F332468

General Info

Members Datasets Scaffolds Average Seq Length
220 156 214 243

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0214780|Ga0316582_0214780_182_973
Length 263
Sequence MTSSQESHLLGENIILAVRSLLFLTGMILSVIIWAPAILSAFFLSFEHRYRTAQQWSRFIIWWLNKTCKIKYQISGLENIPPGPAIIVAKHQSAWETVFLQQFMPPLAWVVKRELLWVPFFGWALATLNPIAINRKTPSSALKQILRKGEVCLAQKRWVLIFPEGTRTAPGCRSTYGASGALLAVNSGYPILPIAHNAGEYWPRRGFLKRPGTIQLVFGPPIISVGRKAKELNAFVENWIETTMSRISDTSVQPGQTNSKKTA

Samples

Sample ID Description Type Environment
1 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
2 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
3 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
4 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
105 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
111 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
115 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
116 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
117 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
118 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
119 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
120 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
155 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
156 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 0.45
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0
Rhizoplane 0.45
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058692_1003148 3300003856 Bacteria 5233
2 Ga0070658_10148472 3300005327 Bacteria 1961
3 Ga0070658_10664854 3300005327 Bacteria 904
4 Ga0070676_10079051 3300005328 Bacteria 1991
5 Ga0070683_100108352 3300005329 Bacteria 2620
6 Ga0070683_100143860 3300005329 Bacteria 2259
7 Ga0070670_100176508 3300005331 Bacteria 1854
8 Ga0068869_100050697 3300005334 Bacteria 3009
9 Ga0068869_100265464 3300005334 Bacteria 1375
10 Ga0070680_100458503 3300005336 Bacteria 1089
11 Ga0068868_100728845 3300005338 Bacteria 889
12 Ga0070689_100001002 3300005340 Bacteria 17702
13 Ga0070689_100011086 3300005340 Bacteria 6447
14 Ga0070692_10145062 3300005345 Unclassified 1347
15 Ga0070669_100085138 3300005353 Bacteria 2360
16 Ga0070675_100006112 3300005354 Bacteria 9236
17 Ga0070673_100143802 3300005364 Bacteria 2014
18 Ga0070688_100024045 3300005365 Bacteria 3589
19 Ga0070688_100179421 3300005365 Bacteria 1468
20 Ga0070714_100548022 3300005435 Bacteria 1107
21 Ga0070694_100354203 3300005444 Bacteria 1138
22 Ga0070681_10059200 3300005458 Bacteria 3810
23 Ga0070681_10629272 3300005458 Bacteria 988
24 Ga0068867_100219790 3300005459 Bacteria 1530
25 Ga0068867_100756158 3300005459 Bacteria 863
26 Ga0070679_100043513 3300005530 Bacteria 4473
27 Ga0070679_100582931 3300005530 Unclassified 1062
28 Ga0070679_100782727 3300005530 Bacteria 897
29 Ga0068853_100399546 3300005539 Unclassified 1286
30 Ga0070672_100107995 3300005543 Bacteria 2265
31 Ga0070693_100043389 3300005547 Bacteria 2539
32 Ga0068855_100023318 3300005563 Bacteria 7412
33 Ga0068855_100046385 3300005563 Bacteria 5138
34 Ga0068856_100296924 3300005614 Bacteria 1633
35 Ga0068852_100003636 3300005616 Bacteria 10800
36 Ga0068852_100056305 3300005616 Bacteria 3397
37 Ga0068852_100410675 3300005616 Unclassified 1333
38 Ga0068859_100162438 3300005617 Bacteria 2313
39 Ga0068859_100298366 3300005617 Bacteria 1705
40 Ga0068859_101133921 3300005617 Unclassified 861
41 Ga0068861_100521653 3300005719 Bacteria 1078
42 Ga0068858_100002639 3300005842 Bacteria 18064
43 Ga0068858_100076438 3300005842 Bacteria 3109
44 Ga0068858_100112434 3300005842 Bacteria 2544
45 Ga0068858_100316826 3300005842 Bacteria 1490
46 Ga0068862_100769312 3300005844 Bacteria 938
47 Ga0075364_10528576 3300006051 Bacteria 806
48 Ga0075367_10071818 3300006178 Bacteria 2083
49 Ga0075367_10109935 3300006178 Unclassified 1691
50 Ga0075369_10034698 3300006186 Bacteria 2142
51 Ga0075366_10103784 3300006195 Bacteria 1707
52 Ga0097621_100087718 3300006237 Bacteria 2598
53 Ga0097621_100132919 3300006237 Bacteria 2119
54 Ga0097621_100351196 3300006237 Bacteria 1311
55 Ga0068871_100092723 3300006358 Bacteria 2519
56 Ga0097620_100162439 3300006931 Bacteria 2313
57 Ga0097620_100298367 3300006931 Bacteria 1705
58 Ga0097620_101133956 3300006931 Unclassified 861
59 Ga0105240_10018150 3300009093 Bacteria 9458
60 Ga0105240_10068600 3300009093 Bacteria 4391
61 Ga0105241_10013590 3300009174 Bacteria 5966
62 Ga0105242_10001658 3300009176 Bacteria 17602
63 Ga0105242_10182786 3300009176 Bacteria 1851
64 Ga0105242_10542797 3300009176 Bacteria 1113
65 Ga0105248_10005187 3300009177 Bacteria 14361
66 Ga0105248_10127471 3300009177 Bacteria 2871
67 Ga0105238_10004061 3300009551 Bacteria 14507
68 Ga0105238_10011719 3300009551 Bacteria 8838
69 Ga0105238_10116989 3300009551 Bacteria 2646
70 Ga0105238_10185285 3300009551 Bacteria 2058
71 Ga0157373_10036649 3300013100 Bacteria 3519
72 Ga0157371_10071767 3300013102 Bacteria 2451
73 Ga0157371_10163704 3300013102 Bacteria 1588
74 Ga0157371_10236953 3300013102 Bacteria 1312
75 Ga0157370_10000800 3300013104 Bacteria 39630
76 Ga0157370_10003131 3300013104 Bacteria 19584
77 Ga0157370_10181073 3300013104 Bacteria 1958
78 Ga0157369_10005296 3300013105 Bacteria 15032
79 Ga0157369_10656192 3300013105 Unclassified 1082
80 Ga0157374_10474633 3300013296 Bacteria 1253
81 Ga0157378_10041244 3300013297 Bacteria 4094
82 Ga0157378_10271319 3300013297 Bacteria 1632
83 Ga0163162_10025449 3300013306 Bacteria 5848
84 Ga0157372_10003769 3300013307 Bacteria 16282
85 Ga0157372_10189667 3300013307 Bacteria 2381
86 Ga0157375_10143135 3300013308 Bacteria 2520
87 Ga0157380_10071039 3300014326 Bacteria 2815
88 Ga0157380_10396899 3300014326 Bacteria 1307
89 Ga0157380_10429130 3300014326 Bacteria 1263
90 Ga0157377_10030474 3300014745 Bacteria 2922
91 Ga0157379_10049245 3300014968 Bacteria 3762
92 Ga0157379_10353908 3300014968 Bacteria 1345
93 Ga0157376_10115501 3300014969 Bacteria 2370
94 Ga0182006_1005220 3300015261 Bacteria 6225
95 Ga0182006_1024069 3300015261 Bacteria 2515
96 Ga0213876_10051582 3300021384 Bacteria 2174
97 Ga0207705_10111689 3300025909 Bacteria 2020
98 Ga0207654_10039027 3300025911 Bacteria 2668
99 Ga0207695_10308690 3300025913 Bacteria 1472
100 Ga0207663_10263587 3300025916 Bacteria 1273
101 Ga0207660_10257877 3300025917 Bacteria 1378
102 Ga0207649_10218232 3300025920 Bacteria 1357
103 Ga0207649_10516764 3300025920 Bacteria 910
104 Ga0207652_10033789 3300025921 Bacteria 4308
105 Ga0207652_10234114 3300025921 Bacteria 1655
106 Ga0207694_10043505 3300025924 Bacteria 3467
107 Ga0207694_10140524 3300025924 Bacteria 1942
108 Ga0207694_10235958 3300025924 Unclassified 1494
109 Ga0207687_10138627 3300025927 Unclassified 1843
110 Ga0207687_10201727 3300025927 Bacteria 1555
111 Ga0207664_10643381 3300025929 Bacteria 953
112 Ga0207686_10066874 3300025934 Bacteria 2297
113 Ga0207669_10115549 3300025937 Bacteria 1809
114 Ga0207691_10016439 3300025940 Bacteria 7025
115 Ga0207711_10023772 3300025941 Bacteria 5130
116 Ga0207711_10074220 3300025941 Bacteria 2958
117 Ga0207689_10050247 3300025942 Bacteria 3439
118 Ga0207689_10192059 3300025942 Bacteria 1685
119 Ga0207661_10175069 3300025944 Bacteria 1870
120 Ga0207667_10046287 3300025949 Bacteria 4606
121 Ga0207651_10132158 3300025960 Bacteria 1913
122 Ga0207677_10869467 3300026023 Bacteria 811
123 Ga0207703_10007077 3300026035 Bacteria 8925
124 Ga0207703_10048566 3300026035 Bacteria 3426
125 Ga0207703_10286617 3300026035 Bacteria 1497
126 Ga0207648_10086853 3300026089 Bacteria 2729
127 Ga0207648_10197585 3300026089 Bacteria 1783
128 Ga0207676_10064097 3300026095 Bacteria 2921
129 Ga0207674_10029601 3300026116 Bacteria 5765
130 Ga0207683_10092543 3300026121 Bacteria 2694
131 Ga0207698_10013611 3300026142 Bacteria 5376
132 Ga0207698_10062676 3300026142 Bacteria 2905
133 Ga0207698_10201950 3300026142 Bacteria 1781
134 Ga0209371_1000231 3300027312 Bacteria 71359
135 Ga0209969_1011244 3300027360 Bacteria 1285
136 Ga0209984_1004147 3300027424 Bacteria 1694
137 Ga0209995_1001326 3300027471 Bacteria 3806
138 Ga0209982_1002229 3300027552 Bacteria 2712
139 Ga0209983_1002661 3300027665 Bacteria 3874
140 Ga0209974_10001496 3300027876 Bacteria 8490
141 Ga0268265_10618206 3300028380 Bacteria 1038
142 Ga0265336_10099324 3300028666 Bacteria 867
143 Ga0268256_1000192 3300030500 Bacteria 71359
144 Ga0265328_10013756 3300031239 Bacteria 3196
145 Ga0265316_10168288 3300031344 Bacteria 1636
146 Ga0316575_10023977 3300031665 Bacteria 2360
147 Ga0316579_10007246 3300031691 Bacteria 4569
148 Ga0316576_10061485 3300031727 Bacteria 2753
149 Ga0316578_10019789 3300031728 Bacteria 3712
150 Ga0316578_10050037 3300031728 Bacteria 2444
151 Ga0316577_10013203 3300031733 Bacteria 4510
152 Ga0316577_10049631 3300031733 Bacteria 2342
153 Ga0316577_10080145 3300031733 Bacteria 1825
154 Ga0307414_10031611 3300032004 Bacteria 3475
155 Ga0307414_10280013 3300032004 Bacteria 1401
156 Ga0316585_10029158 3300032137 Bacteria 1728
157 Ga0316593_10000898 3300032168 Bacteria 6077
158 Ga0316574_0096103 3300035398 Unclassified 1893
159 Ga0373924_0026593 3300035410 Bacteria 2296
160 Ga0316582_0088376 3300036647 Bacteria 2035
161 Ga0316582_0214780 3300036647 Bacteria 1314
162 Ga0316584_0004199 3300036712 Bacteria 9511
163 Ga0316584_0046881 3300036712 Bacteria 3228
164 Ga0316584_0079561 3300036712 Bacteria 2456
165 Ga0316584_0080799 3300036712 Bacteria 2435
166 Ga0316584_0095304 3300036712 Bacteria 2228
167 Ga0316581_0005123 3300037588 Bacteria 3392
168 Ga0400487_40213 3300039110 Bacteria 1513
169 Ga0436365_0831845 3300039437 Bacteria 2174
170 Ga0436365_1241889 3300039437 Bacteria 5207
171 Ga0451807_1023130 3300041486 Bacteria 955
172 Ga0439431_0068932 3300041997 Bacteria 940
173 Ga0439437_000886 3300042000 Bacteria 3119
174 Ga0439441_001275 3300042001 Bacteria 3236
175 Ga0439452_008649 3300042010 Bacteria 3048
176 Ga0439456_007322 3300042013 Bacteria 2263
177 Ga0450911_000055 3300042115 Bacteria 47324
178 Ga0450904_000123 3300042139 Bacteria 17117
179 Ga0439446_0008696 3300042156 Bacteria 2704
180 Ga0439464_0008737 3300042439 Bacteria 2656
181 Ga0439464_0010884 3300042439 Bacteria 2404
182 Ga0451577_0380413 3300042876 Bacteria 1281
183 Ga0453684_0002435 3300044712 Bacteria 45259
184 Ga0495592_0045789 3300046454 Bacteria 3263
185 Ga0495651_0200613 3300046462 Bacteria 1396
186 Ga0495606_0000311 3300046507 Bacteria 84114
187 Ga0495608_0021704 3300046511 Bacteria 4406
188 Ga0495643_0173353 3300046522 Bacteria 1053
189 Ga0495652_0162340 3300046529 Bacteria 1733
190 Ga0495587_0239443 3300046536 Bacteria 1021
191 Ga0495621_0017865 3300046539 Bacteria 2298
192 Ga0495645_0012868 3300046543 Bacteria 5906
193 Ga0495667_0009223 3300046559 Bacteria 6694
194 Ga0495657_0017014 3300046675 Bacteria 5285
195 Ga0495599_0036537 3300046678 Bacteria 3085
196 Ga0495623_0043174 3300046679 Bacteria 2870
197 Ga0495649_0005819 3300046694 Bacteria 7762
198 Ga0495600_0165047 3300046809 Bacteria 1431
199 Ga0495604_0063685 3300047317 Bacteria 2812
200 Ga0495684_0142575 3300047471 Bacteria 1796
201 Ga0496116_0000008 3300048919 Bacteria 726753
202 Ga0496121_0000012 3300048924 Bacteria 653131
203 Ga0496122_0072472 3300048925 Bacteria 2449
204 Ga0501072_0702452 3300049588 Bacteria 795
205 Ga0501080_0075075 3300049742 Bacteria 3145
206 Ga0501226_000008 3300049853 Bacteria 199119
207 nmdc:mga0k408_93196_c1 3300050493 Bacteria 1771
208 nmdc:mga06z11_268686_c1 3300050494 Unclassified 1008
209 nmdc:mga06z11_287797_c1 3300050494 Bacteria 974
210 nmdc:mga07m45_158782_c1 3300050496 Bacteria 1312
211 nmdc:mga08x19_899827_c1 3300050514 Bacteria 629
212 Ga0495601_0006152 3300053077 Bacteria 7004
213 Ga0495619_0046659 3300053085 Bacteria 2850
214 Ga0500555_037617 3300053103 Bacteria 1355

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_899827_c1 nmdc:mga08x19_899827_c1_22_612 196
2 3300050494 nmdc:mga06z11_287797_c1 nmdc:mga06z11_287797_c1_330_938 201
3 3300028666 Ga0265336_10099324 Ga0265336_100993242 207
4 3300025920 Ga0207649_10516764 Ga0207649_105167641 228
5 3300031733 Ga0316577_10080145 Ga0316577_100801453 231
6 3300032137 Ga0316585_10029158 Ga0316585_100291581 231
7 3300036712 Ga0316584_0046881 Ga0316584_0046881_790_1509 231
8 3300036712 Ga0316584_0080799 Ga0316584_0080799_1172_1909 232
9 3300041486 Ga0451807_1023130 Ga0451807_1023130_247_945 232
10 3300039110 Ga0400487_40213 Ga0400487_40213_768_1469 233
11 3300031239 Ga0265328_10013756 Ga0265328_100137563 235
12 3300031344 Ga0265316_10168288 Ga0265316_101682882 235
13 3300044712 Ga0453684_0002435 Ga0453684_0002435_29937_30644 235
14 3300042876 Ga0451577_0380413 Ga0451577_0380413_547_1257 236
15 3300005563 Ga0068855_100023318 Ga0068855_1000233183 238
16 3300021384 Ga0213876_10051582 Ga0213876_100515821 238
17 3300039437 Ga0436365_0831845 Ga0436365_0831845_52_786 238
18 3300006051 Ga0075364_10528576 Ga0075364_105285761 239
19 3300006186 Ga0075369_10034698 Ga0075369_100346983 239
20 3300005842 Ga0068858_100002639 Ga0068858_1000026395 240
21 3300006178 Ga0075367_10109935 Ga0075367_101099351 240
22 3300013306 Ga0163162_10025449 Ga0163162_100254493 240
23 3300026035 Ga0207703_10048566 Ga0207703_100485662 240
24 3300050494 nmdc:mga06z11_268686_c1 nmdc:mga06z11_268686_c1_14_751 240
25 3300053103 Ga0500555_037617 Ga0500555_037617_286_1029 240
26 3300005327 Ga0070658_10148472 Ga0070658_101484723 241
27 3300005327 Ga0070658_10664854 Ga0070658_106648541 241
28 3300005328 Ga0070676_10079051 Ga0070676_100790512 241
29 3300005329 Ga0070683_100108352 Ga0070683_1001083523 241
30 3300005329 Ga0070683_100143860 Ga0070683_1001438603 241
31 3300005331 Ga0070670_100176508 Ga0070670_1001765082 241
32 3300005334 Ga0068869_100050697 Ga0068869_1000506972 241
33 3300005334 Ga0068869_100265464 Ga0068869_1002654641 241
34 3300005336 Ga0070680_100458503 Ga0070680_1004585032 241
35 3300005338 Ga0068868_100728845 Ga0068868_1007288451 241
36 3300005340 Ga0070689_100001002 Ga0070689_10000100217 241
37 3300005340 Ga0070689_100011086 Ga0070689_1000110863 241
38 3300005345 Ga0070692_10145062 Ga0070692_101450622 241
39 3300005353 Ga0070669_100085138 Ga0070669_1000851382 241
40 3300005354 Ga0070675_100006112 Ga0070675_1000061129 241
41 3300005364 Ga0070673_100143802 Ga0070673_1001438023 241
42 3300005365 Ga0070688_100024045 Ga0070688_1000240453 241
43 3300005365 Ga0070688_100179421 Ga0070688_1001794211 241
44 3300005435 Ga0070714_100548022 Ga0070714_1005480222 241
45 3300005444 Ga0070694_100354203 Ga0070694_1003542031 241
46 3300005458 Ga0070681_10059200 Ga0070681_100592004 241
47 3300005458 Ga0070681_10629272 Ga0070681_106292721 241
48 3300005459 Ga0068867_100219790 Ga0068867_1002197901 241
49 3300005459 Ga0068867_100756158 Ga0068867_1007561581 241
50 3300005530 Ga0070679_100043513 Ga0070679_1000435134 241
51 3300005530 Ga0070679_100582931 Ga0070679_1005829312 241
52 3300005530 Ga0070679_100782727 Ga0070679_1007827271 241
53 3300005539 Ga0068853_100399546 Ga0068853_1003995462 241
54 3300005543 Ga0070672_100107995 Ga0070672_1001079953 241
55 3300005547 Ga0070693_100043389 Ga0070693_1000433892 241
56 3300005563 Ga0068855_100046385 Ga0068855_1000463853 241
57 3300005614 Ga0068856_100296924 Ga0068856_1002969243 241
58 3300005616 Ga0068852_100003636 Ga0068852_1000036367 241
59 3300005616 Ga0068852_100056305 Ga0068852_1000563053 241
60 3300005616 Ga0068852_100410675 Ga0068852_1004106752 241
61 3300005617 Ga0068859_100162438 Ga0068859_1001624382 241
62 3300005617 Ga0068859_100298366 Ga0068859_1002983663 241
63 3300005617 Ga0068859_101133921 Ga0068859_1011339212 241
64 3300005719 Ga0068861_100521653 Ga0068861_1005216532 241
65 3300005842 Ga0068858_100076438 Ga0068858_1000764385 241
66 3300005842 Ga0068858_100112434 Ga0068858_1001124344 241
67 3300005842 Ga0068858_100316826 Ga0068858_1003168262 241
68 3300005844 Ga0068862_100769312 Ga0068862_1007693122 241
69 3300006178 Ga0075367_10071818 Ga0075367_100718182 241
70 3300006195 Ga0075366_10103784 Ga0075366_101037842 241
71 3300006237 Ga0097621_100087718 Ga0097621_1000877182 241
72 3300006237 Ga0097621_100132919 Ga0097621_1001329193 241
73 3300006237 Ga0097621_100351196 Ga0097621_1003511962 241
74 3300006358 Ga0068871_100092723 Ga0068871_1000927233 241
75 3300006931 Ga0097620_100162439 Ga0097620_1001624393 241
76 3300006931 Ga0097620_100298367 Ga0097620_1002983673 241
77 3300006931 Ga0097620_101133956 Ga0097620_1011339562 241
78 3300009093 Ga0105240_10018150 Ga0105240_1001815011 241
79 3300009093 Ga0105240_10068600 Ga0105240_100686002 241
80 3300009174 Ga0105241_10013590 Ga0105241_100135905 241
81 3300009176 Ga0105242_10001658 Ga0105242_1000165818 241
82 3300009176 Ga0105242_10182786 Ga0105242_101827862 241
83 3300009176 Ga0105242_10542797 Ga0105242_105427972 241
84 3300009177 Ga0105248_10005187 Ga0105248_100051874 241
85 3300009177 Ga0105248_10127471 Ga0105248_101274713 241
86 3300009551 Ga0105238_10004061 Ga0105238_1000406113 241
87 3300009551 Ga0105238_10011719 Ga0105238_100117198 241
88 3300009551 Ga0105238_10116989 Ga0105238_101169893 241
89 3300009551 Ga0105238_10185285 Ga0105238_101852853 241
90 3300013102 Ga0157371_10163704 Ga0157371_101637042 241
91 3300013102 Ga0157371_10236953 Ga0157371_102369532 241
92 3300013104 Ga0157370_10000800 Ga0157370_1000080027 241
93 3300013104 Ga0157370_10181073 Ga0157370_101810733 241
94 3300013105 Ga0157369_10005296 Ga0157369_1000529614 241
95 3300013105 Ga0157369_10656192 Ga0157369_106561921 241
96 3300013296 Ga0157374_10474633 Ga0157374_104746332 241
97 3300013297 Ga0157378_10041244 Ga0157378_100412442 241
98 3300013297 Ga0157378_10271319 Ga0157378_102713193 241
99 3300013307 Ga0157372_10003769 Ga0157372_1000376914 241
100 3300013307 Ga0157372_10189667 Ga0157372_101896672 241
101 3300013308 Ga0157375_10143135 Ga0157375_101431352 241
102 3300014326 Ga0157380_10071039 Ga0157380_100710392 241
103 3300014326 Ga0157380_10396899 Ga0157380_103968991 241
104 3300014326 Ga0157380_10429130 Ga0157380_104291302 241
105 3300014745 Ga0157377_10030474 Ga0157377_100304744 241
106 3300014968 Ga0157379_10049245 Ga0157379_100492453 241
107 3300014968 Ga0157379_10353908 Ga0157379_103539082 241
108 3300014969 Ga0157376_10115501 Ga0157376_101155012 241
109 3300025909 Ga0207705_10111689 Ga0207705_101116893 241
110 3300025911 Ga0207654_10039027 Ga0207654_100390273 241
111 3300025913 Ga0207695_10308690 Ga0207695_103086902 241
112 3300025916 Ga0207663_10263587 Ga0207663_102635872 241
113 3300025917 Ga0207660_10257877 Ga0207660_102578772 241
114 3300025920 Ga0207649_10218232 Ga0207649_102182322 241
115 3300025921 Ga0207652_10033789 Ga0207652_100337893 241
116 3300025921 Ga0207652_10234114 Ga0207652_102341142 241
117 3300025924 Ga0207694_10043505 Ga0207694_100435053 241
118 3300025924 Ga0207694_10140524 Ga0207694_101405243 241
119 3300025924 Ga0207694_10235958 Ga0207694_102359582 241
120 3300025927 Ga0207687_10138627 Ga0207687_101386272 241
121 3300025927 Ga0207687_10201727 Ga0207687_102017273 241
122 3300025929 Ga0207664_10643381 Ga0207664_106433812 241
123 3300025934 Ga0207686_10066874 Ga0207686_100668743 241
124 3300025937 Ga0207669_10115549 Ga0207669_101155492 241
125 3300025940 Ga0207691_10016439 Ga0207691_100164395 241
126 3300025941 Ga0207711_10023772 Ga0207711_100237723 241
127 3300025941 Ga0207711_10074220 Ga0207711_100742203 241
128 3300025942 Ga0207689_10050247 Ga0207689_100502473 241
129 3300025942 Ga0207689_10192059 Ga0207689_101920593 241
130 3300025944 Ga0207661_10175069 Ga0207661_101750691 241
131 3300025949 Ga0207667_10046287 Ga0207667_100462873 241
132 3300025960 Ga0207651_10132158 Ga0207651_101321582 241
133 3300026023 Ga0207677_10869467 Ga0207677_108694671 241
134 3300026035 Ga0207703_10007077 Ga0207703_100070774 241
135 3300026035 Ga0207703_10286617 Ga0207703_102866172 241
136 3300026089 Ga0207648_10086853 Ga0207648_100868532 241
137 3300026089 Ga0207648_10197585 Ga0207648_101975852 241
138 3300026095 Ga0207676_10064097 Ga0207676_100640972 241
139 3300026116 Ga0207674_10029601 Ga0207674_100296017 241
140 3300026121 Ga0207683_10092543 Ga0207683_100925433 241
141 3300026142 Ga0207698_10013611 Ga0207698_100136113 241
142 3300026142 Ga0207698_10062676 Ga0207698_100626762 241
143 3300026142 Ga0207698_10201950 Ga0207698_102019502 241
144 3300028380 Ga0268265_10618206 Ga0268265_106182062 241
145 3300035410 Ga0373924_0026593 Ga0373924_0026593_1260_1985 241
146 3300039437 Ga0436365_1241889 Ga0436365_1241889_2878_3603 241
147 3300042001 Ga0439441_001275 Ga0439441_001275_1675_2400 241
148 3300046454 Ga0495592_0045789 Ga0495592_0045789_244_969 241
149 3300046462 Ga0495651_0200613 Ga0495651_0200613_554_1279 241
150 3300046511 Ga0495608_0021704 Ga0495608_0021704_2915_3640 241
151 3300046529 Ga0495652_0162340 Ga0495652_0162340_848_1573 241
152 3300046536 Ga0495587_0239443 Ga0495587_0239443_53_778 241
153 3300046539 Ga0495621_0017865 Ga0495621_0017865_1367_2092 241
154 3300046543 Ga0495645_0012868 Ga0495645_0012868_3413_4138 241
155 3300046559 Ga0495667_0009223 Ga0495667_0009223_753_1478 241
156 3300046675 Ga0495657_0017014 Ga0495657_0017014_2693_3418 241
157 3300046678 Ga0495599_0036537 Ga0495599_0036537_892_1617 241
158 3300046679 Ga0495623_0043174 Ga0495623_0043174_848_1573 241
159 3300046809 Ga0495600_0165047 Ga0495600_0165047_318_1043 241
160 3300047317 Ga0495604_0063685 Ga0495604_0063685_1441_2166 241
161 3300047471 Ga0495684_0142575 Ga0495684_0142575_39_764 241
162 3300049588 Ga0501072_0702452 Ga0501072_0702452_11_778 241
163 3300049742 Ga0501080_0075075 Ga0501080_0075075_448_1173 241
164 3300050493 nmdc:mga0k408_93196_c1 nmdc:mga0k408_93196_c1_418_1143 241
165 3300050496 nmdc:mga07m45_158782_c1 nmdc:mga07m45_158782_c1_37_762 241
166 3300053077 Ga0495601_0006152 Ga0495601_0006152_4069_4794 241
167 3300053085 Ga0495619_0046659 Ga0495619_0046659_1016_1741 241
168 3300041997 Ga0439431_0068932 Ga0439431_0068932_118_891 242
169 3300042000 Ga0439437_000886 Ga0439437_000886_711_1484 242
170 3300042013 Ga0439456_007322 Ga0439456_007322_1391_2164 242
171 3300042115 Ga0450911_000055 Ga0450911_000055_39069_39842 242
172 3300042139 Ga0450904_000123 Ga0450904_000123_7579_8352 242
173 3300042156 Ga0439446_0008696 Ga0439446_0008696_1524_2297 242
174 3300048919 Ga0496116_0000008 Ga0496116_0000008_519302_520054 242
175 3300048924 Ga0496121_0000012 Ga0496121_0000012_205764_206516 242
176 3300049853 Ga0501226_000008 Ga0501226_000008_37067_37840 242
177 3300042439 Ga0439464_0010884 Ga0439464_0010884_563_1336 244
178 3300027360 Ga0209969_1011244 Ga0209969_10112442 245
179 3300027424 Ga0209984_1004147 Ga0209984_10041473 245
180 3300027471 Ga0209995_1001326 Ga0209995_10013264 245
181 3300027552 Ga0209982_1002229 Ga0209982_10022292 245
182 3300027665 Ga0209983_1002661 Ga0209983_10026614 245
183 3300027876 Ga0209974_10001496 Ga0209974_100014964 245
184 3300032004 Ga0307414_10280013 Ga0307414_102800132 245
185 iso_pu_bacteria 640427133 640485963 245
186 iso_pu_bacteria 651053060 651173875 245
187 3300031665 Ga0316575_10023977 Ga0316575_100239773 250
188 3300031691 Ga0316579_10007246 Ga0316579_100072461 250
189 3300031727 Ga0316576_10061485 Ga0316576_100614852 250
190 3300031728 Ga0316578_10019789 Ga0316578_100197893 250
191 3300031728 Ga0316578_10050037 Ga0316578_100500373 250
192 3300031733 Ga0316577_10013203 Ga0316577_100132033 250
193 3300031733 Ga0316577_10049631 Ga0316577_100496312 250
194 3300032168 Ga0316593_10000898 Ga0316593_100008982 250
195 3300035398 Ga0316574_0096103 Ga0316574_0096103_984_1766 250
196 3300036647 Ga0316582_0088376 Ga0316582_0088376_168_944 250
197 3300036712 Ga0316584_0004199 Ga0316584_0004199_49_837 250
198 3300036712 Ga0316584_0079561 Ga0316584_0079561_1390_2166 250
199 3300037588 Ga0316581_0005123 Ga0316581_0005123_2134_2910 250
200 3300036647 Ga0316582_0214780 Ga0316582_0214780_182_973 252
201 3300036712 Ga0316584_0095304 Ga0316584_0095304_1055_1846 252
202 iso_pu_bacteria 2808606373 2808905931 253
203 iso_pu_bacteria 2808606379 2808940345 253
204 iso_pu_bacteria 3007252601 3007254948 254
205 iso_pu_bacteria 3007315729 3007316255 254
206 3300013104 Ga0157370_10003131 Ga0157370_1000313112 257
207 3300015261 Ga0182006_1024069 Ga0182006_10240693 257
208 3300032004 Ga0307414_10031611 Ga0307414_100316113 257
209 3300046507 Ga0495606_0000311 Ga0495606_0000311_76431_77204 257
210 3300046522 Ga0495643_0173353 Ga0495643_0173353_230_1003 257
211 3300046694 Ga0495649_0005819 Ga0495649_0005819_3829_4602 257
212 3300003856 Ga0058692_1003148 Ga0058692_10031483 258
213 3300013100 Ga0157373_10036649 Ga0157373_100366493 258
214 3300013102 Ga0157371_10071767 Ga0157371_100717671 258
215 3300015261 Ga0182006_1005220 Ga0182006_10052203 258
216 3300027312 Ga0209371_1000231 Ga0209371_100023122 258
217 3300030500 Ga0268256_1000192 Ga0268256_100019248 258
218 3300042010 Ga0439452_008649 Ga0439452_008649_1492_2268 258
219 3300042439 Ga0439464_0008737 Ga0439464_0008737_941_1717 258
220 3300048925 Ga0496122_0072472 Ga0496122_0072472_52_828 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

71

197

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.819 7 243
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8123 5 243
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8032 7 243
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7942 5 243
2zqk-assembly1.cif.gz_N crystal structure of intimin-tir68 complex 0.7081 210 241
ID Description Score Start End Superfamily
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8961 64 182 3.40.50.2000
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8919 62 182 3.40.50.620
af_P33333_55_242_3.40.1130.10 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.8872 56 237 3.40.1130.10
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8772 64 182 3.40.50.620
af_Q22267_77_205_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8626 69 182 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A1G9G971-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9929 1 254 GO:0003841
GO:0006654
GO:0016020
AF-A0A3T0SAV2-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9897 1 241 GO:0003841
GO:0006654
GO:0016020
AF-A0A5E6PBA3-F1-model_v4 deleted 0.9891 1 248
AF-A0A3M5VJR0-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.9874 60 251 GO:0003841
GO:0006654
AF-A0A1G9G971-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9776 1 254 GO:0003841
GO:0006654
GO:0016020

Feature Viewer

pLDDT pTM Quality
91.76 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map