F333503

General Info

Members Datasets Scaffolds Average Seq Length
221 159 442 218

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100037186|Ga0307408_1000371863
Length 211
Sequence VSAIVRQLGRVGYEPAWRAMQAFTDRRDDATPDELWFLEHDPVFTQGLNGKAEHLLAPGDIPVVGIDRGGQVTYHGPGQLVMYALVDLRRVRIGVRELVVALEAASHGIEAAGRREAPGVYVGERKLASIGLRVRRGCSYHGLALNVDMDLEPFGRINPCGMAGLAMTQLVAEGARTGIAESALALAPLAAAALGLSWDGNWRGPPDNQGV

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
92 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
93 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
94 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
104 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
105 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
106 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
107 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
108 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
109 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
110 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
154 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
158 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
159 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0.45
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 1.81
Rhizosphere 95.02
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100037186 3300031548 Bacteria 3427
2 rootH1_10122749 3300003323 Bacteria 7626
3 Ga0070676_10011191 3300005328 Bacteria 4876
4 Ga0070677_10056118 3300005333 Bacteria 1610
5 Ga0070677_10087218 3300005333 Bacteria 1350
6 Ga0068868_100737761 3300005338 Bacteria 884
7 Ga0070692_10036578 3300005345 Bacteria 2492
8 Ga0070668_100035621 3300005347 Bacteria 3796
9 Ga0070675_100111536 3300005354 Bacteria 2315
10 Ga0070674_100053382 3300005356 Bacteria 2790
11 Ga0070709_10083750 3300005434 Bacteria 2087
12 Ga0070714_100008133 3300005435 Bacteria 8172
13 Ga0070714_100334606 3300005435 Bacteria 1419
14 Ga0070713_100018112 3300005436 Bacteria 5350
15 Ga0070711_100256738 3300005439 Bacteria 1373
16 Ga0070700_100056166 3300005441 Bacteria 2467
17 Ga0070662_100045344 3300005457 Bacteria 3153
18 Ga0070681_10005720 3300005458 Bacteria 12020
19 Ga0068867_100311766 3300005459 Bacteria 1300
20 Ga0070679_100040510 3300005530 Bacteria 4634
21 Ga0070684_100134923 3300005535 Bacteria 2228
22 Ga0068853_100080581 3300005539 Bacteria 2849
23 Ga0070672_100160840 3300005543 Bacteria 1863
24 Ga0070672_100257581 3300005543 Bacteria 1471
25 Ga0070696_100143022 3300005546 Bacteria 1750
26 Ga0068855_100008946 3300005563 Bacteria 12106
27 Ga0068856_100309232 3300005614 Bacteria 1598
28 Ga0068852_100055732 3300005616 Bacteria 3413
29 Ga0068852_100431298 3300005616 Bacteria 1302
30 Ga0068861_100069253 3300005719 Bacteria 2729
31 Ga0068851_10054715 3300005834 Bacteria 2033
32 Ga0068870_10133247 3300005840 Bacteria 1446
33 Ga0068862_100014645 3300005844 Bacteria 6514
34 Ga0070717_10148341 3300006028 Bacteria 2028
35 Ga0097621_100118784 3300006237 Bacteria 2241
36 Ga0075434_100000099 3300006871 Bacteria 48394
37 Ga0075434_100102807 3300006871 Bacteria 2865
38 Ga0068865_100021425 3300006881 Bacteria 4202
39 Ga0075435_100018186 3300007076 Bacteria 5337
40 Ga0105250_10013171 3300009092 Bacteria 3402
41 Ga0105240_10000992 3300009093 Bacteria 50667
42 Ga0105240_10235558 3300009093 Bacteria 2125
43 Ga0111539_10039251 3300009094 Bacteria 5708
44 Ga0111539_10290611 3300009094 Bacteria 1902
45 Ga0105241_10019219 3300009174 Bacteria 5037
46 Ga0105241_10453413 3300009174 Bacteria 1135
47 Ga0105238_10020602 3300009551 Bacteria 6717
48 Ga0105249_10140362 3300009553 Bacteria 2316
49 Ga0157373_10137768 3300013100 Bacteria 1716
50 Ga0157372_10129906 3300013307 Bacteria 2898
51 Ga0157375_10421642 3300013308 Bacteria 1500
52 Ga0157380_10004910 3300014326 Bacteria 9321
53 Ga0157380_10948088 3300014326 Bacteria 890
54 Ga0157379_10291574 3300014968 Bacteria 1486
55 Ga0157379_10354250 3300014968 Bacteria 1344
56 Ga0213872_10183584 3300021361 Bacteria 902
57 Ga0207656_10093206 3300025321 Bacteria 1370
58 Ga0207682_10068513 3300025893 Bacteria 1499
59 Ga0207699_10039130 3300025906 Bacteria 2722
60 Ga0207645_10002034 3300025907 Bacteria 16233
61 Ga0207654_10066999 3300025911 Bacteria 2120
62 Ga0207695_10005516 3300025913 Bacteria 16746
63 Ga0207695_10085553 3300025913 Bacteria 3182
64 Ga0207695_10114196 3300025913 Bacteria 2676
65 Ga0207663_10029623 3300025916 Bacteria 3218
66 Ga0207660_10127624 3300025917 Bacteria 1933
67 Ga0207662_10187217 3300025918 Bacteria 1334
68 Ga0207657_10111655 3300025919 Bacteria 2256
69 Ga0207694_10022090 3300025924 Bacteria 4825
70 Ga0207659_10463548 3300025926 Bacteria 1069
71 Ga0207664_10075199 3300025929 Bacteria 2730
72 Ga0207664_10293083 3300025929 Bacteria 1430
73 Ga0207706_10001080 3300025933 Bacteria 27682
74 Ga0207669_10079144 3300025937 Bacteria 2097
75 Ga0207691_10003214 3300025940 Bacteria 15939
76 Ga0207691_10150516 3300025940 Bacteria 2046
77 Ga0207661_10648471 3300025944 Bacteria 970
78 Ga0207667_10002749 3300025949 Bacteria 21743
79 Ga0207667_10216375 3300025949 Bacteria 1963
80 Ga0207639_10035048 3300026041 Bacteria 3713
81 Ga0207702_10064414 3300026078 Bacteria 3137
82 Ga0207702_10175617 3300026078 Bacteria 1968
83 Ga0207674_10080648 3300026116 Bacteria 3257
84 Ga0207675_100003068 3300026118 Bacteria 16383
85 Ga0207698_10085432 3300026142 Bacteria 2562
86 Ga0209971_1000258 3300027682 Bacteria 14999
87 Ga0209971_1014793 3300027682 Bacteria 1850
88 Ga0209966_1010748 3300027695 Bacteria 1658
89 Ga0209998_10001476 3300027717 Bacteria 5677
90 Ga0209974_10000810 3300027876 Bacteria 10716
91 Ga0265334_10000513 3300028573 Bacteria 19853
92 Ga0307513_10412272 3300031456 Bacteria 1083
93 Ga0307408_100279555 3300031548 Bacteria 1390
94 Ga0316579_10018149 3300031691 Bacteria 3093
95 Ga0316579_10121001 3300031691 Bacteria 1258
96 Ga0316576_10012333 3300031727 Bacteria 5642
97 Ga0316578_10000053 3300031728 Bacteria 24064
98 Ga0307405_10005955 3300031731 Bacteria 5950
99 Ga0316577_10003527 3300031733 Bacteria 7917
100 Ga0307413_10062294 3300031824 Bacteria 2306
101 Ga0307410_10010714 3300031852 Bacteria 5210
102 Ga0307410_10186095 3300031852 Bacteria 1576
103 Ga0307406_10224121 3300031901 Bacteria 1399
104 Ga0307407_10473800 3300031903 Bacteria 913
105 Ga0307412_10018817 3300031911 Bacteria 4166
106 Ga0307409_100016474 3300031995 Bacteria 4891
107 Ga0307416_100053657 3300032002 Bacteria 3235
108 Ga0307414_10093225 3300032004 Bacteria 2244
109 Ga0307411_10015913 3300032005 Bacteria 4241
110 Ga0307411_10377033 3300032005 Bacteria 1165
111 Ga0307415_100025056 3300032126 Bacteria 3737
112 Ga0307415_100690716 3300032126 Bacteria 920
113 Ga0316583_10038271 3300032133 Bacteria 1701
114 Ga0316585_10027173 3300032137 Bacteria 1784
115 Ga0316580_10002924 3300032139 Bacteria 4786
116 Ga0316593_10003579 3300032168 Bacteria 3879
117 Ga0316574_0265908 3300035398 Bacteria 1094
118 Ga0316574_0360194 3300035398 Bacteria 919
119 Ga0316582_0001261 3300036647 Bacteria 10933
120 Ga0316584_0003510 3300036712 Bacteria 10219
121 Ga0316584_0053120 3300036712 Bacteria 3032
122 Ga0316584_0084436 3300036712 Bacteria 2378
123 Ga0373925_0165126 3300037068 Bacteria 1746
124 Ga0316581_0024079 3300037588 Bacteria 1803
125 Ga0436360_0031215 3300039438 Bacteria 1513
126 Ga0436361_0035878 3300039447 Bacteria 24665
127 Ga0436363_0498643 3300039450 Bacteria 3301
128 Ga0439433_0014367 3300041999 Bacteria 1743
129 Ga0439443_000963 3300042003 Bacteria 2947
130 Ga0450921_002117 3300042123 Bacteria 1288
131 Ga0450923_009053 3300042125 Bacteria 1731
132 Ga0450894_003098 3300042131 Bacteria 2193
133 Ga0450896_000139 3300042133 Bacteria 5609
134 Ga0450896_000167 3300042133 Bacteria 5370
135 Ga0450896_003548 3300042133 Bacteria 2080
136 Ga0450898_000273 3300042134 Bacteria 5768
137 Ga0450906_010360 3300042145 Bacteria 1764
138 Ga0439446_0000497 3300042156 Bacteria 7860
139 Ga0450908_000407 3300042184 Bacteria 8271
140 Ga0450908_023563 3300042184 Bacteria 1077
141 Ga0439434_0061841 3300042435 Bacteria 1171
142 Ga0439435_0001148 3300042436 Bacteria 4743
143 Ga0439444_0000332 3300042437 Bacteria 4960
144 Ga0439460_0005869 3300042461 Bacteria 3026
145 Ga0450918_001594 3300042531 Bacteria 4468
146 Ga0495670_0123164 3300046691 Bacteria 1348
147 Ga0496102_0196097 3300048905 Bacteria 1903
148 Ga0496104_0214138 3300048907 Bacteria 1838
149 Ga0496107_0143239 3300048910 Bacteria 1767
150 Ga0496112_0213011 3300048915 Bacteria 1889
151 Ga0501036_0003616 3300049572 Bacteria 12361
152 Ga0501038_0002930 3300049574 Bacteria 15918
153 Ga0501038_0225070 3300049574 Bacteria 1495
154 Ga0501039_0044670 3300049575 Bacteria 3423
155 Ga0501039_0312700 3300049575 Bacteria 1235
156 Ga0501040_0007859 3300049576 Bacteria 6911
157 Ga0501040_0017610 3300049576 Bacteria 4743
158 Ga0501040_0032745 3300049576 Bacteria 3518
159 Ga0501041_0002091 3300049577 Bacteria 11238
160 Ga0501041_0004039 3300049577 Bacteria 8475
161 Ga0501042_0003161 3300049578 Bacteria 10269
162 Ga0501042_0008609 3300049578 Bacteria 6751
163 Ga0501042_0177363 3300049578 Bacteria 1537
164 Ga0501043_0081891 3300049579 Bacteria 2536
165 Ga0501046_0070277 3300049580 Bacteria 2722
166 Ga0501046_0170256 3300049580 Bacteria 1635
167 Ga0501046_0500871 3300049580 Unclassified 870
168 Ga0501048_0003706 3300049582 Bacteria 11642
169 Ga0501048_0508639 3300049582 Bacteria 864
170 Ga0501068_0042562 3300049584 Bacteria 2731
171 Ga0501070_0005523 3300049586 Bacteria 10783
172 Ga0501071_0001933 3300049587 Bacteria 12343
173 Ga0501071_0072924 3300049587 Bacteria 2504
174 Ga0501071_0834295 3300049587 Bacteria 711
175 Ga0501072_0001847 3300049588 Bacteria 15766
176 Ga0501072_0175907 3300049588 Bacteria 1707
177 Ga0501073_0084662 3300049589 Bacteria 2206
178 Ga0501074_0006873 3300049590 Bacteria 8217
179 Ga0501074_0175034 3300049590 Bacteria 1531
180 Ga0501075_0001881 3300049591 Bacteria 13851
181 Ga0501075_0002909 3300049591 Bacteria 11490
182 Ga0501075_0195341 3300049591 Bacteria 1543
183 Ga0501076_0001641 3300049592 Bacteria 15091
184 Ga0501076_0022440 3300049592 Bacteria 4850
185 Ga0501077_0056594 3300049593 Bacteria 2489
186 Ga0501077_0173782 3300049593 Bacteria 1369
187 Ga0501079_0000473 3300049741 Bacteria 26450
188 Ga0501079_0001869 3300049741 Bacteria 15100
189 Ga0501080_0054781 3300049742 Bacteria 3714
190 Ga0501080_0192050 3300049742 Bacteria 1876
191 Ga0501080_0461289 3300049742 Bacteria 1138
192 Ga0501081_0000824 3300049743 Bacteria 18337
193 Ga0501081_0002221 3300049743 Bacteria 12214
194 Ga0501081_0031592 3300049743 Bacteria 3589
195 Ga0501083_0046907 3300049744 Bacteria 2921
196 Ga0501083_0486418 3300049744 Unclassified 803
197 Ga0501035_0058505 3300049822 Bacteria 3434
198 Ga0501035_0175074 3300049822 Bacteria 1852
199 Ga0501045_0002981 3300049824 Bacteria 11579
200 Ga0501045_0093653 3300049824 Bacteria 2222
201 nmdc:mga09592_174934_c1 3300050508 Bacteria 1857
202 nmdc:mga08y16_225159_c1 3300050511 Bacteria 1941
203 nmdc:mga08y16_254717_c1 3300050511 Bacteria 1813
204 nmdc:mga08y16_52869_c1 3300050511 Bacteria 4248
205 nmdc:mga0n895_164886_c1 3300050512 Bacteria 2247
206 nmdc:mga0n895_2337_c1 3300050512 Bacteria 14779
207 nmdc:mga08x19_12035_c1 3300050514 Bacteria 5207
208 nmdc:mga0a205_15703_c1 3300050515 Bacteria 7077
209 Ga0500622_0004285 3300053156 Bacteria 9049
210 Ga0500622_0145904 3300053156 Unclassified 1123
211 Ga0500633_0144231 3300053160 Bacteria 892
212 Ga0500637_0146464 3300053178 Bacteria 1365
213 Ga0501084_0004541 3300054114 Bacteria 11352
214 Ga0501084_0073666 3300054114 Bacteria 2860
215 Ga0501082_0003701 3300060353 Bacteria 13355
216 Ga0501082_0014891 3300060353 Bacteria 6699
217 Ga0501082_0383557 3300060353 Bacteria 1226
218 Ga0530510_0001803 3300061734 Bacteria 14606
219 Ga0530510_0108681 3300061734 Bacteria 2030
220 2846034601 2846033681 Bacteria 4377894
221 2846039015 2846037992 Bacteria 4526407
222 Ga0307408_100037186
223 rootH1_10122749
224 Ga0070676_10011191
225 Ga0070677_10056118
226 Ga0070677_10087218
227 Ga0068868_100737761
228 Ga0070692_10036578
229 Ga0070668_100035621
230 Ga0070675_100111536
231 Ga0070674_100053382
232 Ga0070709_10083750
233 Ga0070714_100008133
234 Ga0070714_100334606
235 Ga0070713_100018112
236 Ga0070711_100256738
237 Ga0070700_100056166
238 Ga0070662_100045344
239 Ga0070681_10005720
240 Ga0068867_100311766
241 Ga0070679_100040510
242 Ga0070684_100134923
243 Ga0068853_100080581
244 Ga0070672_100160840
245 Ga0070672_100257581
246 Ga0070696_100143022
247 Ga0068855_100008946
248 Ga0068856_100309232
249 Ga0068852_100055732
250 Ga0068852_100431298
251 Ga0068861_100069253
252 Ga0068851_10054715
253 Ga0068870_10133247
254 Ga0068862_100014645
255 Ga0070717_10148341
256 Ga0097621_100118784
257 Ga0075434_100000099
258 Ga0075434_100102807
259 Ga0068865_100021425
260 Ga0075435_100018186
261 Ga0105250_10013171
262 Ga0105240_10000992
263 Ga0105240_10235558
264 Ga0111539_10039251
265 Ga0111539_10290611
266 Ga0105241_10019219
267 Ga0105241_10453413
268 Ga0105238_10020602
269 Ga0105249_10140362
270 Ga0157373_10137768
271 Ga0157372_10129906
272 Ga0157375_10421642
273 Ga0157380_10004910
274 Ga0157380_10948088
275 Ga0157379_10291574
276 Ga0157379_10354250
277 Ga0213872_10183584
278 Ga0207656_10093206
279 Ga0207682_10068513
280 Ga0207699_10039130
281 Ga0207645_10002034
282 Ga0207654_10066999
283 Ga0207695_10005516
284 Ga0207695_10085553
285 Ga0207695_10114196
286 Ga0207663_10029623
287 Ga0207660_10127624
288 Ga0207662_10187217
289 Ga0207657_10111655
290 Ga0207694_10022090
291 Ga0207659_10463548
292 Ga0207664_10075199
293 Ga0207664_10293083
294 Ga0207706_10001080
295 Ga0207669_10079144
296 Ga0207691_10003214
297 Ga0207691_10150516
298 Ga0207661_10648471
299 Ga0207667_10002749
300 Ga0207667_10216375
301 Ga0207639_10035048
302 Ga0207702_10064414
303 Ga0207702_10175617
304 Ga0207674_10080648
305 Ga0207675_100003068
306 Ga0207698_10085432
307 Ga0209971_1000258
308 Ga0209971_1014793
309 Ga0209966_1010748
310 Ga0209998_10001476
311 Ga0209974_10000810
312 Ga0265334_10000513
313 Ga0307513_10412272
314 Ga0307408_100279555
315 Ga0316579_10018149
316 Ga0316579_10121001
317 Ga0316576_10012333
318 Ga0316578_10000053
319 Ga0307405_10005955
320 Ga0316577_10003527
321 Ga0307413_10062294
322 Ga0307410_10010714
323 Ga0307410_10186095
324 Ga0307406_10224121
325 Ga0307407_10473800
326 Ga0307412_10018817
327 Ga0307409_100016474
328 Ga0307416_100053657
329 Ga0307414_10093225
330 Ga0307411_10015913
331 Ga0307411_10377033
332 Ga0307415_100025056
333 Ga0307415_100690716
334 Ga0316583_10038271
335 Ga0316585_10027173
336 Ga0316580_10002924
337 Ga0316593_10003579
338 Ga0316574_0265908
339 Ga0316574_0360194
340 Ga0316582_0001261
341 Ga0316584_0003510
342 Ga0316584_0053120
343 Ga0316584_0084436
344 Ga0373925_0165126
345 Ga0316581_0024079
346 Ga0436360_0031215
347 Ga0436361_0035878
348 Ga0436363_0498643
349 Ga0439433_0014367
350 Ga0439443_000963
351 Ga0450921_002117
352 Ga0450923_009053
353 Ga0450894_003098
354 Ga0450896_000139
355 Ga0450896_000167
356 Ga0450896_003548
357 Ga0450898_000273
358 Ga0450906_010360
359 Ga0439446_0000497
360 Ga0450908_000407
361 Ga0450908_023563
362 Ga0439434_0061841
363 Ga0439435_0001148
364 Ga0439444_0000332
365 Ga0439460_0005869
366 Ga0450918_001594
367 Ga0495670_0123164
368 Ga0496102_0196097
369 Ga0496104_0214138
370 Ga0496107_0143239
371 Ga0496112_0213011
372 Ga0501036_0003616
373 Ga0501038_0002930
374 Ga0501038_0225070
375 Ga0501039_0044670
376 Ga0501039_0312700
377 Ga0501040_0007859
378 Ga0501040_0017610
379 Ga0501040_0032745
380 Ga0501041_0002091
381 Ga0501041_0004039
382 Ga0501042_0003161
383 Ga0501042_0008609
384 Ga0501042_0177363
385 Ga0501043_0081891
386 Ga0501046_0070277
387 Ga0501046_0170256
388 Ga0501046_0500871
389 Ga0501048_0003706
390 Ga0501048_0508639
391 Ga0501068_0042562
392 Ga0501070_0005523
393 Ga0501071_0001933
394 Ga0501071_0072924
395 Ga0501071_0834295
396 Ga0501072_0001847
397 Ga0501072_0175907
398 Ga0501073_0084662
399 Ga0501074_0006873
400 Ga0501074_0175034
401 Ga0501075_0001881
402 Ga0501075_0002909
403 Ga0501075_0195341
404 Ga0501076_0001641
405 Ga0501076_0022440
406 Ga0501077_0056594
407 Ga0501077_0173782
408 Ga0501079_0000473
409 Ga0501079_0001869
410 Ga0501080_0054781
411 Ga0501080_0192050
412 Ga0501080_0461289
413 Ga0501081_0000824
414 Ga0501081_0002221
415 Ga0501081_0031592
416 Ga0501083_0046907
417 Ga0501083_0486418
418 Ga0501035_0058505
419 Ga0501035_0175074
420 Ga0501045_0002981
421 Ga0501045_0093653
422 nmdc:mga09592_174934_c1
423 nmdc:mga08y16_225159_c1
424 nmdc:mga08y16_254717_c1
425 nmdc:mga08y16_52869_c1
426 nmdc:mga0n895_164886_c1
427 nmdc:mga0n895_2337_c1
428 nmdc:mga08x19_12035_c1
429 nmdc:mga0a205_15703_c1
430 Ga0500622_0004285
431 Ga0500622_0145904
432 Ga0500633_0144231
433 Ga0500637_0146464
434 Ga0501084_0004541
435 Ga0501084_0073666
436 Ga0501082_0003701
437 Ga0501082_0014891
438 Ga0501082_0383557
439 Ga0530510_0001803
440 Ga0530510_0108681
441 2846034601
442 2846039015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

12

186

0.87

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

48

150

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9099 12 211
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.9075 7 209
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8646 12 211
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8436 7 209
2aru-assembly1.cif.gz_A crystal structure of lipoate-protein ligase a bound with atp 0.7996 11 221
ID Description Score Start End Superfamily
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9871 9 208 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9726 9 208 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.95 11 209 3.30.930.10
1w66A01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9289 13 209 3.30.930.10
af_O36017_5_216_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9238 20 208 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A3D3D3L3-F1-model_v4 deleted 0.9976 14 90
AF-A0A2T4CS76-F1-model_v4 deleted 0.9955 15 175
AF-A0A7Y2HUV1-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9943 10 137 GO:0033819
AF-A0A074W1I9-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9942 14 185 GO:0016874
GO:0033819
AF-A0A433ICB7-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9924 11 212 GO:0005737
GO:0033819

Map