F332468
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 220 | 156 | 214 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300036647|Ga0316582_0214780|Ga0316582_0214780_182_973 |
| Length | 263 |
| Sequence | MTSSQESHLLGENIILAVRSLLFLTGMILSVIIWAPAILSAFFLSFEHRYRTAQQWSRFIIWWLNKTCKIKYQISGLENIPPGPAIIVAKHQSAWETVFLQQFMPPLAWVVKRELLWVPFFGWALATLNPIAINRKTPSSALKQILRKGEVCLAQKRWVLIFPEGTRTAPGCRSTYGASGALLAVNSGYPILPIAHNAGEYWPRRGFLKRPGTIQLVFGPPIISVGRKAKELNAFVENWIETTMSRISDTSVQPGQTNSKKTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 2 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 3 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 4 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 5 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 36 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 95 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 96 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 99 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 100 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 101 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 102 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 103 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 104 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 105 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 107 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 108 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 109 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 110 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 111 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 115 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 116 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 117 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 118 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 119 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 120 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 121 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 122 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 123 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 124 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 143 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 144 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 145 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 148 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 149 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 150 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 151 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 155 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 156 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.82 |
| Metatranscriptomes | 0.45 |
| Isolates | 2.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.55 |
| Nodule | 0 |
| Rhizoplane | 0.45 |
| Rhizosphere | 90.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058692_1003148 | 3300003856 | Bacteria | 5233 |
| 2 | Ga0070658_10148472 | 3300005327 | Bacteria | 1961 |
| 3 | Ga0070658_10664854 | 3300005327 | Bacteria | 904 |
| 4 | Ga0070676_10079051 | 3300005328 | Bacteria | 1991 |
| 5 | Ga0070683_100108352 | 3300005329 | Bacteria | 2620 |
| 6 | Ga0070683_100143860 | 3300005329 | Bacteria | 2259 |
| 7 | Ga0070670_100176508 | 3300005331 | Bacteria | 1854 |
| 8 | Ga0068869_100050697 | 3300005334 | Bacteria | 3009 |
| 9 | Ga0068869_100265464 | 3300005334 | Bacteria | 1375 |
| 10 | Ga0070680_100458503 | 3300005336 | Bacteria | 1089 |
| 11 | Ga0068868_100728845 | 3300005338 | Bacteria | 889 |
| 12 | Ga0070689_100001002 | 3300005340 | Bacteria | 17702 |
| 13 | Ga0070689_100011086 | 3300005340 | Bacteria | 6447 |
| 14 | Ga0070692_10145062 | 3300005345 | Unclassified | 1347 |
| 15 | Ga0070669_100085138 | 3300005353 | Bacteria | 2360 |
| 16 | Ga0070675_100006112 | 3300005354 | Bacteria | 9236 |
| 17 | Ga0070673_100143802 | 3300005364 | Bacteria | 2014 |
| 18 | Ga0070688_100024045 | 3300005365 | Bacteria | 3589 |
| 19 | Ga0070688_100179421 | 3300005365 | Bacteria | 1468 |
| 20 | Ga0070714_100548022 | 3300005435 | Bacteria | 1107 |
| 21 | Ga0070694_100354203 | 3300005444 | Bacteria | 1138 |
| 22 | Ga0070681_10059200 | 3300005458 | Bacteria | 3810 |
| 23 | Ga0070681_10629272 | 3300005458 | Bacteria | 988 |
| 24 | Ga0068867_100219790 | 3300005459 | Bacteria | 1530 |
| 25 | Ga0068867_100756158 | 3300005459 | Bacteria | 863 |
| 26 | Ga0070679_100043513 | 3300005530 | Bacteria | 4473 |
| 27 | Ga0070679_100582931 | 3300005530 | Unclassified | 1062 |
| 28 | Ga0070679_100782727 | 3300005530 | Bacteria | 897 |
| 29 | Ga0068853_100399546 | 3300005539 | Unclassified | 1286 |
| 30 | Ga0070672_100107995 | 3300005543 | Bacteria | 2265 |
| 31 | Ga0070693_100043389 | 3300005547 | Bacteria | 2539 |
| 32 | Ga0068855_100023318 | 3300005563 | Bacteria | 7412 |
| 33 | Ga0068855_100046385 | 3300005563 | Bacteria | 5138 |
| 34 | Ga0068856_100296924 | 3300005614 | Bacteria | 1633 |
| 35 | Ga0068852_100003636 | 3300005616 | Bacteria | 10800 |
| 36 | Ga0068852_100056305 | 3300005616 | Bacteria | 3397 |
| 37 | Ga0068852_100410675 | 3300005616 | Unclassified | 1333 |
| 38 | Ga0068859_100162438 | 3300005617 | Bacteria | 2313 |
| 39 | Ga0068859_100298366 | 3300005617 | Bacteria | 1705 |
| 40 | Ga0068859_101133921 | 3300005617 | Unclassified | 861 |
| 41 | Ga0068861_100521653 | 3300005719 | Bacteria | 1078 |
| 42 | Ga0068858_100002639 | 3300005842 | Bacteria | 18064 |
| 43 | Ga0068858_100076438 | 3300005842 | Bacteria | 3109 |
| 44 | Ga0068858_100112434 | 3300005842 | Bacteria | 2544 |
| 45 | Ga0068858_100316826 | 3300005842 | Bacteria | 1490 |
| 46 | Ga0068862_100769312 | 3300005844 | Bacteria | 938 |
| 47 | Ga0075364_10528576 | 3300006051 | Bacteria | 806 |
| 48 | Ga0075367_10071818 | 3300006178 | Bacteria | 2083 |
| 49 | Ga0075367_10109935 | 3300006178 | Unclassified | 1691 |
| 50 | Ga0075369_10034698 | 3300006186 | Bacteria | 2142 |
| 51 | Ga0075366_10103784 | 3300006195 | Bacteria | 1707 |
| 52 | Ga0097621_100087718 | 3300006237 | Bacteria | 2598 |
| 53 | Ga0097621_100132919 | 3300006237 | Bacteria | 2119 |
| 54 | Ga0097621_100351196 | 3300006237 | Bacteria | 1311 |
| 55 | Ga0068871_100092723 | 3300006358 | Bacteria | 2519 |
| 56 | Ga0097620_100162439 | 3300006931 | Bacteria | 2313 |
| 57 | Ga0097620_100298367 | 3300006931 | Bacteria | 1705 |
| 58 | Ga0097620_101133956 | 3300006931 | Unclassified | 861 |
| 59 | Ga0105240_10018150 | 3300009093 | Bacteria | 9458 |
| 60 | Ga0105240_10068600 | 3300009093 | Bacteria | 4391 |
| 61 | Ga0105241_10013590 | 3300009174 | Bacteria | 5966 |
| 62 | Ga0105242_10001658 | 3300009176 | Bacteria | 17602 |
| 63 | Ga0105242_10182786 | 3300009176 | Bacteria | 1851 |
| 64 | Ga0105242_10542797 | 3300009176 | Bacteria | 1113 |
| 65 | Ga0105248_10005187 | 3300009177 | Bacteria | 14361 |
| 66 | Ga0105248_10127471 | 3300009177 | Bacteria | 2871 |
| 67 | Ga0105238_10004061 | 3300009551 | Bacteria | 14507 |
| 68 | Ga0105238_10011719 | 3300009551 | Bacteria | 8838 |
| 69 | Ga0105238_10116989 | 3300009551 | Bacteria | 2646 |
| 70 | Ga0105238_10185285 | 3300009551 | Bacteria | 2058 |
| 71 | Ga0157373_10036649 | 3300013100 | Bacteria | 3519 |
| 72 | Ga0157371_10071767 | 3300013102 | Bacteria | 2451 |
| 73 | Ga0157371_10163704 | 3300013102 | Bacteria | 1588 |
| 74 | Ga0157371_10236953 | 3300013102 | Bacteria | 1312 |
| 75 | Ga0157370_10000800 | 3300013104 | Bacteria | 39630 |
| 76 | Ga0157370_10003131 | 3300013104 | Bacteria | 19584 |
| 77 | Ga0157370_10181073 | 3300013104 | Bacteria | 1958 |
| 78 | Ga0157369_10005296 | 3300013105 | Bacteria | 15032 |
| 79 | Ga0157369_10656192 | 3300013105 | Unclassified | 1082 |
| 80 | Ga0157374_10474633 | 3300013296 | Bacteria | 1253 |
| 81 | Ga0157378_10041244 | 3300013297 | Bacteria | 4094 |
| 82 | Ga0157378_10271319 | 3300013297 | Bacteria | 1632 |
| 83 | Ga0163162_10025449 | 3300013306 | Bacteria | 5848 |
| 84 | Ga0157372_10003769 | 3300013307 | Bacteria | 16282 |
| 85 | Ga0157372_10189667 | 3300013307 | Bacteria | 2381 |
| 86 | Ga0157375_10143135 | 3300013308 | Bacteria | 2520 |
| 87 | Ga0157380_10071039 | 3300014326 | Bacteria | 2815 |
| 88 | Ga0157380_10396899 | 3300014326 | Bacteria | 1307 |
| 89 | Ga0157380_10429130 | 3300014326 | Bacteria | 1263 |
| 90 | Ga0157377_10030474 | 3300014745 | Bacteria | 2922 |
| 91 | Ga0157379_10049245 | 3300014968 | Bacteria | 3762 |
| 92 | Ga0157379_10353908 | 3300014968 | Bacteria | 1345 |
| 93 | Ga0157376_10115501 | 3300014969 | Bacteria | 2370 |
| 94 | Ga0182006_1005220 | 3300015261 | Bacteria | 6225 |
| 95 | Ga0182006_1024069 | 3300015261 | Bacteria | 2515 |
| 96 | Ga0213876_10051582 | 3300021384 | Bacteria | 2174 |
| 97 | Ga0207705_10111689 | 3300025909 | Bacteria | 2020 |
| 98 | Ga0207654_10039027 | 3300025911 | Bacteria | 2668 |
| 99 | Ga0207695_10308690 | 3300025913 | Bacteria | 1472 |
| 100 | Ga0207663_10263587 | 3300025916 | Bacteria | 1273 |
| 101 | Ga0207660_10257877 | 3300025917 | Bacteria | 1378 |
| 102 | Ga0207649_10218232 | 3300025920 | Bacteria | 1357 |
| 103 | Ga0207649_10516764 | 3300025920 | Bacteria | 910 |
| 104 | Ga0207652_10033789 | 3300025921 | Bacteria | 4308 |
| 105 | Ga0207652_10234114 | 3300025921 | Bacteria | 1655 |
| 106 | Ga0207694_10043505 | 3300025924 | Bacteria | 3467 |
| 107 | Ga0207694_10140524 | 3300025924 | Bacteria | 1942 |
| 108 | Ga0207694_10235958 | 3300025924 | Unclassified | 1494 |
| 109 | Ga0207687_10138627 | 3300025927 | Unclassified | 1843 |
| 110 | Ga0207687_10201727 | 3300025927 | Bacteria | 1555 |
| 111 | Ga0207664_10643381 | 3300025929 | Bacteria | 953 |
| 112 | Ga0207686_10066874 | 3300025934 | Bacteria | 2297 |
| 113 | Ga0207669_10115549 | 3300025937 | Bacteria | 1809 |
| 114 | Ga0207691_10016439 | 3300025940 | Bacteria | 7025 |
| 115 | Ga0207711_10023772 | 3300025941 | Bacteria | 5130 |
| 116 | Ga0207711_10074220 | 3300025941 | Bacteria | 2958 |
| 117 | Ga0207689_10050247 | 3300025942 | Bacteria | 3439 |
| 118 | Ga0207689_10192059 | 3300025942 | Bacteria | 1685 |
| 119 | Ga0207661_10175069 | 3300025944 | Bacteria | 1870 |
| 120 | Ga0207667_10046287 | 3300025949 | Bacteria | 4606 |
| 121 | Ga0207651_10132158 | 3300025960 | Bacteria | 1913 |
| 122 | Ga0207677_10869467 | 3300026023 | Bacteria | 811 |
| 123 | Ga0207703_10007077 | 3300026035 | Bacteria | 8925 |
| 124 | Ga0207703_10048566 | 3300026035 | Bacteria | 3426 |
| 125 | Ga0207703_10286617 | 3300026035 | Bacteria | 1497 |
| 126 | Ga0207648_10086853 | 3300026089 | Bacteria | 2729 |
| 127 | Ga0207648_10197585 | 3300026089 | Bacteria | 1783 |
| 128 | Ga0207676_10064097 | 3300026095 | Bacteria | 2921 |
| 129 | Ga0207674_10029601 | 3300026116 | Bacteria | 5765 |
| 130 | Ga0207683_10092543 | 3300026121 | Bacteria | 2694 |
| 131 | Ga0207698_10013611 | 3300026142 | Bacteria | 5376 |
| 132 | Ga0207698_10062676 | 3300026142 | Bacteria | 2905 |
| 133 | Ga0207698_10201950 | 3300026142 | Bacteria | 1781 |
| 134 | Ga0209371_1000231 | 3300027312 | Bacteria | 71359 |
| 135 | Ga0209969_1011244 | 3300027360 | Bacteria | 1285 |
| 136 | Ga0209984_1004147 | 3300027424 | Bacteria | 1694 |
| 137 | Ga0209995_1001326 | 3300027471 | Bacteria | 3806 |
| 138 | Ga0209982_1002229 | 3300027552 | Bacteria | 2712 |
| 139 | Ga0209983_1002661 | 3300027665 | Bacteria | 3874 |
| 140 | Ga0209974_10001496 | 3300027876 | Bacteria | 8490 |
| 141 | Ga0268265_10618206 | 3300028380 | Bacteria | 1038 |
| 142 | Ga0265336_10099324 | 3300028666 | Bacteria | 867 |
| 143 | Ga0268256_1000192 | 3300030500 | Bacteria | 71359 |
| 144 | Ga0265328_10013756 | 3300031239 | Bacteria | 3196 |
| 145 | Ga0265316_10168288 | 3300031344 | Bacteria | 1636 |
| 146 | Ga0316575_10023977 | 3300031665 | Bacteria | 2360 |
| 147 | Ga0316579_10007246 | 3300031691 | Bacteria | 4569 |
| 148 | Ga0316576_10061485 | 3300031727 | Bacteria | 2753 |
| 149 | Ga0316578_10019789 | 3300031728 | Bacteria | 3712 |
| 150 | Ga0316578_10050037 | 3300031728 | Bacteria | 2444 |
| 151 | Ga0316577_10013203 | 3300031733 | Bacteria | 4510 |
| 152 | Ga0316577_10049631 | 3300031733 | Bacteria | 2342 |
| 153 | Ga0316577_10080145 | 3300031733 | Bacteria | 1825 |
| 154 | Ga0307414_10031611 | 3300032004 | Bacteria | 3475 |
| 155 | Ga0307414_10280013 | 3300032004 | Bacteria | 1401 |
| 156 | Ga0316585_10029158 | 3300032137 | Bacteria | 1728 |
| 157 | Ga0316593_10000898 | 3300032168 | Bacteria | 6077 |
| 158 | Ga0316574_0096103 | 3300035398 | Unclassified | 1893 |
| 159 | Ga0373924_0026593 | 3300035410 | Bacteria | 2296 |
| 160 | Ga0316582_0088376 | 3300036647 | Bacteria | 2035 |
| 161 | Ga0316582_0214780 | 3300036647 | Bacteria | 1314 |
| 162 | Ga0316584_0004199 | 3300036712 | Bacteria | 9511 |
| 163 | Ga0316584_0046881 | 3300036712 | Bacteria | 3228 |
| 164 | Ga0316584_0079561 | 3300036712 | Bacteria | 2456 |
| 165 | Ga0316584_0080799 | 3300036712 | Bacteria | 2435 |
| 166 | Ga0316584_0095304 | 3300036712 | Bacteria | 2228 |
| 167 | Ga0316581_0005123 | 3300037588 | Bacteria | 3392 |
| 168 | Ga0400487_40213 | 3300039110 | Bacteria | 1513 |
| 169 | Ga0436365_0831845 | 3300039437 | Bacteria | 2174 |
| 170 | Ga0436365_1241889 | 3300039437 | Bacteria | 5207 |
| 171 | Ga0451807_1023130 | 3300041486 | Bacteria | 955 |
| 172 | Ga0439431_0068932 | 3300041997 | Bacteria | 940 |
| 173 | Ga0439437_000886 | 3300042000 | Bacteria | 3119 |
| 174 | Ga0439441_001275 | 3300042001 | Bacteria | 3236 |
| 175 | Ga0439452_008649 | 3300042010 | Bacteria | 3048 |
| 176 | Ga0439456_007322 | 3300042013 | Bacteria | 2263 |
| 177 | Ga0450911_000055 | 3300042115 | Bacteria | 47324 |
| 178 | Ga0450904_000123 | 3300042139 | Bacteria | 17117 |
| 179 | Ga0439446_0008696 | 3300042156 | Bacteria | 2704 |
| 180 | Ga0439464_0008737 | 3300042439 | Bacteria | 2656 |
| 181 | Ga0439464_0010884 | 3300042439 | Bacteria | 2404 |
| 182 | Ga0451577_0380413 | 3300042876 | Bacteria | 1281 |
| 183 | Ga0453684_0002435 | 3300044712 | Bacteria | 45259 |
| 184 | Ga0495592_0045789 | 3300046454 | Bacteria | 3263 |
| 185 | Ga0495651_0200613 | 3300046462 | Bacteria | 1396 |
| 186 | Ga0495606_0000311 | 3300046507 | Bacteria | 84114 |
| 187 | Ga0495608_0021704 | 3300046511 | Bacteria | 4406 |
| 188 | Ga0495643_0173353 | 3300046522 | Bacteria | 1053 |
| 189 | Ga0495652_0162340 | 3300046529 | Bacteria | 1733 |
| 190 | Ga0495587_0239443 | 3300046536 | Bacteria | 1021 |
| 191 | Ga0495621_0017865 | 3300046539 | Bacteria | 2298 |
| 192 | Ga0495645_0012868 | 3300046543 | Bacteria | 5906 |
| 193 | Ga0495667_0009223 | 3300046559 | Bacteria | 6694 |
| 194 | Ga0495657_0017014 | 3300046675 | Bacteria | 5285 |
| 195 | Ga0495599_0036537 | 3300046678 | Bacteria | 3085 |
| 196 | Ga0495623_0043174 | 3300046679 | Bacteria | 2870 |
| 197 | Ga0495649_0005819 | 3300046694 | Bacteria | 7762 |
| 198 | Ga0495600_0165047 | 3300046809 | Bacteria | 1431 |
| 199 | Ga0495604_0063685 | 3300047317 | Bacteria | 2812 |
| 200 | Ga0495684_0142575 | 3300047471 | Bacteria | 1796 |
| 201 | Ga0496116_0000008 | 3300048919 | Bacteria | 726753 |
| 202 | Ga0496121_0000012 | 3300048924 | Bacteria | 653131 |
| 203 | Ga0496122_0072472 | 3300048925 | Bacteria | 2449 |
| 204 | Ga0501072_0702452 | 3300049588 | Bacteria | 795 |
| 205 | Ga0501080_0075075 | 3300049742 | Bacteria | 3145 |
| 206 | Ga0501226_000008 | 3300049853 | Bacteria | 199119 |
| 207 | nmdc:mga0k408_93196_c1 | 3300050493 | Bacteria | 1771 |
| 208 | nmdc:mga06z11_268686_c1 | 3300050494 | Unclassified | 1008 |
| 209 | nmdc:mga06z11_287797_c1 | 3300050494 | Bacteria | 974 |
| 210 | nmdc:mga07m45_158782_c1 | 3300050496 | Bacteria | 1312 |
| 211 | nmdc:mga08x19_899827_c1 | 3300050514 | Bacteria | 629 |
| 212 | Ga0495601_0006152 | 3300053077 | Bacteria | 7004 |
| 213 | Ga0495619_0046659 | 3300053085 | Bacteria | 2850 |
| 214 | Ga0500555_037617 | 3300053103 | Bacteria | 1355 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050514 | nmdc:mga08x19_899827_c1 | nmdc:mga08x19_899827_c1_22_612 | 196 |
| 2 | 3300050494 | nmdc:mga06z11_287797_c1 | nmdc:mga06z11_287797_c1_330_938 | 201 |
| 3 | 3300028666 | Ga0265336_10099324 | Ga0265336_100993242 | 207 |
| 4 | 3300025920 | Ga0207649_10516764 | Ga0207649_105167641 | 228 |
| 5 | 3300031733 | Ga0316577_10080145 | Ga0316577_100801453 | 231 |
| 6 | 3300032137 | Ga0316585_10029158 | Ga0316585_100291581 | 231 |
| 7 | 3300036712 | Ga0316584_0046881 | Ga0316584_0046881_790_1509 | 231 |
| 8 | 3300036712 | Ga0316584_0080799 | Ga0316584_0080799_1172_1909 | 232 |
| 9 | 3300041486 | Ga0451807_1023130 | Ga0451807_1023130_247_945 | 232 |
| 10 | 3300039110 | Ga0400487_40213 | Ga0400487_40213_768_1469 | 233 |
| 11 | 3300031239 | Ga0265328_10013756 | Ga0265328_100137563 | 235 |
| 12 | 3300031344 | Ga0265316_10168288 | Ga0265316_101682882 | 235 |
| 13 | 3300044712 | Ga0453684_0002435 | Ga0453684_0002435_29937_30644 | 235 |
| 14 | 3300042876 | Ga0451577_0380413 | Ga0451577_0380413_547_1257 | 236 |
| 15 | 3300005563 | Ga0068855_100023318 | Ga0068855_1000233183 | 238 |
| 16 | 3300021384 | Ga0213876_10051582 | Ga0213876_100515821 | 238 |
| 17 | 3300039437 | Ga0436365_0831845 | Ga0436365_0831845_52_786 | 238 |
| 18 | 3300006051 | Ga0075364_10528576 | Ga0075364_105285761 | 239 |
| 19 | 3300006186 | Ga0075369_10034698 | Ga0075369_100346983 | 239 |
| 20 | 3300005842 | Ga0068858_100002639 | Ga0068858_1000026395 | 240 |
| 21 | 3300006178 | Ga0075367_10109935 | Ga0075367_101099351 | 240 |
| 22 | 3300013306 | Ga0163162_10025449 | Ga0163162_100254493 | 240 |
| 23 | 3300026035 | Ga0207703_10048566 | Ga0207703_100485662 | 240 |
| 24 | 3300050494 | nmdc:mga06z11_268686_c1 | nmdc:mga06z11_268686_c1_14_751 | 240 |
| 25 | 3300053103 | Ga0500555_037617 | Ga0500555_037617_286_1029 | 240 |
| 26 | 3300005327 | Ga0070658_10148472 | Ga0070658_101484723 | 241 |
| 27 | 3300005327 | Ga0070658_10664854 | Ga0070658_106648541 | 241 |
| 28 | 3300005328 | Ga0070676_10079051 | Ga0070676_100790512 | 241 |
| 29 | 3300005329 | Ga0070683_100108352 | Ga0070683_1001083523 | 241 |
| 30 | 3300005329 | Ga0070683_100143860 | Ga0070683_1001438603 | 241 |
| 31 | 3300005331 | Ga0070670_100176508 | Ga0070670_1001765082 | 241 |
| 32 | 3300005334 | Ga0068869_100050697 | Ga0068869_1000506972 | 241 |
| 33 | 3300005334 | Ga0068869_100265464 | Ga0068869_1002654641 | 241 |
| 34 | 3300005336 | Ga0070680_100458503 | Ga0070680_1004585032 | 241 |
| 35 | 3300005338 | Ga0068868_100728845 | Ga0068868_1007288451 | 241 |
| 36 | 3300005340 | Ga0070689_100001002 | Ga0070689_10000100217 | 241 |
| 37 | 3300005340 | Ga0070689_100011086 | Ga0070689_1000110863 | 241 |
| 38 | 3300005345 | Ga0070692_10145062 | Ga0070692_101450622 | 241 |
| 39 | 3300005353 | Ga0070669_100085138 | Ga0070669_1000851382 | 241 |
| 40 | 3300005354 | Ga0070675_100006112 | Ga0070675_1000061129 | 241 |
| 41 | 3300005364 | Ga0070673_100143802 | Ga0070673_1001438023 | 241 |
| 42 | 3300005365 | Ga0070688_100024045 | Ga0070688_1000240453 | 241 |
| 43 | 3300005365 | Ga0070688_100179421 | Ga0070688_1001794211 | 241 |
| 44 | 3300005435 | Ga0070714_100548022 | Ga0070714_1005480222 | 241 |
| 45 | 3300005444 | Ga0070694_100354203 | Ga0070694_1003542031 | 241 |
| 46 | 3300005458 | Ga0070681_10059200 | Ga0070681_100592004 | 241 |
| 47 | 3300005458 | Ga0070681_10629272 | Ga0070681_106292721 | 241 |
| 48 | 3300005459 | Ga0068867_100219790 | Ga0068867_1002197901 | 241 |
| 49 | 3300005459 | Ga0068867_100756158 | Ga0068867_1007561581 | 241 |
| 50 | 3300005530 | Ga0070679_100043513 | Ga0070679_1000435134 | 241 |
| 51 | 3300005530 | Ga0070679_100582931 | Ga0070679_1005829312 | 241 |
| 52 | 3300005530 | Ga0070679_100782727 | Ga0070679_1007827271 | 241 |
| 53 | 3300005539 | Ga0068853_100399546 | Ga0068853_1003995462 | 241 |
| 54 | 3300005543 | Ga0070672_100107995 | Ga0070672_1001079953 | 241 |
| 55 | 3300005547 | Ga0070693_100043389 | Ga0070693_1000433892 | 241 |
| 56 | 3300005563 | Ga0068855_100046385 | Ga0068855_1000463853 | 241 |
| 57 | 3300005614 | Ga0068856_100296924 | Ga0068856_1002969243 | 241 |
| 58 | 3300005616 | Ga0068852_100003636 | Ga0068852_1000036367 | 241 |
| 59 | 3300005616 | Ga0068852_100056305 | Ga0068852_1000563053 | 241 |
| 60 | 3300005616 | Ga0068852_100410675 | Ga0068852_1004106752 | 241 |
| 61 | 3300005617 | Ga0068859_100162438 | Ga0068859_1001624382 | 241 |
| 62 | 3300005617 | Ga0068859_100298366 | Ga0068859_1002983663 | 241 |
| 63 | 3300005617 | Ga0068859_101133921 | Ga0068859_1011339212 | 241 |
| 64 | 3300005719 | Ga0068861_100521653 | Ga0068861_1005216532 | 241 |
| 65 | 3300005842 | Ga0068858_100076438 | Ga0068858_1000764385 | 241 |
| 66 | 3300005842 | Ga0068858_100112434 | Ga0068858_1001124344 | 241 |
| 67 | 3300005842 | Ga0068858_100316826 | Ga0068858_1003168262 | 241 |
| 68 | 3300005844 | Ga0068862_100769312 | Ga0068862_1007693122 | 241 |
| 69 | 3300006178 | Ga0075367_10071818 | Ga0075367_100718182 | 241 |
| 70 | 3300006195 | Ga0075366_10103784 | Ga0075366_101037842 | 241 |
| 71 | 3300006237 | Ga0097621_100087718 | Ga0097621_1000877182 | 241 |
| 72 | 3300006237 | Ga0097621_100132919 | Ga0097621_1001329193 | 241 |
| 73 | 3300006237 | Ga0097621_100351196 | Ga0097621_1003511962 | 241 |
| 74 | 3300006358 | Ga0068871_100092723 | Ga0068871_1000927233 | 241 |
| 75 | 3300006931 | Ga0097620_100162439 | Ga0097620_1001624393 | 241 |
| 76 | 3300006931 | Ga0097620_100298367 | Ga0097620_1002983673 | 241 |
| 77 | 3300006931 | Ga0097620_101133956 | Ga0097620_1011339562 | 241 |
| 78 | 3300009093 | Ga0105240_10018150 | Ga0105240_1001815011 | 241 |
| 79 | 3300009093 | Ga0105240_10068600 | Ga0105240_100686002 | 241 |
| 80 | 3300009174 | Ga0105241_10013590 | Ga0105241_100135905 | 241 |
| 81 | 3300009176 | Ga0105242_10001658 | Ga0105242_1000165818 | 241 |
| 82 | 3300009176 | Ga0105242_10182786 | Ga0105242_101827862 | 241 |
| 83 | 3300009176 | Ga0105242_10542797 | Ga0105242_105427972 | 241 |
| 84 | 3300009177 | Ga0105248_10005187 | Ga0105248_100051874 | 241 |
| 85 | 3300009177 | Ga0105248_10127471 | Ga0105248_101274713 | 241 |
| 86 | 3300009551 | Ga0105238_10004061 | Ga0105238_1000406113 | 241 |
| 87 | 3300009551 | Ga0105238_10011719 | Ga0105238_100117198 | 241 |
| 88 | 3300009551 | Ga0105238_10116989 | Ga0105238_101169893 | 241 |
| 89 | 3300009551 | Ga0105238_10185285 | Ga0105238_101852853 | 241 |
| 90 | 3300013102 | Ga0157371_10163704 | Ga0157371_101637042 | 241 |
| 91 | 3300013102 | Ga0157371_10236953 | Ga0157371_102369532 | 241 |
| 92 | 3300013104 | Ga0157370_10000800 | Ga0157370_1000080027 | 241 |
| 93 | 3300013104 | Ga0157370_10181073 | Ga0157370_101810733 | 241 |
| 94 | 3300013105 | Ga0157369_10005296 | Ga0157369_1000529614 | 241 |
| 95 | 3300013105 | Ga0157369_10656192 | Ga0157369_106561921 | 241 |
| 96 | 3300013296 | Ga0157374_10474633 | Ga0157374_104746332 | 241 |
| 97 | 3300013297 | Ga0157378_10041244 | Ga0157378_100412442 | 241 |
| 98 | 3300013297 | Ga0157378_10271319 | Ga0157378_102713193 | 241 |
| 99 | 3300013307 | Ga0157372_10003769 | Ga0157372_1000376914 | 241 |
| 100 | 3300013307 | Ga0157372_10189667 | Ga0157372_101896672 | 241 |
| 101 | 3300013308 | Ga0157375_10143135 | Ga0157375_101431352 | 241 |
| 102 | 3300014326 | Ga0157380_10071039 | Ga0157380_100710392 | 241 |
| 103 | 3300014326 | Ga0157380_10396899 | Ga0157380_103968991 | 241 |
| 104 | 3300014326 | Ga0157380_10429130 | Ga0157380_104291302 | 241 |
| 105 | 3300014745 | Ga0157377_10030474 | Ga0157377_100304744 | 241 |
| 106 | 3300014968 | Ga0157379_10049245 | Ga0157379_100492453 | 241 |
| 107 | 3300014968 | Ga0157379_10353908 | Ga0157379_103539082 | 241 |
| 108 | 3300014969 | Ga0157376_10115501 | Ga0157376_101155012 | 241 |
| 109 | 3300025909 | Ga0207705_10111689 | Ga0207705_101116893 | 241 |
| 110 | 3300025911 | Ga0207654_10039027 | Ga0207654_100390273 | 241 |
| 111 | 3300025913 | Ga0207695_10308690 | Ga0207695_103086902 | 241 |
| 112 | 3300025916 | Ga0207663_10263587 | Ga0207663_102635872 | 241 |
| 113 | 3300025917 | Ga0207660_10257877 | Ga0207660_102578772 | 241 |
| 114 | 3300025920 | Ga0207649_10218232 | Ga0207649_102182322 | 241 |
| 115 | 3300025921 | Ga0207652_10033789 | Ga0207652_100337893 | 241 |
| 116 | 3300025921 | Ga0207652_10234114 | Ga0207652_102341142 | 241 |
| 117 | 3300025924 | Ga0207694_10043505 | Ga0207694_100435053 | 241 |
| 118 | 3300025924 | Ga0207694_10140524 | Ga0207694_101405243 | 241 |
| 119 | 3300025924 | Ga0207694_10235958 | Ga0207694_102359582 | 241 |
| 120 | 3300025927 | Ga0207687_10138627 | Ga0207687_101386272 | 241 |
| 121 | 3300025927 | Ga0207687_10201727 | Ga0207687_102017273 | 241 |
| 122 | 3300025929 | Ga0207664_10643381 | Ga0207664_106433812 | 241 |
| 123 | 3300025934 | Ga0207686_10066874 | Ga0207686_100668743 | 241 |
| 124 | 3300025937 | Ga0207669_10115549 | Ga0207669_101155492 | 241 |
| 125 | 3300025940 | Ga0207691_10016439 | Ga0207691_100164395 | 241 |
| 126 | 3300025941 | Ga0207711_10023772 | Ga0207711_100237723 | 241 |
| 127 | 3300025941 | Ga0207711_10074220 | Ga0207711_100742203 | 241 |
| 128 | 3300025942 | Ga0207689_10050247 | Ga0207689_100502473 | 241 |
| 129 | 3300025942 | Ga0207689_10192059 | Ga0207689_101920593 | 241 |
| 130 | 3300025944 | Ga0207661_10175069 | Ga0207661_101750691 | 241 |
| 131 | 3300025949 | Ga0207667_10046287 | Ga0207667_100462873 | 241 |
| 132 | 3300025960 | Ga0207651_10132158 | Ga0207651_101321582 | 241 |
| 133 | 3300026023 | Ga0207677_10869467 | Ga0207677_108694671 | 241 |
| 134 | 3300026035 | Ga0207703_10007077 | Ga0207703_100070774 | 241 |
| 135 | 3300026035 | Ga0207703_10286617 | Ga0207703_102866172 | 241 |
| 136 | 3300026089 | Ga0207648_10086853 | Ga0207648_100868532 | 241 |
| 137 | 3300026089 | Ga0207648_10197585 | Ga0207648_101975852 | 241 |
| 138 | 3300026095 | Ga0207676_10064097 | Ga0207676_100640972 | 241 |
| 139 | 3300026116 | Ga0207674_10029601 | Ga0207674_100296017 | 241 |
| 140 | 3300026121 | Ga0207683_10092543 | Ga0207683_100925433 | 241 |
| 141 | 3300026142 | Ga0207698_10013611 | Ga0207698_100136113 | 241 |
| 142 | 3300026142 | Ga0207698_10062676 | Ga0207698_100626762 | 241 |
| 143 | 3300026142 | Ga0207698_10201950 | Ga0207698_102019502 | 241 |
| 144 | 3300028380 | Ga0268265_10618206 | Ga0268265_106182062 | 241 |
| 145 | 3300035410 | Ga0373924_0026593 | Ga0373924_0026593_1260_1985 | 241 |
| 146 | 3300039437 | Ga0436365_1241889 | Ga0436365_1241889_2878_3603 | 241 |
| 147 | 3300042001 | Ga0439441_001275 | Ga0439441_001275_1675_2400 | 241 |
| 148 | 3300046454 | Ga0495592_0045789 | Ga0495592_0045789_244_969 | 241 |
| 149 | 3300046462 | Ga0495651_0200613 | Ga0495651_0200613_554_1279 | 241 |
| 150 | 3300046511 | Ga0495608_0021704 | Ga0495608_0021704_2915_3640 | 241 |
| 151 | 3300046529 | Ga0495652_0162340 | Ga0495652_0162340_848_1573 | 241 |
| 152 | 3300046536 | Ga0495587_0239443 | Ga0495587_0239443_53_778 | 241 |
| 153 | 3300046539 | Ga0495621_0017865 | Ga0495621_0017865_1367_2092 | 241 |
| 154 | 3300046543 | Ga0495645_0012868 | Ga0495645_0012868_3413_4138 | 241 |
| 155 | 3300046559 | Ga0495667_0009223 | Ga0495667_0009223_753_1478 | 241 |
| 156 | 3300046675 | Ga0495657_0017014 | Ga0495657_0017014_2693_3418 | 241 |
| 157 | 3300046678 | Ga0495599_0036537 | Ga0495599_0036537_892_1617 | 241 |
| 158 | 3300046679 | Ga0495623_0043174 | Ga0495623_0043174_848_1573 | 241 |
| 159 | 3300046809 | Ga0495600_0165047 | Ga0495600_0165047_318_1043 | 241 |
| 160 | 3300047317 | Ga0495604_0063685 | Ga0495604_0063685_1441_2166 | 241 |
| 161 | 3300047471 | Ga0495684_0142575 | Ga0495684_0142575_39_764 | 241 |
| 162 | 3300049588 | Ga0501072_0702452 | Ga0501072_0702452_11_778 | 241 |
| 163 | 3300049742 | Ga0501080_0075075 | Ga0501080_0075075_448_1173 | 241 |
| 164 | 3300050493 | nmdc:mga0k408_93196_c1 | nmdc:mga0k408_93196_c1_418_1143 | 241 |
| 165 | 3300050496 | nmdc:mga07m45_158782_c1 | nmdc:mga07m45_158782_c1_37_762 | 241 |
| 166 | 3300053077 | Ga0495601_0006152 | Ga0495601_0006152_4069_4794 | 241 |
| 167 | 3300053085 | Ga0495619_0046659 | Ga0495619_0046659_1016_1741 | 241 |
| 168 | 3300041997 | Ga0439431_0068932 | Ga0439431_0068932_118_891 | 242 |
| 169 | 3300042000 | Ga0439437_000886 | Ga0439437_000886_711_1484 | 242 |
| 170 | 3300042013 | Ga0439456_007322 | Ga0439456_007322_1391_2164 | 242 |
| 171 | 3300042115 | Ga0450911_000055 | Ga0450911_000055_39069_39842 | 242 |
| 172 | 3300042139 | Ga0450904_000123 | Ga0450904_000123_7579_8352 | 242 |
| 173 | 3300042156 | Ga0439446_0008696 | Ga0439446_0008696_1524_2297 | 242 |
| 174 | 3300048919 | Ga0496116_0000008 | Ga0496116_0000008_519302_520054 | 242 |
| 175 | 3300048924 | Ga0496121_0000012 | Ga0496121_0000012_205764_206516 | 242 |
| 176 | 3300049853 | Ga0501226_000008 | Ga0501226_000008_37067_37840 | 242 |
| 177 | 3300042439 | Ga0439464_0010884 | Ga0439464_0010884_563_1336 | 244 |
| 178 | 3300027360 | Ga0209969_1011244 | Ga0209969_10112442 | 245 |
| 179 | 3300027424 | Ga0209984_1004147 | Ga0209984_10041473 | 245 |
| 180 | 3300027471 | Ga0209995_1001326 | Ga0209995_10013264 | 245 |
| 181 | 3300027552 | Ga0209982_1002229 | Ga0209982_10022292 | 245 |
| 182 | 3300027665 | Ga0209983_1002661 | Ga0209983_10026614 | 245 |
| 183 | 3300027876 | Ga0209974_10001496 | Ga0209974_100014964 | 245 |
| 184 | 3300032004 | Ga0307414_10280013 | Ga0307414_102800132 | 245 |
| 185 | iso_pu_bacteria | 640427133 | 640485963 | 245 |
| 186 | iso_pu_bacteria | 651053060 | 651173875 | 245 |
| 187 | 3300031665 | Ga0316575_10023977 | Ga0316575_100239773 | 250 |
| 188 | 3300031691 | Ga0316579_10007246 | Ga0316579_100072461 | 250 |
| 189 | 3300031727 | Ga0316576_10061485 | Ga0316576_100614852 | 250 |
| 190 | 3300031728 | Ga0316578_10019789 | Ga0316578_100197893 | 250 |
| 191 | 3300031728 | Ga0316578_10050037 | Ga0316578_100500373 | 250 |
| 192 | 3300031733 | Ga0316577_10013203 | Ga0316577_100132033 | 250 |
| 193 | 3300031733 | Ga0316577_10049631 | Ga0316577_100496312 | 250 |
| 194 | 3300032168 | Ga0316593_10000898 | Ga0316593_100008982 | 250 |
| 195 | 3300035398 | Ga0316574_0096103 | Ga0316574_0096103_984_1766 | 250 |
| 196 | 3300036647 | Ga0316582_0088376 | Ga0316582_0088376_168_944 | 250 |
| 197 | 3300036712 | Ga0316584_0004199 | Ga0316584_0004199_49_837 | 250 |
| 198 | 3300036712 | Ga0316584_0079561 | Ga0316584_0079561_1390_2166 | 250 |
| 199 | 3300037588 | Ga0316581_0005123 | Ga0316581_0005123_2134_2910 | 250 |
| 200 | 3300036647 | Ga0316582_0214780 | Ga0316582_0214780_182_973 | 252 |
| 201 | 3300036712 | Ga0316584_0095304 | Ga0316584_0095304_1055_1846 | 252 |
| 202 | iso_pu_bacteria | 2808606373 | 2808905931 | 253 |
| 203 | iso_pu_bacteria | 2808606379 | 2808940345 | 253 |
| 204 | iso_pu_bacteria | 3007252601 | 3007254948 | 254 |
| 205 | iso_pu_bacteria | 3007315729 | 3007316255 | 254 |
| 206 | 3300013104 | Ga0157370_10003131 | Ga0157370_1000313112 | 257 |
| 207 | 3300015261 | Ga0182006_1024069 | Ga0182006_10240693 | 257 |
| 208 | 3300032004 | Ga0307414_10031611 | Ga0307414_100316113 | 257 |
| 209 | 3300046507 | Ga0495606_0000311 | Ga0495606_0000311_76431_77204 | 257 |
| 210 | 3300046522 | Ga0495643_0173353 | Ga0495643_0173353_230_1003 | 257 |
| 211 | 3300046694 | Ga0495649_0005819 | Ga0495649_0005819_3829_4602 | 257 |
| 212 | 3300003856 | Ga0058692_1003148 | Ga0058692_10031483 | 258 |
| 213 | 3300013100 | Ga0157373_10036649 | Ga0157373_100366493 | 258 |
| 214 | 3300013102 | Ga0157371_10071767 | Ga0157371_100717671 | 258 |
| 215 | 3300015261 | Ga0182006_1005220 | Ga0182006_10052203 | 258 |
| 216 | 3300027312 | Ga0209371_1000231 | Ga0209371_100023122 | 258 |
| 217 | 3300030500 | Ga0268256_1000192 | Ga0268256_100019248 | 258 |
| 218 | 3300042010 | Ga0439452_008649 | Ga0439452_008649_1492_2268 | 258 |
| 219 | 3300042439 | Ga0439464_0008737 | Ga0439464_0008737_941_1717 | 258 |
| 220 | 3300048925 | Ga0496122_0072472 | Ga0496122_0072472_52_828 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.819 | 7 | 243 |
| 5kym-assembly1.cif.gz_A | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.8123 | 5 | 243 |
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.8032 | 7 | 243 |
| 5kym-assembly1.cif.gz_A | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.7942 | 5 | 243 |
| 2zqk-assembly1.cif.gz_N | crystal structure of intimin-tir68 complex | 0.7081 | 210 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8GXU8_180_307_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8961 | 64 | 182 | 3.40.50.2000 |
| af_D4AC45_64_192_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8919 | 62 | 182 | 3.40.50.620 |
| af_P33333_55_242_3.40.1130.10 | Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase | 0.8872 | 56 | 237 | 3.40.1130.10 |
| af_I6YDI9_312_439_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8772 | 64 | 182 | 3.40.50.620 |
| af_Q22267_77_205_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8626 | 69 | 182 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G9G971-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9929 | 1 | 254 |
GO:0003841
GO:0006654 GO:0016020 |
| AF-A0A3T0SAV2-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9897 | 1 | 241 |
GO:0003841
GO:0006654 GO:0016020 |
| AF-A0A5E6PBA3-F1-model_v4 | deleted | 0.9891 | 1 | 248 |
|
| AF-A0A3M5VJR0-F1-model_v4 | Phospholipid/glycerol acyltransferase domain-containing protein | 0.9874 | 60 | 251 |
GO:0003841
GO:0006654 |
| AF-A0A1G9G971-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9776 | 1 | 254 |
GO:0003841
GO:0006654 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar