F333330

General Info

Members Datasets Scaffolds Average Seq Length
221 158 442 290

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10476427|Ga0114129_104764272
Length 301
Sequence LYNHIMQLRAPRLQGVLTALVTPMRDGRVDYDSLTKLVEWQIAEGIDGLVAVGTTGESATLDMKEHVDVIAHVVKITAGRIPVVAGAGGNATSEALELTEASARAGADALLHVAPYYNKPTQEGLFRHFEAIARSTKLPIMLYNVPGRTSCDLLPDTVERLAAFDNIVAIKEATGSVPRAAELIARVGDRIAVLSGDDATAFPLYAVGARGVVSVLSNVVPGRVARQWDDVVAGKWDSARAEFYAMRELEQLLFAEGNPPGAKAALALLGRCPNELRLPIVPVSAALTEKLKKALHALGML

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
81 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
100 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
149 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
150 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
151 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
152 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
153 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
157 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 0
Rhizoplane 5.43
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10476427 3300009147 Bacteria 1634
2 Ga0070676_10073701 3300005328 Unclassified 2054
3 Ga0070683_100030524 3300005329 Bacteria 4895
4 Ga0070683_100290147 3300005329 Bacteria 1556
5 Ga0070683_100426881 3300005329 Bacteria 1265
6 Ga0070690_100002781 3300005330 Bacteria 9446
7 Ga0070690_100003144 3300005330 Bacteria 8989
8 Ga0070690_100180354 3300005330 Bacteria 1459
9 Ga0070670_100090187 3300005331 Bacteria 2635
10 Ga0068869_100006857 3300005334 Bacteria 7245
11 Ga0070689_100067718 3300005340 Bacteria 2784
12 Ga0070689_100080348 3300005340 Bacteria 2558
13 Ga0070689_100311421 3300005340 Bacteria 1313
14 Ga0070691_10035138 3300005341 Bacteria 2360
15 Ga0070687_100019146 3300005343 Bacteria 3180
16 Ga0070687_100092407 3300005343 Bacteria 1677
17 Ga0070668_100014713 3300005347 Bacteria 5847
18 Ga0070669_100002571 3300005353 Bacteria 13130
19 Ga0070675_100017871 3300005354 Bacteria 5641
20 Ga0070675_100273957 3300005354 Archaea 1482
21 Ga0070674_100002867 3300005356 Bacteria 9535
22 Ga0070673_100037449 3300005364 Bacteria 3696
23 Ga0070688_100005188 3300005365 Bacteria 6841
24 Ga0070688_100041133 3300005365 Bacteria 2836
25 Ga0070688_100222127 3300005365 Bacteria 1332
26 Ga0070667_100026308 3300005367 Bacteria 4839
27 Ga0070701_10011372 3300005438 Bacteria 3977
28 Ga0070701_10023376 3300005438 Bacteria 2976
29 Ga0070705_100187044 3300005440 Bacteria 1408
30 Ga0070700_100003503 3300005441 Bacteria 8094
31 Ga0070681_10202692 3300005458 Bacteria 1902
32 Ga0070685_10042057 3300005466 Bacteria 2606
33 Ga0070706_100183561 3300005467 Unclassified 1954
34 Ga0070707_100604691 3300005468 Bacteria 1059
35 Ga0070698_100005300 3300005471 Bacteria 14108
36 Ga0070698_100101453 3300005471 Unclassified 2849
37 Ga0070679_100083423 3300005530 Bacteria 3184
38 Ga0070684_100202551 3300005535 Bacteria 1808
39 Ga0070684_100239649 3300005535 Bacteria 1657
40 Ga0068853_100058551 3300005539 Bacteria 3326
41 Ga0070672_100073594 3300005543 Bacteria 2723
42 Ga0070672_100092095 3300005543 Bacteria 2447
43 Ga0070686_100016463 3300005544 Bacteria 4302
44 Ga0070686_100018031 3300005544 Bacteria 4136
45 Ga0068855_100438873 3300005563 Bacteria 1426
46 Ga0068856_100278104 3300005614 Bacteria 1691
47 Ga0068863_100044465 3300005841 Bacteria 4216
48 Ga0068863_100550714 3300005841 Bacteria 1139
49 Ga0068858_100182025 3300005842 Bacteria 1984
50 Ga0068860_100154713 3300005843 Bacteria 2210
51 Ga0070717_10111073 3300006028 Bacteria 2338
52 Ga0075428_100049701 3300006844 Bacteria 4601
53 Ga0075428_100705714 3300006844 Bacteria 1074
54 Ga0075429_100424437 3300006880 Bacteria 1164
55 Ga0068865_100017585 3300006881 Bacteria 4600
56 Ga0068865_100052632 3300006881 Bacteria 2823
57 Ga0105240_10149162 3300009093 Bacteria 2787
58 Ga0111539_10008720 3300009094 Bacteria 12865
59 Ga0111539_10779489 3300009094 Bacteria 1113
60 Ga0105245_10112176 3300009098 Bacteria 2537
61 Ga0105242_10217629 3300009176 Bacteria 1705
62 Ga0105249_10080075 3300009553 Bacteria 3034
63 Ga0157378_10069274 3300013297 Bacteria 3164
64 Ga0157372_10653569 3300013307 Bacteria 1224
65 Ga0157376_10400115 3300014969 Bacteria 1328
66 Ga0207666_1007700 3300025271 Bacteria 1424
67 Ga0207680_10114444 3300025903 Bacteria 1755
68 Ga0207645_10006133 3300025907 Bacteria 8635
69 Ga0207684_10012316 3300025910 Bacteria 7443
70 Ga0207662_10076451 3300025918 Bacteria 2035
71 Ga0207662_10219572 3300025918 Bacteria 1237
72 Ga0207657_10225626 3300025919 Bacteria 1499
73 Ga0207646_10111595 3300025922 Bacteria 2454
74 Ga0207681_10000113 3300025923 Bacteria 68072
75 Ga0207659_10141660 3300025926 Archaea 1867
76 Ga0207687_10001879 3300025927 Bacteria 14462
77 Ga0207687_10037587 3300025927 Bacteria 3304
78 Ga0207644_10138799 3300025931 Bacteria 1870
79 Ga0207686_10098158 3300025934 Bacteria 1950
80 Ga0207670_10040786 3300025936 Bacteria 3048
81 Ga0207670_10104306 3300025936 Bacteria 2030
82 Ga0207670_10131665 3300025936 Bacteria 1833
83 Ga0207669_10001014 3300025937 Bacteria 11984
84 Ga0207669_10218078 3300025937 Bacteria 1398
85 Ga0207704_10354453 3300025938 Bacteria 1143
86 Ga0207691_10038914 3300025940 Bacteria 4400
87 Ga0207691_10045376 3300025940 Bacteria 4040
88 Ga0207689_10160602 3300025942 Bacteria 1852
89 Ga0207689_10276642 3300025942 Bacteria 1390
90 Ga0207661_10117250 3300025944 Bacteria 2261
91 Ga0207651_10099521 3300025960 Bacteria 2153
92 Ga0207712_10039097 3300025961 Bacteria 3249
93 Ga0207712_10115843 3300025961 Unclassified 2018
94 Ga0207668_10150809 3300025972 Bacteria 1799
95 Ga0207658_10098777 3300025986 Bacteria 2282
96 Ga0207639_10020163 3300026041 Bacteria 4770
97 Ga0207708_10000950 3300026075 Bacteria 21709
98 Ga0207702_10495169 3300026078 Bacteria 1191
99 Ga0207641_10053051 3300026088 Bacteria 3435
100 Ga0207648_10013454 3300026089 Bacteria 7612
101 Ga0207675_100015373 3300026118 Bacteria 7138
102 Ga0207683_10150533 3300026121 Bacteria 2100
103 Ga0207683_10267930 3300026121 Bacteria 1560
104 Ga0207428_10025428 3300027907 Archaea 4956
105 Ga0268266_10008524 3300028379 Bacteria 9108
106 Ga0265326_10008002 3300028558 Bacteria 3210
107 Ga0265334_10009421 3300028573 Bacteria 4130
108 Ga0265323_10000959 3300028653 Bacteria 15058
109 Ga0265323_10004540 3300028653 Bacteria 5977
110 Ga0265323_10041451 3300028653 Bacteria 1670
111 Ga0265336_10036146 3300028666 Bacteria 1521
112 Ga0307517_10015302 3300028786 Bacteria 10209
113 Ga0307515_10045449 3300028794 Bacteria 6746
114 Ga0265338_10022617 3300028800 Bacteria 6499
115 Ga0265338_10036782 3300028800 Bacteria 4676
116 Ga0265338_10081683 3300028800 Bacteria 2709
117 Ga0265338_10292163 3300028800 Bacteria 1187
118 Ga0265330_10001078 3300031235 Bacteria 16478
119 Ga0265330_10003588 3300031235 Bacteria 8084
120 Ga0265330_10005116 3300031235 Bacteria 6570
121 Ga0265330_10049118 3300031235 Bacteria 1854
122 Ga0265330_10075854 3300031235 Bacteria 1451
123 Ga0265330_10101862 3300031235 Bacteria 1229
124 Ga0265330_10152847 3300031235 Bacteria 980
125 Ga0265332_10057724 3300031238 Bacteria 1662
126 Ga0265328_10082018 3300031239 Bacteria 1188
127 Ga0265320_10005340 3300031240 Bacteria 8263
128 Ga0265325_10020162 3300031241 Bacteria 3678
129 Ga0265329_10000311 3300031242 Bacteria 25878
130 Ga0265329_10013960 3300031242 Bacteria 2848
131 Ga0265329_10050757 3300031242 Bacteria 1321
132 Ga0265340_10013664 3300031247 Bacteria 4259
133 Ga0265340_10112920 3300031247 Bacteria 1254
134 Ga0265339_10009702 3300031249 Bacteria 6021
135 Ga0265316_10000068 3300031344 Bacteria 108687
136 Ga0265316_10000078 3300031344 Bacteria 101128
137 Ga0265316_10003945 3300031344 Bacteria 14869
138 Ga0265316_10024764 3300031344 Bacteria 5017
139 Ga0265316_10056603 3300031344 Bacteria 3061
140 Ga0265316_10142341 3300031344 Bacteria 1800
141 Ga0307509_10035743 3300031507 Bacteria 5449
142 Ga0307509_10165174 3300031507 Bacteria 2104
143 Ga0265314_10004843 3300031711 Bacteria 12309
144 Ga0265314_10005501 3300031711 Bacteria 11413
145 Ga0265342_10000642 3300031712 Bacteria 36621
146 Ga0265342_10000874 3300031712 Bacteria 30080
147 Ga0265342_10003641 3300031712 Bacteria 12533
148 Ga0265342_10041497 3300031712 Bacteria 2786
149 Ga0265342_10118495 3300031712 Bacteria 1492
150 Ga0307406_10094069 3300031901 Bacteria 2025
151 Ga0307415_100010817 3300032126 Bacteria 5186
152 Ga0307507_10036679 3300033179 Bacteria 5007
153 Ga0373949_0000471 3300035090 Bacteria 13794
154 Ga0373941_0074873 3300035115 Bacteria 1132
155 Ga0373945_0032755 3300035116 Bacteria 1843
156 Ga0373943_0014765 3300035170 Bacteria 3542
157 Ga0373961_0000111 3300035241 Bacteria 42397
158 Ga0373935_0075990 3300035692 Bacteria 2174
159 Ga0373947_0090837 3300035725 Bacteria 1904
160 Ga0373937_0160677 3300036401 Bacteria 2106
161 Ga0373937_0170732 3300036401 Bacteria 2041
162 Ga0373925_0092316 3300037068 Bacteria 2316
163 Ga0395900_0130431 3300037418 Bacteria 2576
164 Ga0395898_0122135 3300037466 Bacteria 2496
165 Ga0395901_0181519 3300038443 Bacteria 2207
166 Ga0436365_0702409 3300039437 Bacteria 1511
167 Ga0436365_1608935 3300039437 Bacteria 1020
168 Ga0451577_0058383 3300042876 Bacteria 3439
169 Ga0466961_0182136 3300044693 Unclassified 1304
170 Ga0453684_0044934 3300044712 Bacteria 5900
171 Ga0451576_0141975 3300045051 Bacteria 2504
172 Ga0495650_0046870 3300046471 Bacteria 1811
173 Ga0495628_0221500 3300046516 Bacteria 1421
174 Ga0495630_0005157 3300046517 Bacteria 9204
175 Ga0495640_0118522 3300046533 Bacteria 1723
176 Ga0495586_0070968 3300046535 Bacteria 1903
177 Ga0495634_0012893 3300046642 Bacteria 6049
178 Ga0495635_0219783 3300046663 Bacteria 1285
179 Ga0495599_0070792 3300046678 Bacteria 2177
180 Ga0495674_0013579 3300047319 Bacteria 7652
181 Ga0496100_0005287 3300048903 Bacteria 6935
182 Ga0496101_0127956 3300048904 Bacteria 1926
183 Ga0496104_0142791 3300048907 Bacteria 2300
184 Ga0496104_0145722 3300048907 Bacteria 2274
185 Ga0496107_0043730 3300048910 Bacteria 3218
186 Ga0496108_0032892 3300048911 Bacteria 4308
187 Ga0496112_0088946 3300048915 Bacteria 3056
188 Ga0496114_0001040 3300048917 Bacteria 20876
189 Ga0496114_0003547 3300048917 Bacteria 11975
190 Ga0496114_0012072 3300048917 Bacteria 6913
191 Ga0496114_0029424 3300048917 Bacteria 4515
192 Ga0496115_0050376 3300048918 Bacteria 3336
193 Ga0501036_0106519 3300049572 Bacteria 2371
194 Ga0501043_0131705 3300049579 Bacteria 1960
195 Ga0501047_0213896 3300049581 Bacteria 1785
196 Ga0501048_0043759 3300049582 Bacteria 3205
197 Ga0501069_0088150 3300049585 Bacteria 1753
198 Ga0501230_023620 3300049667 Unclassified 1095
199 Ga0501225_0027717 3300049705 Bacteria 1557
200 Ga0501044_0032362 3300049823 Bacteria 5498
201 nmdc:mga05p37_494720_c1 3300050507 Bacteria 1405
202 nmdc:mga09592_127738_c1 3300050508 Bacteria 2186
203 nmdc:mga08y16_2252_c1 3300050511 Bacteria 19785
204 nmdc:mga08y16_235736_c1 3300050511 Bacteria 1892
205 nmdc:mga08y16_623911_c1 3300050511 Bacteria 1085
206 Ga0500578_0086935 3300053086 Bacteria 1986
207 Ga0500646_0017000 3300053090 Bacteria 1903
208 Ga0500583_0184889 3300053092 Bacteria 1037
209 Ga0500640_007023 3300053095 Bacteria 4347
210 Ga0500554_000189 3300053102 Bacteria 12908
211 Ga0500572_002972 3300053111 Bacteria 3971
212 Ga0500595_000073 3300053119 Bacteria 70983
213 Ga0500597_006902 3300053120 Bacteria 3809
214 Ga0500614_000338 3300053123 Bacteria 12160
215 Ga0500614_024092 3300053123 Bacteria 1436
216 Ga0500559_0001716 3300053136 Bacteria 12031
217 Ga0500568_0032534 3300053139 Bacteria 2144
218 Ga0500568_0093630 3300053139 Bacteria 1132
219 Ga0500603_001200 3300053150 Bacteria 6019
220 Ga0500630_084039 3300053159 Bacteria 1484
221 Ga0501082_0127988 3300060353 Bacteria 2203
222 Ga0114129_10476427
223 Ga0070676_10073701
224 Ga0070683_100030524
225 Ga0070683_100290147
226 Ga0070683_100426881
227 Ga0070690_100002781
228 Ga0070690_100003144
229 Ga0070690_100180354
230 Ga0070670_100090187
231 Ga0068869_100006857
232 Ga0070689_100067718
233 Ga0070689_100080348
234 Ga0070689_100311421
235 Ga0070691_10035138
236 Ga0070687_100019146
237 Ga0070687_100092407
238 Ga0070668_100014713
239 Ga0070669_100002571
240 Ga0070675_100017871
241 Ga0070675_100273957
242 Ga0070674_100002867
243 Ga0070673_100037449
244 Ga0070688_100005188
245 Ga0070688_100041133
246 Ga0070688_100222127
247 Ga0070667_100026308
248 Ga0070701_10011372
249 Ga0070701_10023376
250 Ga0070705_100187044
251 Ga0070700_100003503
252 Ga0070681_10202692
253 Ga0070685_10042057
254 Ga0070706_100183561
255 Ga0070707_100604691
256 Ga0070698_100005300
257 Ga0070698_100101453
258 Ga0070679_100083423
259 Ga0070684_100202551
260 Ga0070684_100239649
261 Ga0068853_100058551
262 Ga0070672_100073594
263 Ga0070672_100092095
264 Ga0070686_100016463
265 Ga0070686_100018031
266 Ga0068855_100438873
267 Ga0068856_100278104
268 Ga0068863_100044465
269 Ga0068863_100550714
270 Ga0068858_100182025
271 Ga0068860_100154713
272 Ga0070717_10111073
273 Ga0075428_100049701
274 Ga0075428_100705714
275 Ga0075429_100424437
276 Ga0068865_100017585
277 Ga0068865_100052632
278 Ga0105240_10149162
279 Ga0111539_10008720
280 Ga0111539_10779489
281 Ga0105245_10112176
282 Ga0105242_10217629
283 Ga0105249_10080075
284 Ga0157378_10069274
285 Ga0157372_10653569
286 Ga0157376_10400115
287 Ga0207666_1007700
288 Ga0207680_10114444
289 Ga0207645_10006133
290 Ga0207684_10012316
291 Ga0207662_10076451
292 Ga0207662_10219572
293 Ga0207657_10225626
294 Ga0207646_10111595
295 Ga0207681_10000113
296 Ga0207659_10141660
297 Ga0207687_10001879
298 Ga0207687_10037587
299 Ga0207644_10138799
300 Ga0207686_10098158
301 Ga0207670_10040786
302 Ga0207670_10104306
303 Ga0207670_10131665
304 Ga0207669_10001014
305 Ga0207669_10218078
306 Ga0207704_10354453
307 Ga0207691_10038914
308 Ga0207691_10045376
309 Ga0207689_10160602
310 Ga0207689_10276642
311 Ga0207661_10117250
312 Ga0207651_10099521
313 Ga0207712_10039097
314 Ga0207712_10115843
315 Ga0207668_10150809
316 Ga0207658_10098777
317 Ga0207639_10020163
318 Ga0207708_10000950
319 Ga0207702_10495169
320 Ga0207641_10053051
321 Ga0207648_10013454
322 Ga0207675_100015373
323 Ga0207683_10150533
324 Ga0207683_10267930
325 Ga0207428_10025428
326 Ga0268266_10008524
327 Ga0265326_10008002
328 Ga0265334_10009421
329 Ga0265323_10000959
330 Ga0265323_10004540
331 Ga0265323_10041451
332 Ga0265336_10036146
333 Ga0307517_10015302
334 Ga0307515_10045449
335 Ga0265338_10022617
336 Ga0265338_10036782
337 Ga0265338_10081683
338 Ga0265338_10292163
339 Ga0265330_10001078
340 Ga0265330_10003588
341 Ga0265330_10005116
342 Ga0265330_10049118
343 Ga0265330_10075854
344 Ga0265330_10101862
345 Ga0265330_10152847
346 Ga0265332_10057724
347 Ga0265328_10082018
348 Ga0265320_10005340
349 Ga0265325_10020162
350 Ga0265329_10000311
351 Ga0265329_10013960
352 Ga0265329_10050757
353 Ga0265340_10013664
354 Ga0265340_10112920
355 Ga0265339_10009702
356 Ga0265316_10000068
357 Ga0265316_10000078
358 Ga0265316_10003945
359 Ga0265316_10024764
360 Ga0265316_10056603
361 Ga0265316_10142341
362 Ga0307509_10035743
363 Ga0307509_10165174
364 Ga0265314_10004843
365 Ga0265314_10005501
366 Ga0265342_10000642
367 Ga0265342_10000874
368 Ga0265342_10003641
369 Ga0265342_10041497
370 Ga0265342_10118495
371 Ga0307406_10094069
372 Ga0307415_100010817
373 Ga0307507_10036679
374 Ga0373949_0000471
375 Ga0373941_0074873
376 Ga0373945_0032755
377 Ga0373943_0014765
378 Ga0373961_0000111
379 Ga0373935_0075990
380 Ga0373947_0090837
381 Ga0373937_0160677
382 Ga0373937_0170732
383 Ga0373925_0092316
384 Ga0395900_0130431
385 Ga0395898_0122135
386 Ga0395901_0181519
387 Ga0436365_0702409
388 Ga0436365_1608935
389 Ga0451577_0058383
390 Ga0466961_0182136
391 Ga0453684_0044934
392 Ga0451576_0141975
393 Ga0495650_0046870
394 Ga0495628_0221500
395 Ga0495630_0005157
396 Ga0495640_0118522
397 Ga0495586_0070968
398 Ga0495634_0012893
399 Ga0495635_0219783
400 Ga0495599_0070792
401 Ga0495674_0013579
402 Ga0496100_0005287
403 Ga0496101_0127956
404 Ga0496104_0142791
405 Ga0496104_0145722
406 Ga0496107_0043730
407 Ga0496108_0032892
408 Ga0496112_0088946
409 Ga0496114_0001040
410 Ga0496114_0003547
411 Ga0496114_0012072
412 Ga0496114_0029424
413 Ga0496115_0050376
414 Ga0501036_0106519
415 Ga0501043_0131705
416 Ga0501047_0213896
417 Ga0501048_0043759
418 Ga0501069_0088150
419 Ga0501230_023620
420 Ga0501225_0027717
421 Ga0501044_0032362
422 nmdc:mga05p37_494720_c1
423 nmdc:mga09592_127738_c1
424 nmdc:mga08y16_2252_c1
425 nmdc:mga08y16_235736_c1
426 nmdc:mga08y16_623911_c1
427 Ga0500578_0086935
428 Ga0500646_0017000
429 Ga0500583_0184889
430 Ga0500640_007023
431 Ga0500554_000189
432 Ga0500572_002972
433 Ga0500595_000073
434 Ga0500597_006902
435 Ga0500614_000338
436 Ga0500614_024092
437 Ga0500559_0001716
438 Ga0500568_0032534
439 Ga0500568_0093630
440 Ga0500603_001200
441 Ga0500630_084039
442 Ga0501082_0127988

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

12

298

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nq1-assembly1.cif.gz_B legionella pneumophila dihydrodipicolinate synthase with first substrate pyruvate bound in the active site 0.9856 1 290
4nq1-assembly1.cif.gz_B legionella pneumophila dihydrodipicolinate synthase with first substrate pyruvate bound in the active site 0.9823 1 290
6p90-assembly1.cif.gz_B crystal structure of padhdps2-h56q mutant 0.982 1 290
6mqh-assembly1.cif.gz_A crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei 0.9819 1 290
6t3t-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9815 1 288
ID Description Score Start End Superfamily
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9794 2 290 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.979 2 290 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9775 1 288 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9773 2 290 3.20.20.70
5f1uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9758 1 286 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3M1Y908-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9876 101 290 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A2T6CT88-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9874 1 290 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A0W0RQR6-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9873 1 290 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A2I8VK58-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9871 2 288 GO:0005737
GO:0008675
GO:0008840
GO:0009089
GO:0019877
AF-A0A558NI30-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.986 1 290 GO:0005829
GO:0008840
GO:0009089
GO:0019877

Map