081 514
182 3300025893 Ga0207682_10025995 Ga0207682_100259952 515
183 iso_pu_bacteria 8006964411 8006969425 515
184 3300046458 Ga0495591_000796 Ga0495591_000796_7525_9120 516
185 3300046471 Ga0495650_0000026 Ga0495650_0000026_14122_15720 516
186 3300046500 Ga0495596_0005529 Ga0495596_0005529_640_2223 516
187 3300046507 Ga0495606_0015080 Ga0495606_0015080_3540_5138 516
188 3300046524 Ga0495648_0007650 Ga0495648_0007650_3029_4627 516
189 3300046524 Ga0495648_0044072 Ga0495648_0044072_1089_2684 516
190 3300046530 Ga0495654_0000077 Ga0495654_0000077_110879_112477 516
191 3300046530 Ga0495654_0008590 Ga0495654_0008590_3996_5591 516
192 3300046692 Ga0495671_0003808 Ga0495671_0003808_1015_2610 516
193 3300046810 Ga0495660_0000029 Ga0495660_0000029_211097_212695 516
194 3300047323 Ga0495683_0005932 Ga0495683_0005932_671_2266 516
195 3300047323 Ga0495683_0006712 Ga0495683_0006712_4567_6165 516
196 3300047469 Ga0495673_0000648 Ga0495673_0000648_31464_33059 516
197 3300049459 Ga0495678_001627 Ga0495678_001627_14720_16318 516
198 3300049460 Ga0495682_0000001 Ga0495682_0000001_1045944_1047626 516
199 3300053126 Ga0500621_000003 Ga0500621_000003_388985_390580 516
200 2162886007 SwRhRL2b_contig_407357 SwRhRL2b_0086.00003270 518
201 3300005289 Ga0065704_10074587 Ga0065704_100745873 518
202 3300006946 Ga0079104_1001810 Ga0079104_10018104 518
203 3300006946 Ga0079104_1002891 Ga0079104_10028913 518
204 3300009036 Ga0105244_10000024 Ga0105244_1000002460 518
205 3300025728 Ga0207655_1000042 Ga0207655_1000042101 518
206 3300025728 Ga0207655_1000660 Ga0207655_100066044 518
207 3300027111 Ga0209281_1001071 Ga0209281_100107115 518
208 3300027111 Ga0209281_1001702 Ga0209281_10017024 518
209 3300046458 Ga0495591_001691 Ga0495591_001691_2562_4139 518
210 3300046460 Ga0495638_0001019 Ga0495638_0001019_1355_2932 518
211 3300046471 Ga0495650_0002585 Ga0495650_0002585_2425_4002 518
212 3300046515 Ga0495620_0019008 Ga0495620_0019008_910_2487 518
213 3300046694 Ga0495649_0000056 Ga0495649_0000056_29952_31529 518
214 3300046694 Ga0495649_0001248 Ga0495649_0001248_15578_17155 518
215 3300047446 Ga0495679_000797 Ga0495679_000797_12157_13734 518
216 3300047446 Ga0495679_003233 Ga0495679_003233_5855_7432 518
217 3300048907 Ga0496104_0018241 Ga0496104_0018241_2222_3799 518
218 3300048920 Ga0496117_0003982 Ga0496117_0003982_2555_4132 518
219 3300048921 Ga0496118_0003834 Ga0496118_0003834_4014_5591 518
220 3300048922 Ga0496119_0000438 Ga0496119_0000438_30592_32169 518
221 3300048923 Ga0496120_0001291 Ga0496120_0001291_3894_5471 518
222 3300048927 Ga0496124_0000322 Ga0496124_0000322_1255_2832 518

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00884

Sulfatase

Sulfatase

117

460

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aj0-assembly1.cif.gz_F crystal structure of psfucs1 sulfatase from pseudoalteromonas sp. 0.8732 34 497
1e33-assembly1.cif.gz_P-2 crystal structure of an arylsulfatase a mutant p426l 0.8259 34 498
1n2k-assembly1.cif.gz_A crystal structure of a covalent intermediate of endogenous human arylsulfatase a 0.8209 34 497
8eg3-assembly1.cif.gz_A structure of human placental steroid (estrone/dhea) sulfatase at 2.0 angstrom resolution 0.8201 31 502
1p49-assembly1.cif.gz_A structure of human placental estrone/dhea sulfatase 0.8176 31 501
ID Description Score Start End Superfamily
1e1zP01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8701 34 400 3.40.720.10
af_Q32KJ6_30_387_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8413 34 406 3.40.720.10
1p49A01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8388 31 393 3.40.720.10
af_Q8SZ72_26_377_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8369 35 400 3.40.720.10
af_Q32KJ6_30_387_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8368 34 406 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A4Q5Y054-F1-model_v4 deleted 0.9934 34 467
AF-A0A090RV80-F1-model_v4 Arylsulfatase (EC 3.1.6.1) 0.9902 59 443 GO:0004065
AF-A0A1H5VT36-F1-model_v4 Arylsulfatase 0.989 57 512
AF-A0A6G4UEH7-F1-model_v4 Arylsulfatase 0.9885 34 513
AF-A0A2E0Z4C0-F1-model_v4 Arylsulfatase 0.9879 39 512

Feature Viewer

pLDDT pTM Quality
87.97 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map