F333115

General Info

Members Datasets Scaffolds Average Seq Length
221 134 442 175

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100834387|Ga0070663_1008343871
Length 189
Sequence MTRALLSFGSNLGDRYQHLRSAVAAAGEVLTGSREVLAVSGIYETPPWGDPDQPTYFNAVALVTADVQPRAWLELAAALERAAGRARDPERRFGPRTLDVDVIAVWTDDGEPVRSTDPDLTLPHPRAHLRAFVLRPWIDIAPYAQLPGHGWVTDLLRTQAVAADLPALVPRPDLPLTLPPAADAPQPVR

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
79 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
80 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
81 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
82 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
94 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
107 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
125 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
126 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
127 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
128 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
129 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
130 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
131 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
132 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
133 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
134 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 0
Isolates 4.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0
Rhizoplane 4.52
Rhizosphere 80.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100834387 3300005455 Bacteria 792
2 JGI25406J46586_10036817 3300003203 Bacteria 1772
3 rootH1_10089019 3300003316 Bacteria 2204
4 rootH2_10016579 3300003320 Bacteria 2122
5 Ga0070658_10386338 3300005327 Bacteria 1201
6 Ga0068869_100427355 3300005334 Bacteria 1094
7 Ga0068868_100914975 3300005338 Bacteria 798
8 Ga0070661_100269448 3300005344 Bacteria 1318
9 Ga0070668_100004736 3300005347 Bacteria 10091
10 Ga0070668_100112997 3300005347 Bacteria 2163
11 Ga0070659_100495114 3300005366 Bacteria 1041
12 Ga0070667_100045328 3300005367 Bacteria 3696
13 Ga0070714_101391274 3300005435 Bacteria 685
14 Ga0070663_100342891 3300005455 Bacteria 1208
15 Ga0070679_100123503 3300005530 Bacteria 2572
16 Ga0070684_100426466 3300005535 Bacteria 1224
17 Ga0070684_100486330 3300005535 Bacteria 1143
18 Ga0070665_100167038 3300005548 Bacteria 2203
19 Ga0070664_100337074 3300005564 Bacteria 1369
20 Ga0070664_100465723 3300005564 Bacteria 1162
21 Ga0068856_100442519 3300005614 Bacteria 1320
22 Ga0068856_100464336 3300005614 Bacteria 1287
23 Ga0068863_100003011 3300005841 Bacteria 16652
24 Ga0068858_100015066 3300005842 Bacteria 7273
25 Ga0068860_100199939 3300005843 Bacteria 1936
26 Ga0068860_100874774 3300005843 Bacteria 914
27 Ga0081540_1053659 3300005983 Bacteria 1975
28 Ga0081539_10000779 3300005985 Bacteria 62135
29 Ga0081539_10005125 3300005985 Bacteria 13687
30 Ga0081539_10005655 3300005985 Bacteria 12558
31 Ga0081539_10061128 3300005985 Bacteria 2065
32 Ga0081539_10210997 3300005985 Bacteria 890
33 Ga0070712_100091800 3300006175 Bacteria 2226
34 Ga0075428_100000071 3300006844 Bacteria 82288
35 Ga0075428_100005251 3300006844 Bacteria 14401
36 Ga0075428_100168711 3300006844 Bacteria 2374
37 Ga0075428_100426006 3300006844 Bacteria 1422
38 Ga0075430_100004324 3300006846 Bacteria 11998
39 Ga0075430_100171967 3300006846 Bacteria 1802
40 Ga0075431_100013378 3300006847 Bacteria 8291
41 Ga0075431_100062690 3300006847 Bacteria 3836
42 Ga0075431_100177220 3300006847 Bacteria 2189
43 Ga0075431_100769036 3300006847 Bacteria 938
44 Ga0075429_100009196 3300006880 Bacteria 8579
45 Ga0075429_100048823 3300006880 Bacteria 3680
46 Ga0075429_100127039 3300006880 Bacteria 2230
47 Ga0111539_11061395 3300009094 Bacteria 941
48 Ga0105245_10651375 3300009098 Bacteria 1083
49 Ga0105247_10164551 3300009101 Bacteria 1471
50 Ga0114129_10002117 3300009147 Bacteria 27355
51 Ga0114129_10136509 3300009147 Bacteria 3365
52 Ga0114129_10604845 3300009147 Bacteria 1420
53 Ga0114129_10876499 3300009147 Bacteria 1139
54 Ga0114129_11045909 3300009147 Bacteria 1025
55 Ga0114129_11244408 3300009147 Bacteria 925
56 Ga0105248_10272418 3300009177 Bacteria 1906
57 Ga0105249_10982963 3300009553 Bacteria 912
58 Ga0163163_10005462 3300014325 Bacteria 10988
59 Ga0163163_10027468 3300014325 Bacteria 5451
60 Ga0163163_10485763 3300014325 Bacteria 1296
61 Ga0157379_10071661 3300014968 Bacteria 3100
62 Ga0157376_11102040 3300014969 Bacteria 820
63 Ga0207699_10120398 3300025906 Bacteria 1697
64 Ga0207705_10669868 3300025909 Bacteria 807
65 Ga0207684_11315441 3300025910 Bacteria 595
66 Ga0207693_10330424 3300025915 Bacteria 1193
67 Ga0207687_10227251 3300025927 Bacteria 1472
68 Ga0207670_10065734 3300025936 Bacteria 2490
69 Ga0207689_10200300 3300025942 Bacteria 1648
70 Ga0207679_11065845 3300025945 Bacteria 741
71 Ga0207712_10328375 3300025961 Bacteria 1264
72 Ga0207668_10030582 3300025972 Bacteria 3539
73 Ga0207668_10048505 3300025972 Bacteria 2915
74 Ga0207668_10763117 3300025972 Bacteria 854
75 Ga0207658_10034668 3300025986 Bacteria 3609
76 Ga0207658_10051295 3300025986 Bacteria 3040
77 Ga0207703_10096533 3300026035 Bacteria 2496
78 Ga0207639_10951935 3300026041 Bacteria 803
79 Ga0207678_10181688 3300026067 Bacteria 1796
80 Ga0207702_10777723 3300026078 Bacteria 946
81 Ga0207702_10944409 3300026078 Bacteria 855
82 Ga0207641_10005049 3300026088 Bacteria 11307
83 Ga0207641_10054188 3300026088 Bacteria 3402
84 Ga0207641_10432072 3300026088 Bacteria 1270
85 Ga0207676_10039599 3300026095 Bacteria 3606
86 Ga0207676_10380628 3300026095 Bacteria 1314
87 Ga0207674_10066497 3300026116 Bacteria 3630
88 Ga0268266_10187964 3300028379 Bacteria 1885
89 Ga0268266_11128136 3300028379 Bacteria 759
90 Ga0268265_10872126 3300028380 Bacteria 882
91 Ga0268264_10771624 3300028381 Bacteria 959
92 Ga0268264_10873518 3300028381 Bacteria 901
93 Ga0307517_10052312 3300028786 Bacteria 4097
94 Ga0307517_10136343 3300028786 Bacteria 1744
95 Ga0307515_10000083 3300028794 Bacteria 222889
96 Ga0307515_10006931 3300028794 Bacteria 22512
97 Ga0307512_10001451 3300030522 Bacteria 33604
98 Ga0307513_10016248 3300031456 Bacteria 8985
99 Ga0307513_10071957 3300031456 Bacteria 3606
100 Ga0307513_10076566 3300031456 Bacteria 3469
101 Ga0307513_10132272 3300031456 Bacteria 2438
102 Ga0307509_10013463 3300031507 Bacteria 9684
103 Ga0307509_10246737 3300031507 Bacteria 1572
104 Ga0307408_100309461 3300031548 Bacteria 1326
105 Ga0307508_10005452 3300031616 Bacteria 12095
106 Ga0307508_10015649 3300031616 Bacteria 6911
107 Ga0307516_10003673 3300031730 Bacteria 19506
108 Ga0307516_10012467 3300031730 Bacteria 9158
109 Ga0307516_10062241 3300031730 Bacteria 3617
110 Ga0307516_10155052 3300031730 Bacteria 2046
111 Ga0307405_10002593 3300031731 Bacteria 8018
112 Ga0307405_10025143 3300031731 Bacteria 3414
113 Ga0307405_10165503 3300031731 Bacteria 1571
114 Ga0307405_10479979 3300031731 Bacteria 992
115 Ga0307413_10035868 3300031824 Bacteria 2850
116 Ga0307413_10331400 3300031824 Bacteria 1167
117 Ga0307518_10283036 3300031838 Bacteria 1024
118 Ga0307410_10309291 3300031852 Bacteria 1250
119 Ga0307410_10536106 3300031852 Bacteria 968
120 Ga0326468_10000070 3300031889 Bacteria 8332
121 Ga0307406_10019489 3300031901 Bacteria 3981
122 Ga0307406_10073411 3300031901 Bacteria 2249
123 Ga0307407_10048379 3300031903 Bacteria 2420
124 Ga0307409_100009860 3300031995 Bacteria 5895
125 Ga0307409_100072600 3300031995 Bacteria 2741
126 Ga0307409_100113100 3300031995 Bacteria 2281
127 Ga0307409_101140031 3300031995 Bacteria 802
128 Ga0307409_101531117 3300031995 Bacteria 695
129 Ga0307416_100022694 3300032002 Bacteria 4536
130 Ga0307416_100244322 3300032002 Bacteria 1742
131 Ga0307416_100393993 3300032002 Bacteria 1420
132 Ga0307416_100416809 3300032002 Bacteria 1386
133 Ga0307416_101237927 3300032002 Bacteria 852
134 Ga0307416_102169215 3300032002 Bacteria 657
135 Ga0307414_10015979 3300032004 Bacteria 4549
136 Ga0307411_10629937 3300032005 Bacteria 926
137 Ga0307415_100000091 3300032126 Bacteria 38025
138 Ga0307415_100049686 3300032126 Bacteria 2837
139 Ga0307415_100076907 3300032126 Bacteria 2368
140 Ga0307415_100096461 3300032126 Bacteria 2155
141 Ga0307415_100591746 3300032126 Bacteria 986
142 Ga0307415_100920661 3300032126 Bacteria 807
143 Ga0307510_10233931 3300033180 Bacteria 1338
144 Ga0307510_10294929 3300033180 Bacteria 1086
145 Ga0307510_10426546 3300033180 Bacteria 768
146 Ga0373938_0009553 3300034957 Bacteria 1761
147 Ga0373928_0091222 3300035084 Bacteria 782
148 Ga0373940_0022465 3300035088 Bacteria 1621
149 Ga0373951_0000190 3300035091 Bacteria 22296
150 Ga0373932_0114867 3300035112 Bacteria 892
151 Ga0373939_0074792 3300035114 Bacteria 1112
152 Ga0373946_0074877 3300035171 Bacteria 1470
153 Ga0373942_0000309 3300035207 Bacteria 13320
154 Ga0373935_0011274 3300035692 Bacteria 5369
155 Ga0395899_0065459 3300037312 Bacteria 2671
156 Ga0395899_0123618 3300037312 Bacteria 1852
157 Ga0395900_0338982 3300037418 Bacteria 1479
158 Ga0395900_0382743 3300037418 Bacteria 1374
159 Ga0395898_0026358 3300037466 Bacteria 5850
160 Ga0395898_0070754 3300037466 Bacteria 3372
161 Ga0395905_0004689 3300037471 Bacteria 14130
162 Ga0395905_0037751 3300037471 Bacteria 4534
163 Ga0395901_0018443 3300038443 Bacteria 7123
164 Ga0395901_0032644 3300038443 Bacteria 5370
165 Ga0451849_1503696 3300041505 Bacteria 717
166 Ga0439458_0111357 3300042157 Bacteria 716
167 Ga0466966_0253807 3300044684 Bacteria 1059
168 Ga0466967_0157322 3300045976 Bacteria 2130
169 Ga0495629_0076793 3300046459 Bacteria 2332
170 Ga0495638_0230966 3300046460 Bacteria 1029
171 Ga0495594_0000498 3300046499 Bacteria 20059
172 Ga0495606_0001741 3300046507 Bacteria 27951
173 Ga0495632_0091895 3300046519 Bacteria 1438
174 Ga0495622_0280788 3300046557 Bacteria 728
175 Ga0495668_0000642 3300046616 Bacteria 42122
176 Ga0495625_0001727 3300046660 Bacteria 25329
177 Ga0495581_0205277 3300047315 Bacteria 1153
178 Ga0495683_0062487 3300047323 Bacteria 1842
179 Ga0495626_0000455 3300048091 Bacteria 41789
180 Ga0496104_0036565 3300048907 Bacteria 4591
181 Ga0496105_0059197 3300048908 Bacteria 3161
182 Ga0496108_0012675 3300048911 Bacteria 6869
183 Ga0496109_0038833 3300048912 Bacteria 4306
184 Ga0496111_0008730 3300048914 Bacteria 6725
185 Ga0496112_0052535 3300048915 Bacteria 3999
186 Ga0496112_0073222 3300048915 Bacteria 3387
187 Ga0496112_0076352 3300048915 Bacteria 3313
188 Ga0496112_0275806 3300048915 Bacteria 1629
189 Ga0496113_0400458 3300048916 Bacteria 1102
190 Ga0496119_0408940 3300048922 Bacteria 646
191 Ga0501047_0047410 3300049581 Bacteria 4151
192 nmdc:mga05p37_1312710_c1 3300050507 Bacteria 736
193 nmdc:mga05p37_1446_c1 3300050507 Bacteria 27619
194 nmdc:mga05p37_299183_c1 3300050507 Bacteria 1912
195 nmdc:mga05p37_349758_c1 3300050507 Bacteria 1740
196 nmdc:mga05p37_486993_c1 3300050507 Bacteria 1419
197 nmdc:mga09592_402356_c1 3300050508 Bacteria 1183
198 nmdc:mga09592_606656_c1 3300050508 Bacteria 937
199 nmdc:mga09592_643_c1 3300050508 Bacteria 26576
200 nmdc:mga09592_712960_c1 3300050508 Bacteria 853
201 nmdc:mga09592_91108_c1 3300050508 Bacteria 2605
202 nmdc:mga0qj67_503_c1 3300050509 Bacteria 26659
203 nmdc:mga0qj67_55790_c1 3300050509 Bacteria 3130
204 nmdc:mga06r32_136470_c1 3300050510 Bacteria 2427
205 nmdc:mga06r32_5246_c1 3300050510 Bacteria 8701
206 nmdc:mga06r32_783350_c1 3300050510 Bacteria 915
207 nmdc:mga06r32_883_c2 3300050510 Bacteria 11998
208 Ga0500644_0013174 3300053088 Bacteria 2304
209 Ga0500651_0091085 3300053093 Bacteria 1877
210 Ga0500641_0059039 3300053096 Bacteria 1594
211 Ga0500660_187806 3300053100 Bacteria 734
212 Ga0500594_0005825 3300053118 Bacteria 2743
213 2515720385 2515154129 Bacteria 5584369
214 2516084558 2515154202 Bacteria 5471270
215 2753266969 2751185782 Bacteria 11227053
216 2772645293 2772190715 Bacteria 6959372
217 2867317124 2867312974 Bacteria 7058875
218 2880494787 2880489317 Bacteria 7096270
219 2880497527 2880495981 Bacteria 7340502
220 2887485681 2887478801 Bacteria 8972725
221 8001783086 8001781756 Bacteria 9586736
222 Ga0070663_100834387
223 JGI25406J46586_10036817
224 rootH1_10089019
225 rootH2_10016579
226 Ga0070658_10386338
227 Ga0068869_100427355
228 Ga0068868_100914975
229 Ga0070661_100269448
230 Ga0070668_100004736
231 Ga0070668_100112997
232 Ga0070659_100495114
233 Ga0070667_100045328
234 Ga0070714_101391274
235 Ga0070663_100342891
236 Ga0070679_100123503
237 Ga0070684_100426466
238 Ga0070684_100486330
239 Ga0070665_100167038
240 Ga0070664_100337074
241 Ga0070664_100465723
242 Ga0068856_100442519
243 Ga0068856_100464336
244 Ga0068863_100003011
245 Ga0068858_100015066
246 Ga0068860_100199939
247 Ga0068860_100874774
248 Ga0081540_1053659
249 Ga0081539_10000779
250 Ga0081539_10005125
251 Ga0081539_10005655
252 Ga0081539_10061128
253 Ga0081539_10210997
254 Ga0070712_100091800
255 Ga0075428_100000071
256 Ga0075428_100005251
257 Ga0075428_100168711
258 Ga0075428_100426006
259 Ga0075430_100004324
260 Ga0075430_100171967
261 Ga0075431_100013378
262 Ga0075431_100062690
263 Ga0075431_100177220
264 Ga0075431_100769036
265 Ga0075429_100009196
266 Ga0075429_100048823
267 Ga0075429_100127039
268 Ga0111539_11061395
269 Ga0105245_10651375
270 Ga0105247_10164551
271 Ga0114129_10002117
272 Ga0114129_10136509
273 Ga0114129_10604845
274 Ga0114129_10876499
275 Ga0114129_11045909
276 Ga0114129_11244408
277 Ga0105248_10272418
278 Ga0105249_10982963
279 Ga0163163_10005462
280 Ga0163163_10027468
281 Ga0163163_10485763
282 Ga0157379_10071661
283 Ga0157376_11102040
284 Ga0207699_10120398
285 Ga0207705_10669868
286 Ga0207684_11315441
287 Ga0207693_10330424
288 Ga0207687_10227251
289 Ga0207670_10065734
290 Ga0207689_10200300
291 Ga0207679_11065845
292 Ga0207712_10328375
293 Ga0207668_10030582
294 Ga0207668_10048505
295 Ga0207668_10763117
296 Ga0207658_10034668
297 Ga0207658_10051295
298 Ga0207703_10096533
299 Ga0207639_10951935
300 Ga0207678_10181688
301 Ga0207702_10777723
302 Ga0207702_10944409
303 Ga0207641_10005049
304 Ga0207641_10054188
305 Ga0207641_10432072
306 Ga0207676_10039599
307 Ga0207676_10380628
308 Ga0207674_10066497
309 Ga0268266_10187964
310 Ga0268266_11128136
311 Ga0268265_10872126
312 Ga0268264_10771624
313 Ga0268264_10873518
314 Ga0307517_10052312
315 Ga0307517_10136343
316 Ga0307515_10000083
317 Ga0307515_10006931
318 Ga0307512_10001451
319 Ga0307513_10016248
320 Ga0307513_10071957
321 Ga0307513_10076566
322 Ga0307513_10132272
323 Ga0307509_10013463
324 Ga0307509_10246737
325 Ga0307408_100309461
326 Ga0307508_10005452
327 Ga0307508_10015649
328 Ga0307516_10003673
329 Ga0307516_10012467
330 Ga0307516_10062241
331 Ga0307516_10155052
332 Ga0307405_10002593
333 Ga0307405_10025143
334 Ga0307405_10165503
335 Ga0307405_10479979
336 Ga0307413_10035868
337 Ga0307413_10331400
338 Ga0307518_10283036
339 Ga0307410_10309291
340 Ga0307410_10536106
341 Ga0326468_10000070
342 Ga0307406_10019489
343 Ga0307406_10073411
344 Ga0307407_10048379
345 Ga0307409_100009860
346 Ga0307409_100072600
347 Ga0307409_100113100
348 Ga0307409_101140031
349 Ga0307409_101531117
350 Ga0307416_100022694
351 Ga0307416_100244322
352 Ga0307416_100393993
353 Ga0307416_100416809
354 Ga0307416_101237927
355 Ga0307416_102169215
356 Ga0307414_10015979
357 Ga0307411_10629937
358 Ga0307415_100000091
359 Ga0307415_100049686
360 Ga0307415_100076907
361 Ga0307415_100096461
362 Ga0307415_100591746
363 Ga0307415_100920661
364 Ga0307510_10233931
365 Ga0307510_10294929
366 Ga0307510_10426546
367 Ga0373938_0009553
368 Ga0373928_0091222
369 Ga0373940_0022465
370 Ga0373951_0000190
371 Ga0373932_0114867
372 Ga0373939_0074792
373 Ga0373946_0074877
374 Ga0373942_0000309
375 Ga0373935_0011274
376 Ga0395899_0065459
377 Ga0395899_0123618
378 Ga0395900_0338982
379 Ga0395900_0382743
380 Ga0395898_0026358
381 Ga0395898_0070754
382 Ga0395905_0004689
383 Ga0395905_0037751
384 Ga0395901_0018443
385 Ga0395901_0032644
386 Ga0451849_1503696
387 Ga0439458_0111357
388 Ga0466966_0253807
389 Ga0466967_0157322
390 Ga0495629_0076793
391 Ga0495638_0230966
392 Ga0495594_0000498
393 Ga0495606_0001741
394 Ga0495632_0091895
395 Ga0495622_0280788
396 Ga0495668_0000642
397 Ga0495625_0001727
398 Ga0495581_0205277
399 Ga0495683_0062487
400 Ga0495626_0000455
401 Ga0496104_0036565
402 Ga0496105_0059197
403 Ga0496108_0012675
404 Ga0496109_0038833
405 Ga0496111_0008730
406 Ga0496112_0052535
407 Ga0496112_0073222
408 Ga0496112_0076352
409 Ga0496112_0275806
410 Ga0496113_0400458
411 Ga0496119_0408940
412 Ga0501047_0047410
413 nmdc:mga05p37_1312710_c1
414 nmdc:mga05p37_1446_c1
415 nmdc:mga05p37_299183_c1
416 nmdc:mga05p37_349758_c1
417 nmdc:mga05p37_486993_c1
418 nmdc:mga09592_402356_c1
419 nmdc:mga09592_606656_c1
420 nmdc:mga09592_643_c1
421 nmdc:mga09592_712960_c1
422 nmdc:mga09592_91108_c1
423 nmdc:mga0qj67_503_c1
424 nmdc:mga0qj67_55790_c1
425 nmdc:mga06r32_136470_c1
426 nmdc:mga06r32_5246_c1
427 nmdc:mga06r32_783350_c1
428 nmdc:mga06r32_883_c2
429 Ga0500644_0013174
430 Ga0500651_0091085
431 Ga0500641_0059039
432 Ga0500660_187806
433 Ga0500594_0005825
434 2515720385
435 2516084558
436 2753266969
437 2772645293
438 2867317124
439 2880494787
440 2880497527
441 2887485681
442 8001783086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

5

142

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m5j-assembly1.cif.gz_A the identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase 0.924 1 153
3ilo-assembly1.cif.gz_A crystal structure of e. coli hppk(d97a) in complex with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin 0.9072 3 151
1cbk-assembly1.cif.gz_B 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase from haemophilus influenzae 0.907 1 166
3kuh-assembly1.cif.gz_A crystal structure of e. coli hppk(h115a) in complex with ampcpp and hp 0.906 3 151
6an4-assembly1.cif.gz_A crystal structure of escherichia coli hppk in complex with bisubstrate analogue inhibitor hp-39 (j1f) 0.9031 3 151
ID Description Score Start End Superfamily
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9258 2 150 3.30.70.560
af_Q4LB35_295_465_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8958 1 153 3.30.70.560
af_A0A1D8PN03_274_470_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8867 2 159 3.30.70.560
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8844 2 150 3.30.70.560
af_P9WNC7_1_182_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8808 1 175 3.30.70.560
ID Description Score Start End GO Terms
AF-A0A6N9XZT4-F1-model_v4 deleted 0.9973 1 75
AF-A0A6F8Y2Z1-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9933 1 120 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-W7VLJ6-F1-model_v4 deleted 0.9902 2 175
AF-A0A558AQ62-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9889 1 69 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-D3Q2T6-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9819 1 165 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656

Map