F334348

General Info

Members Datasets Scaffolds Average Seq Length
222 165 222 139

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100074984|Ga0075429_1000749845
Length 153
Sequence MAETALQHRGEAAPRTTLPTSLDVEMVTPRGVIAHENTDALTAPGELGEFELLPGHVPLLTALKPGVLTIGEKKPTRYAVSSGYLRVGVGGAIEVLVEQAMLGSEVDVEVARTELKAAEAELAKWGDRELDGDYRNLVQRAEWARARLDAAST

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
94 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
107 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
131 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
132 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
133 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
134 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
143 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
144 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
145 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
146 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
147 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
148 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
149 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
150 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
151 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
152 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
157 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
158 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
159 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
162 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
163 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
164 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
165 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.06
Nodule 0
Rhizoplane 1.8
Rhizosphere 78.38
Stem 0
Stem Tuber 0
Unclassified 6.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100132530 3300005329 Bacteria 2359
2 Ga0070683_101881937 3300005329 Bacteria 575
3 Ga0070670_100779261 3300005331 Bacteria 863
4 Ga0068869_100206864 3300005334 Bacteria 1550
5 Ga0068869_100339142 3300005334 Bacteria 1223
6 Ga0068869_100388246 3300005334 Bacteria 1145
7 Ga0068869_100724372 3300005334 Unclassified 850
8 Ga0070680_100491217 3300005336 Bacteria 1050
9 Ga0068868_101173850 3300005338 Bacteria 709
10 Ga0070689_100010286 3300005340 Bacteria 6668
11 Ga0070689_100021586 3300005340 Bacteria 4796
12 Ga0070689_100174179 3300005340 Bacteria 1744
13 Ga0070689_100380402 3300005340 Bacteria 1190
14 Ga0070687_100181226 3300005343 Bacteria 1262
15 Ga0070687_100879849 3300005343 Bacteria 641
16 Ga0070692_10079117 3300005345 Bacteria 1767
17 Ga0070692_10593656 3300005345 Bacteria 732
18 Ga0070688_100633143 3300005365 Bacteria 822
19 Ga0070688_100754244 3300005365 Unclassified 758
20 Ga0070701_10054299 3300005438 Bacteria 2088
21 Ga0070705_100442623 3300005440 Bacteria 973
22 Ga0070700_100280953 3300005441 Bacteria 1207
23 Ga0070708_100681411 3300005445 Bacteria 968
24 Ga0070708_101263279 3300005445 Unclassified 690
25 Ga0070706_100246070 3300005467 Bacteria 1670
26 Ga0070707_101881389 3300005468 Unclassified 566
27 Ga0070698_100752334 3300005471 Bacteria 918
28 Ga0070698_101437121 3300005471 Bacteria 641
29 Ga0070699_101005098 3300005518 Unclassified 765
30 Ga0070679_100018873 3300005530 Bacteria 6695
31 Ga0070679_100189293 3300005530 Bacteria 2027
32 Ga0070697_100620343 3300005536 Bacteria 951
33 Ga0068853_101906353 3300005539 Unclassified 576
34 Ga0070695_100510832 3300005545 Bacteria 931
35 Ga0070665_100027766 3300005548 Bacteria 5698
36 Ga0068855_100441252 3300005563 Bacteria 1422
37 Ga0068857_100420906 3300005577 Bacteria 1245
38 Ga0068856_100141702 3300005614 Bacteria 2411
39 Ga0070702_100349603 3300005615 Bacteria 1041
40 Ga0068859_100206722 3300005617 Bacteria 2048
41 Ga0068859_102645876 3300005617 Bacteria 552
42 Ga0068864_100057250 3300005618 Bacteria 3367
43 Ga0068864_100264870 3300005618 Unclassified 1600
44 Ga0068866_10134223 3300005718 Bacteria 1412
45 Ga0068851_10327813 3300005834 Bacteria 886
46 Ga0068863_100631171 3300005841 Bacteria 1062
47 Ga0068863_102621214 3300005841 Unclassified 513
48 Ga0068858_100632103 3300005842 Bacteria 1040
49 Ga0068860_101335887 3300005843 Bacteria 738
50 Ga0068860_101627305 3300005843 Bacteria 668
51 Ga0081455_10213656 3300005937 Bacteria 1435
52 Ga0070717_10129402 3300006028 Bacteria 2170
53 Ga0070712_100765573 3300006175 Bacteria 827
54 Ga0075429_100074984 3300006880 Bacteria 2947
55 Ga0075429_100141082 3300006880 Bacteria 2109
56 Ga0075429_100721680 3300006880 Unclassified 873
57 Ga0097620_100206726 3300006931 Bacteria 2048
58 Ga0097620_102645356 3300006931 Bacteria 552
59 Ga0075435_100752877 3300007076 Bacteria 847
60 Ga0105240_10937936 3300009093 Bacteria 929
61 Ga0105245_10000065 3300009098 Bacteria 109701
62 Ga0105245_10922792 3300009098 Bacteria 915
63 Ga0114129_10479005 3300009147 Bacteria 1629
64 Ga0105243_10393536 3300009148 Bacteria 1285
65 Ga0105242_11761083 3300009176 Archaea 657
66 Ga0105248_11262981 3300009177 Bacteria 835
67 Ga0105238_12054743 3300009551 Bacteria 605
68 Ga0105249_10582787 3300009553 Bacteria 1172
69 Ga0105249_11439282 3300009553 Bacteria 761
70 Ga0105239_10242115 3300010375 Bacteria 2025
71 Ga0157374_10383488 3300013296 Bacteria 1400
72 Ga0157374_11308064 3300013296 Bacteria 747
73 Ga0157378_10060112 3300013297 Bacteria 3391
74 Ga0163163_11058962 3300014325 Bacteria 874
75 Ga0163163_11303337 3300014325 Bacteria 788
76 Ga0157379_10654748 3300014968 Bacteria 983
77 Ga0157376_10040012 3300014969 Bacteria 3829
78 Ga0157376_10398876 3300014969 Unclassified 1330
79 Ga0213876_10045587 3300021384 Bacteria 2318
80 Ga0207642_11064781 3300025899 Bacteria 522
81 Ga0207705_10291908 3300025909 Unclassified 1249
82 Ga0207684_10101719 3300025910 Bacteria 2457
83 Ga0207660_10053594 3300025917 Bacteria 2876
84 Ga0207662_10046754 3300025918 Bacteria 2561
85 Ga0207662_11033533 3300025918 Bacteria 584
86 Ga0207652_10334803 3300025921 Bacteria 1367
87 Ga0207652_10370021 3300025921 Bacteria 1294
88 Ga0207646_11158433 3300025922 Bacteria 679
89 Ga0207650_10316819 3300025925 Bacteria 1277
90 Ga0207687_10000081 3300025927 Bacteria 70015
91 Ga0207686_10563003 3300025934 Bacteria 892
92 Ga0207709_10232075 3300025935 Bacteria 1337
93 Ga0207670_10015457 3300025936 Bacteria 4562
94 Ga0207670_10024193 3300025936 Bacteria 3794
95 Ga0207670_10764025 3300025936 Bacteria 803
96 Ga0207704_10254327 3300025938 Bacteria 1321
97 Ga0207689_10096153 3300025942 Bacteria 2433
98 Ga0207689_10160688 3300025942 Bacteria 1851
99 Ga0207689_10243536 3300025942 Bacteria 1486
100 Ga0207661_11375927 3300025944 Bacteria 648
101 Ga0207667_10663092 3300025949 Bacteria 1048
102 Ga0207712_10490624 3300025961 Bacteria 1048
103 Ga0207712_10738275 3300025961 Bacteria 862
104 Ga0207658_10269746 3300025986 Bacteria 1454
105 Ga0207677_10387502 3300026023 Bacteria 1181
106 Ga0207677_11141577 3300026023 Bacteria 712
107 Ga0207708_10548175 3300026075 Bacteria 975
108 Ga0207641_10483397 3300026088 Bacteria 1200
109 Ga0207641_11049251 3300026088 Bacteria 813
110 Ga0207676_10449508 3300026095 Bacteria 1214
111 Ga0207676_11756604 3300026095 Bacteria 619
112 Ga0207674_11883699 3300026116 Bacteria 564
113 Ga0207675_100151662 3300026118 Bacteria 2206
114 Ga0207683_10117984 3300026121 Unclassified 2380
115 Ga0268266_10014372 3300028379 Bacteria 6809
116 Ga0268264_10544678 3300028381 Bacteria 1137
117 Ga0268264_10871176 3300028381 Bacteria 903
118 Ga0268264_11323990 3300028381 Bacteria 730
119 Ga0307515_10019223 3300028794 Bacteria 12312
120 Ga0265338_10023394 3300028800 Bacteria 6355
121 Ga0265332_10009589 3300031238 Bacteria 4320
122 Ga0307513_10030370 3300031456 Bacteria 6140
123 Ga0307513_10312429 3300031456 Bacteria 1333
124 Ga0307509_10002402 3300031507 Bacteria 30348
125 Ga0307509_10011175 3300031507 Bacteria 10920
126 Ga0307509_10027186 3300031507 Bacteria 6368
127 Ga0307509_10054924 3300031507 Bacteria 4237
128 Ga0307509_10066036 3300031507 Bacteria 3797
129 Ga0307509_10835033 3300031507 Bacteria 586
130 Ga0307508_10031248 3300031616 Bacteria 4813
131 Ga0265314_10131505 3300031711 Unclassified 1561
132 Ga0265314_10153185 3300031711 Bacteria 1411
133 Ga0307405_11340320 3300031731 Bacteria 624
134 Ga0307406_10005350 3300031901 Bacteria 7026
135 Ga0307406_10246033 3300031901 Bacteria 1344
136 Ga0307407_10940708 3300031903 Bacteria 665
137 Ga0307507_10096069 3300033179 Bacteria 2509
138 Ga0373944_0041416 3300035089 Bacteria 1425
139 Ga0373949_0000095 3300035090 Bacteria 32893
140 Ga0373936_0000046 3300035113 Bacteria 82874
141 Ga0373941_0004291 3300035115 Bacteria 3282
142 Ga0373954_0070761 3300035118 Bacteria 1658
143 Ga0373957_0405692 3300035120 Bacteria 587
144 Ga0373961_0000115 3300035241 Bacteria 41722
145 Ga0395899_0068772 3300037312 Bacteria 2595
146 Ga0395899_0287996 3300037312 Bacteria 1115
147 Ga0395900_0018145 3300037418 Bacteria 7179
148 Ga0395901_0012187 3300038443 Bacteria 8725
149 Ga0436365_0848652 3300039437 Bacteria 4058
150 Ga0436360_0733219 3300039438 Unclassified 720
151 Ga0436363_0682422 3300039450 Bacteria 1559
152 Ga0451797_0605463 3300041453 Unclassified 521
153 Ga0451807_2161667 3300041486 Bacteria 602
154 Ga0451853_3212823 3300041512 Bacteria 576
155 Ga0451577_1055218 3300042876 Bacteria 728
156 Ga0466961_0246679 3300044693 Bacteria 1097
157 Ga0453684_0190001 3300044712 Bacteria 2403
158 Ga0451576_0541521 3300045051 Bacteria 1223
159 Ga0451576_2626057 3300045051 Bacteria 513
160 Ga0466967_0169733 3300045976 Bacteria 2052
161 Ga0495686_0009276 3300047472 Bacteria 7106
162 Ga0496112_1661501 3300048915 Bacteria 552
163 Ga0496114_0029063 3300048917 Bacteria 4541
164 Ga0501033_0876337 3300049570 Unclassified 604
165 Ga0501034_0214492 3300049571 Bacteria 1879
166 Ga0501036_1624506 3300049572 Bacteria 522
167 Ga0501038_0573075 3300049574 Bacteria 857
168 Ga0501046_0357017 3300049580 Bacteria 1060
169 Ga0501047_0322053 3300049581 Bacteria 1385
170 Ga0501067_0252031 3300049583 Bacteria 983
171 Ga0501069_0203193 3300049585 Bacteria 1149
172 Ga0501071_0081778 3300049587 Bacteria 2364
173 Ga0501072_0066043 3300049588 Bacteria 2854
174 Ga0501073_0296598 3300049589 Bacteria 1115
175 Ga0501074_0105586 3300049590 Bacteria 2016
176 Ga0501077_0380468 3300049593 Bacteria 902
177 Ga0501227_000343 3300049665 Bacteria 9811
178 Ga0501227_003584 3300049665 Bacteria 3364
179 Ga0501230_003366 3300049667 Bacteria 2120
180 Ga0501233_036956 3300049668 Bacteria 1132
181 Ga0501235_009546 3300049669 Bacteria 2120
182 Ga0501225_0002507 3300049705 Bacteria 5682
183 Ga0501225_0033465 3300049705 Bacteria 1414
184 Ga0501080_0512925 3300049742 Bacteria 1070
185 Ga0501080_0794620 3300049742 Bacteria 830
186 Ga0501081_0108807 3300049743 Bacteria 1966
187 Ga0501232_051328 3300049757 Unclassified 636
188 Ga0501035_0769897 3300049822 Bacteria 771
189 nmdc:mga05p37_410002_c1 3300050507 Bacteria 1580
190 nmdc:mga09592_247609_c1 3300050508 Bacteria 1545
191 nmdc:mga09592_338834_c1 3300050508 Bacteria 1302
192 nmdc:mga09592_713237_c1 3300050508 Unclassified 853
193 nmdc:mga0qj67_206604_c1 3300050509 Bacteria 1595
194 Ga0500578_0352137 3300053086 Bacteria 860
195 Ga0500646_0043197 3300053090 Bacteria 1275
196 Ga0500566_0005430 3300053094 Bacteria 7581
197 Ga0500566_0006942 3300053094 Bacteria 6707
198 Ga0500566_0064523 3300053094 Bacteria 2067
199 Ga0500640_010286 3300053095 Bacteria 3776
200 Ga0500654_109950 3300053099 Bacteria 1134
201 Ga0500554_000385 3300053102 Bacteria 9510
202 Ga0500554_084736 3300053102 Bacteria 1048
203 Ga0500556_0180595 3300053104 Bacteria 834
204 Ga0500572_002596 3300053111 Bacteria 4293
205 Ga0500595_000189 3300053119 Bacteria 42008
206 Ga0500614_000690 3300053123 Bacteria 8651
207 Ga0500614_015163 3300053123 Bacteria 1716
208 Ga0500617_150159 3300053124 Bacteria 923
209 Ga0500658_0264482 3300053134 Bacteria 791
210 Ga0500559_0008855 3300053136 Bacteria 4384
211 Ga0500564_158982 3300053138 Bacteria 958
212 Ga0500564_225768 3300053138 Bacteria 755
213 Ga0500568_0014475 3300053139 Bacteria 3561
214 Ga0500585_018196 3300053144 Bacteria 2248
215 Ga0500588_0213807 3300053146 Bacteria 717
216 Ga0500603_022372 3300053150 Bacteria 1565
217 Ga0500622_0039921 3300053156 Bacteria 2446
218 Ga0500630_119793 3300053159 Bacteria 1168
219 Ga0500639_102245 3300053163 Bacteria 1408
220 Ga0500636_0132521 3300053177 Bacteria 1387
221 Ga0500637_0398666 3300053178 Unclassified 715
222 Ga0500596_025596 3300053735 Bacteria 901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100246070 Ga0070706_1002460702 121
2 3300025910 Ga0207684_10101719 Ga0207684_101017192 121
3 3300049574 Ga0501038_0573075 Ga0501038_0573075_141_566 122
4 3300005563 Ga0068855_100441252 Ga0068855_1004412523 126
5 3300025949 Ga0207667_10663092 Ga0207667_106630922 126
6 3300026095 Ga0207676_11756604 Ga0207676_117566041 134
7 3300005471 Ga0070698_100752334 Ga0070698_1007523342 135
8 3300049665 Ga0501227_000343 Ga0501227_000343_7196_7615 135
9 3300049667 Ga0501230_003366 Ga0501230_003366_1601_2020 135
10 3300049669 Ga0501235_009546 Ga0501235_009546_1189_1608 135
11 3300049705 Ga0501225_0002507 Ga0501225_0002507_1714_2133 135
12 3300049757 Ga0501232_051328 Ga0501232_051328_171_590 135
13 3300050509 nmdc:mga0qj67_206604_c1 nmdc:mga0qj67_206604_c1_701_1123 135
14 3300005530 Ga0070679_100189293 Ga0070679_1001892932 137
15 3300005841 Ga0068863_102621214 Ga0068863_1026212141 137
16 3300005842 Ga0068858_100632103 Ga0068858_1006321032 137
17 3300009176 Ga0105242_11761083 Ga0105242_117610832 137
18 3300021384 Ga0213876_10045587 Ga0213876_100455872 137
19 3300025899 Ga0207642_11064781 Ga0207642_110647811 137
20 3300025909 Ga0207705_10291908 Ga0207705_102919082 137
21 3300025921 Ga0207652_10334803 Ga0207652_103348032 137
22 3300025934 Ga0207686_10563003 Ga0207686_105630031 137
23 3300039437 Ga0436365_0848652 Ga0436365_0848652_3022_3435 137
24 3300042876 Ga0451577_1055218 Ga0451577_1055218_16_429 137
25 3300044693 Ga0466961_0246679 Ga0466961_0246679_42_455 137
26 3300044712 Ga0453684_0190001 Ga0453684_0190001_699_1112 137
27 3300045051 Ga0451576_0541521 Ga0451576_0541521_332_745 137
28 3300049572 Ga0501036_1624506 Ga0501036_1624506_71_484 137
29 3300049665 Ga0501227_003584 Ga0501227_003584_2265_2678 137
30 3300049668 Ga0501233_036956 Ga0501233_036956_273_686 137
31 3300049705 Ga0501225_0033465 Ga0501225_0033465_402_815 137
32 3300005329 Ga0070683_100132530 Ga0070683_1001325302 138
33 3300005329 Ga0070683_101881937 Ga0070683_1018819371 138
34 3300005331 Ga0070670_100779261 Ga0070670_1007792611 138
35 3300005334 Ga0068869_100206864 Ga0068869_1002068643 138
36 3300005334 Ga0068869_100339142 Ga0068869_1003391421 138
37 3300005334 Ga0068869_100388246 Ga0068869_1003882461 138
38 3300005334 Ga0068869_100724372 Ga0068869_1007243721 138
39 3300005336 Ga0070680_100491217 Ga0070680_1004912172 138
40 3300005338 Ga0068868_101173850 Ga0068868_1011738501 138
41 3300005340 Ga0070689_100010286 Ga0070689_1000102862 138
42 3300005340 Ga0070689_100021586 Ga0070689_1000215868 138
43 3300005340 Ga0070689_100174179 Ga0070689_1001741792 138
44 3300005340 Ga0070689_100380402 Ga0070689_1003804022 138
45 3300005343 Ga0070687_100181226 Ga0070687_1001812262 138
46 3300005343 Ga0070687_100879849 Ga0070687_1008798491 138
47 3300005345 Ga0070692_10079117 Ga0070692_100791172 138
48 3300005345 Ga0070692_10593656 Ga0070692_105936561 138
49 3300005365 Ga0070688_100633143 Ga0070688_1006331432 138
50 3300005365 Ga0070688_100754244 Ga0070688_1007542441 138
51 3300005438 Ga0070701_10054299 Ga0070701_100542992 138
52 3300005440 Ga0070705_100442623 Ga0070705_1004426232 138
53 3300005441 Ga0070700_100280953 Ga0070700_1002809533 138
54 3300005445 Ga0070708_100681411 Ga0070708_1006814112 138
55 3300005445 Ga0070708_101263279 Ga0070708_1012632791 138
56 3300005468 Ga0070707_101881389 Ga0070707_1018813891 138
57 3300005471 Ga0070698_101437121 Ga0070698_1014371211 138
58 3300005518 Ga0070699_101005098 Ga0070699_1010050982 138
59 3300005530 Ga0070679_100018873 Ga0070679_1000188732 138
60 3300005536 Ga0070697_100620343 Ga0070697_1006203433 138
61 3300005539 Ga0068853_101906353 Ga0068853_1019063531 138
62 3300005545 Ga0070695_100510832 Ga0070695_1005108321 138
63 3300005548 Ga0070665_100027766 Ga0070665_1000277664 138
64 3300005577 Ga0068857_100420906 Ga0068857_1004209062 138
65 3300005614 Ga0068856_100141702 Ga0068856_1001417022 138
66 3300005615 Ga0070702_100349603 Ga0070702_1003496031 138
67 3300005617 Ga0068859_100206722 Ga0068859_1002067222 138
68 3300005617 Ga0068859_102645876 Ga0068859_1026458761 138
69 3300005618 Ga0068864_100057250 Ga0068864_1000572503 138
70 3300005618 Ga0068864_100264870 Ga0068864_1002648702 138
71 3300005718 Ga0068866_10134223 Ga0068866_101342232 138
72 3300005834 Ga0068851_10327813 Ga0068851_103278132 138
73 3300005841 Ga0068863_100631171 Ga0068863_1006311712 138
74 3300005843 Ga0068860_101335887 Ga0068860_1013358871 138
75 3300005843 Ga0068860_101627305 Ga0068860_1016273052 138
76 3300005937 Ga0081455_10213656 Ga0081455_102136562 138
77 3300006028 Ga0070717_10129402 Ga0070717_101294022 138
78 3300006175 Ga0070712_100765573 Ga0070712_1007655732 138
79 3300006880 Ga0075429_100074984 Ga0075429_1000749845 138
80 3300006880 Ga0075429_100141082 Ga0075429_1001410822 138
81 3300006880 Ga0075429_100721680 Ga0075429_1007216802 138
82 3300006931 Ga0097620_100206726 Ga0097620_1002067262 138
83 3300006931 Ga0097620_102645356 Ga0097620_1026453561 138
84 3300007076 Ga0075435_100752877 Ga0075435_1007528772 138
85 3300009093 Ga0105240_10937936 Ga0105240_109379362 138
86 3300009098 Ga0105245_10000065 Ga0105245_100000654 138
87 3300009098 Ga0105245_10922792 Ga0105245_109227922 138
88 3300009147 Ga0114129_10479005 Ga0114129_104790052 138
89 3300009148 Ga0105243_10393536 Ga0105243_103935362 138
90 3300009177 Ga0105248_11262981 Ga0105248_112629811 138
91 3300009551 Ga0105238_12054743 Ga0105238_120547432 138
92 3300009553 Ga0105249_10582787 Ga0105249_105827871 138
93 3300009553 Ga0105249_11439282 Ga0105249_114392822 138
94 3300010375 Ga0105239_10242115 Ga0105239_102421152 138
95 3300013296 Ga0157374_10383488 Ga0157374_103834882 138
96 3300013296 Ga0157374_11308064 Ga0157374_113080642 138
97 3300013297 Ga0157378_10060112 Ga0157378_100601122 138
98 3300014325 Ga0163163_11058962 Ga0163163_110589621 138
99 3300014325 Ga0163163_11303337 Ga0163163_113033372 138
100 3300014968 Ga0157379_10654748 Ga0157379_106547482 138
101 3300014969 Ga0157376_10040012 Ga0157376_100400122 138
102 3300014969 Ga0157376_10398876 Ga0157376_103988762 138
103 3300025917 Ga0207660_10053594 Ga0207660_100535942 138
104 3300025918 Ga0207662_10046754 Ga0207662_100467543 138
105 3300025918 Ga0207662_11033533 Ga0207662_110335331 138
106 3300025921 Ga0207652_10370021 Ga0207652_103700212 138
107 3300025922 Ga0207646_11158433 Ga0207646_111584332 138
108 3300025925 Ga0207650_10316819 Ga0207650_103168192 138
109 3300025927 Ga0207687_10000081 Ga0207687_1000008158 138
110 3300025935 Ga0207709_10232075 Ga0207709_102320751 138
111 3300025936 Ga0207670_10015457 Ga0207670_100154572 138
112 3300025936 Ga0207670_10024193 Ga0207670_100241934 138
113 3300025936 Ga0207670_10764025 Ga0207670_107640252 138
114 3300025938 Ga0207704_10254327 Ga0207704_102543272 138
115 3300025942 Ga0207689_10096153 Ga0207689_100961532 138
116 3300025942 Ga0207689_10160688 Ga0207689_101606883 138
117 3300025942 Ga0207689_10243536 Ga0207689_102435362 138
118 3300025944 Ga0207661_11375927 Ga0207661_113759271 138
119 3300025961 Ga0207712_10490624 Ga0207712_104906242 138
120 3300025961 Ga0207712_10738275 Ga0207712_107382751 138
121 3300025986 Ga0207658_10269746 Ga0207658_102697462 138
122 3300026023 Ga0207677_10387502 Ga0207677_103875022 138
123 3300026023 Ga0207677_11141577 Ga0207677_111415771 138
124 3300026075 Ga0207708_10548175 Ga0207708_105481752 138
125 3300026088 Ga0207641_10483397 Ga0207641_104833972 138
126 3300026088 Ga0207641_11049251 Ga0207641_110492512 138
127 3300026095 Ga0207676_10449508 Ga0207676_104495082 138
128 3300026116 Ga0207674_11883699 Ga0207674_118836991 138
129 3300026118 Ga0207675_100151662 Ga0207675_1001516622 138
130 3300026121 Ga0207683_10117984 Ga0207683_101179844 138
131 3300028379 Ga0268266_10014372 Ga0268266_100143724 138
132 3300028381 Ga0268264_10544678 Ga0268264_105446782 138
133 3300028381 Ga0268264_10871176 Ga0268264_108711761 138
134 3300028381 Ga0268264_11323990 Ga0268264_113239901 138
135 3300028794 Ga0307515_10019223 Ga0307515_100192234 138
136 3300028800 Ga0265338_10023394 Ga0265338_100233943 138
137 3300031238 Ga0265332_10009589 Ga0265332_100095893 138
138 3300031456 Ga0307513_10030370 Ga0307513_100303703 138
139 3300031456 Ga0307513_10312429 Ga0307513_103124292 138
140 3300031507 Ga0307509_10002402 Ga0307509_1000240221 138
141 3300031507 Ga0307509_10011175 Ga0307509_100111752 138
142 3300031507 Ga0307509_10027186 Ga0307509_100271867 138
143 3300031507 Ga0307509_10054924 Ga0307509_100549242 138
144 3300031507 Ga0307509_10066036 Ga0307509_100660362 138
145 3300031507 Ga0307509_10835033 Ga0307509_108350331 138
146 3300031616 Ga0307508_10031248 Ga0307508_100312485 138
147 3300031711 Ga0265314_10131505 Ga0265314_101315052 138
148 3300031711 Ga0265314_10153185 Ga0265314_101531852 138
149 3300031731 Ga0307405_11340320 Ga0307405_113403202 138
150 3300031901 Ga0307406_10005350 Ga0307406_100053502 138
151 3300031901 Ga0307406_10246033 Ga0307406_102460332 138
152 3300031903 Ga0307407_10940708 Ga0307407_109407081 138
153 3300033179 Ga0307507_10096069 Ga0307507_100960693 138
154 3300035089 Ga0373944_0041416 Ga0373944_0041416_129_551 138
155 3300035090 Ga0373949_0000095 Ga0373949_0000095_22027_22449 138
156 3300035113 Ga0373936_0000046 Ga0373936_0000046_80818_81240 138
157 3300035115 Ga0373941_0004291 Ga0373941_0004291_642_1064 138
158 3300035118 Ga0373954_0070761 Ga0373954_0070761_134_556 138
159 3300035120 Ga0373957_0405692 Ga0373957_0405692_12_428 138
160 3300035241 Ga0373961_0000115 Ga0373961_0000115_12010_12432 138
161 3300037312 Ga0395899_0068772 Ga0395899_0068772_1965_2381 138
162 3300037312 Ga0395899_0287996 Ga0395899_0287996_215_631 138
163 3300037418 Ga0395900_0018145 Ga0395900_0018145_1848_2264 138
164 3300038443 Ga0395901_0012187 Ga0395901_0012187_2599_3015 138
165 3300039438 Ga0436360_0733219 Ga0436360_0733219_82_498 138
166 3300039450 Ga0436363_0682422 Ga0436363_0682422_494_916 138
167 3300041453 Ga0451797_0605463 Ga0451797_0605463_78_500 138
168 3300041486 Ga0451807_2161667 Ga0451807_2161667_23_448 138
169 3300041512 Ga0451853_3212823 Ga0451853_3212823_117_539 138
170 3300045051 Ga0451576_2626057 Ga0451576_2626057_55_477 138
171 3300045976 Ga0466967_0169733 Ga0466967_0169733_284_700 138
172 3300047472 Ga0495686_0009276 Ga0495686_0009276_390_812 138
173 3300048915 Ga0496112_1661501 Ga0496112_1661501_14_430 138
174 3300048917 Ga0496114_0029063 Ga0496114_0029063_928_1344 138
175 3300049570 Ga0501033_0876337 Ga0501033_0876337_99_515 138
176 3300049571 Ga0501034_0214492 Ga0501034_0214492_559_975 138
177 3300049580 Ga0501046_0357017 Ga0501046_0357017_322_738 138
178 3300049581 Ga0501047_0322053 Ga0501047_0322053_764_1180 138
179 3300049583 Ga0501067_0252031 Ga0501067_0252031_41_460 138
180 3300049585 Ga0501069_0203193 Ga0501069_0203193_592_1008 138
181 3300049587 Ga0501071_0081778 Ga0501071_0081778_1587_2006 138
182 3300049588 Ga0501072_0066043 Ga0501072_0066043_370_789 138
183 3300049589 Ga0501073_0296598 Ga0501073_0296598_432_848 138
184 3300049590 Ga0501074_0105586 Ga0501074_0105586_1227_1643 138
185 3300049593 Ga0501077_0380468 Ga0501077_0380468_286_702 138
186 3300049742 Ga0501080_0512925 Ga0501080_0512925_268_687 138
187 3300049742 Ga0501080_0794620 Ga0501080_0794620_59_475 138
188 3300049743 Ga0501081_0108807 Ga0501081_0108807_657_1076 138
189 3300049822 Ga0501035_0769897 Ga0501035_0769897_86_502 138
190 3300050507 nmdc:mga05p37_410002_c1 nmdc:mga05p37_410002_c1_570_1031 138
191 3300050508 nmdc:mga09592_247609_c1 nmdc:mga09592_247609_c1_851_1267 138
192 3300050508 nmdc:mga09592_338834_c1 nmdc:mga09592_338834_c1_595_1056 138
193 3300050508 nmdc:mga09592_713237_c1 nmdc:mga09592_713237_c1_170_586 138
194 3300053086 Ga0500578_0352137 Ga0500578_0352137_337_756 138
195 3300053090 Ga0500646_0043197 Ga0500646_0043197_551_973 138
196 3300053094 Ga0500566_0005430 Ga0500566_0005430_2349_2768 138
197 3300053094 Ga0500566_0006942 Ga0500566_0006942_201_623 138
198 3300053094 Ga0500566_0064523 Ga0500566_0064523_1272_1694 138
199 3300053095 Ga0500640_010286 Ga0500640_010286_2597_3019 138
200 3300053099 Ga0500654_109950 Ga0500654_109950_473_895 138
201 3300053102 Ga0500554_000385 Ga0500554_000385_524_946 138
202 3300053102 Ga0500554_084736 Ga0500554_084736_581_1003 138
203 3300053104 Ga0500556_0180595 Ga0500556_0180595_389_811 138
204 3300053111 Ga0500572_002596 Ga0500572_002596_3012_3434 138
205 3300053119 Ga0500595_000189 Ga0500595_000189_40100_40522 138
206 3300053123 Ga0500614_000690 Ga0500614_000690_6103_6525 138
207 3300053123 Ga0500614_015163 Ga0500614_015163_180_602 138
208 3300053124 Ga0500617_150159 Ga0500617_150159_415_837 138
209 3300053134 Ga0500658_0264482 Ga0500658_0264482_150_572 138
210 3300053136 Ga0500559_0008855 Ga0500559_0008855_746_1168 138
211 3300053138 Ga0500564_158982 Ga0500564_158982_160_579 138
212 3300053138 Ga0500564_225768 Ga0500564_225768_322_744 138
213 3300053139 Ga0500568_0014475 Ga0500568_0014475_628_1053 138
214 3300053144 Ga0500585_018196 Ga0500585_018196_954_1373 138
215 3300053146 Ga0500588_0213807 Ga0500588_0213807_141_563 138
216 3300053150 Ga0500603_022372 Ga0500603_022372_987_1406 138
217 3300053156 Ga0500622_0039921 Ga0500622_0039921_1186_1608 138
218 3300053159 Ga0500630_119793 Ga0500630_119793_109_531 138
219 3300053163 Ga0500639_102245 Ga0500639_102245_313_735 138
220 3300053177 Ga0500636_0132521 Ga0500636_0132521_147_569 138
221 3300053178 Ga0500637_0398666 Ga0500637_0398666_59_481 138
222 3300053735 Ga0500596_025596 Ga0500596_025596_453_875 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

22

100

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.8826 7 137
7nl9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo state 3 0.8777 7 136
5ik2-assembly1.cif.gz_H caldalaklibacillus thermarum f1-atpase (epsilon mutant) 0.8763 7 137
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.8656 12 84
4asu-assembly1.cif.gz_H f1-atpase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the empty site 0.8583 10 86
ID Description Score Start End Superfamily
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9197 5 91 2.60.15.10
af_A0A0R0H8M3_1_64_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9142 6 55 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9087 6 91 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9028 6 91 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9 5 91 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A7W0VV17-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9593 1 138 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A7W0VV17-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9526 1 138 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A538QCH7-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.936 2 138 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A3D2CHA0-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9356 6 134 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A4Q3JZS6-F1-model_v4 ATP synthase F1 subunit epsilon 0.9279 5 135 GO:0012505
GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
89.98 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map