F332362

General Info

Members Datasets Scaffolds Average Seq Length
220 166 440 376

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10180963|Ga0207674_101809631
Length 409
Sequence MRKIGTRRLAAVACAGVLALATACGTSSGDGDEGNSASEEQGDFTVPDVPMQDEIGDAEGQVNILAWPGYAEDGSTDPAVDWVTPFEQQTGCQVTVKTFATSAEAVQLYSTGEYDVVSASGDASLRLVYGDRVQPVNTALVPNYADIFPELKDQPWNTVAGTNYGIPHGRGANLLLYNTAAYPTAPTSWKDMWDPASPAKGKISPYDDGIYIADAAVYLMATKPELGIKNPYALDRTQFDAAVELVRQQKPLVAEYWADVVKQGQGLASGAITQSQGWQLTANLANGESGTSVATTKPAEGATGWSDTWMIRKDTPNINCAYLWLNHVVSPQVNAQIAEYFGEAPANQKSCALTKNADHCTVFHAEETDFWTNVYYWTTPVENCVDGRTDVQCVPYDEWVRTWSELRST

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
50 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
56 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
115 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
158 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
159 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
160 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
161 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
162 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
163 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
164 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
165 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
166 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.55
Metatranscriptomes 0.91
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 0
Rhizoplane 4.55
Rhizosphere 82.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10180963 3300026116 Bacteria 2059
2 JGI24737J22298_10009899 3300001990 Bacteria 3156
3 JGI25153J46596_10015077 3300003215 Bacteria 3171
4 Ga0058859_10017229 3300004798 Bacteria 1448
5 Ga0070683_100138889 3300005329 Bacteria 2302
6 Ga0070698_100129646 3300005471 Bacteria 2478
7 Ga0068864_100150963 3300005618 Bacteria 2104
8 Ga0081455_10007155 3300005937 Bacteria 11808
9 Ga0081455_10094122 3300005937 Bacteria 2421
10 Ga0081455_10158249 3300005937 Bacteria 1739
11 Ga0081455_10185793 3300005937 Bacteria 1570
12 Ga0081538_10000466 3300005981 Bacteria 45388
13 Ga0081538_10017243 3300005981 Bacteria 5491
14 Ga0081540_1000153 3300005983 Bacteria 70813
15 Ga0081539_10038309 3300005985 Bacteria 2843
16 Ga0075368_10008336 3300006042 Bacteria 3686
17 Ga0075363_100007143 3300006048 Bacteria 5114
18 Ga0075363_100007758 3300006048 Bacteria 4957
19 Ga0075364_10164220 3300006051 Bacteria 1500
20 Ga0075432_10007525 3300006058 Bacteria 3709
21 Ga0075367_10000070 3300006178 Bacteria 25863
22 Ga0075370_10098415 3300006353 Bacteria 1691
23 Ga0075428_100017672 3300006844 Bacteria 7881
24 Ga0075428_100095410 3300006844 Bacteria 3242
25 Ga0075430_100010398 3300006846 Bacteria 7881
26 Ga0075430_100090931 3300006846 Bacteria 2553
27 Ga0075430_100137896 3300006846 Bacteria 2032
28 Ga0075431_100005051 3300006847 Bacteria 12981
29 Ga0075433_10120183 3300006852 Bacteria 2332
30 Ga0075434_100184599 3300006871 Bacteria 2106
31 Ga0075429_100028628 3300006880 Bacteria 4837
32 Ga0105245_10110796 3300009098 Bacteria 2552
33 Ga0114129_10170366 3300009147 Bacteria 2969
34 Ga0114129_10226157 3300009147 Bacteria 2522
35 Ga0114129_10341444 3300009147 Bacteria 1986
36 Ga0105241_10096953 3300009174 Bacteria 2337
37 Ga0105242_10059867 3300009176 Bacteria 3126
38 Ga0105242_10178558 3300009176 Bacteria 1872
39 Ga0105248_10326482 3300009177 Bacteria 1728
40 Ga0105249_10090710 3300009553 Bacteria 2858
41 Ga0105249_10504412 3300009553 Bacteria 1255
42 Ga0105246_10042077 3300011119 Bacteria 3093
43 Ga0163162_10008544 3300013306 Bacteria 9984
44 Ga0163162_10129037 3300013306 Bacteria 2636
45 Ga0163162_10305396 3300013306 Bacteria 1723
46 Ga0183367_1001 3300015688 Bacteria 1225545
47 Ga0163161_10037065 3300017792 Bacteria 3494
48 Ga0209758_1005098 3300025297 Bacteria 10400
49 Ga0209758_1012947 3300025297 Bacteria 4607
50 Ga0207687_10045868 3300025927 Bacteria 3023
51 Ga0207661_10087726 3300025944 Bacteria 2585
52 Ga0207712_10231623 3300025961 Bacteria 1483
53 Ga0207676_10144411 3300026095 Bacteria 2042
54 Ga0207676_10149711 3300026095 Bacteria 2009
55 Ga0209813_10006574 3300027866 Bacteria 2877
56 Ga0207428_10016369 3300027907 Bacteria 6380
57 Ga0207428_10123072 3300027907 Bacteria 1988
58 Ga0307515_10000441 3300028794 Bacteria 99819
59 Ga0307511_10000078 3300030521 Bacteria 81896
60 Ga0307512_10003190 3300030522 Bacteria 19437
61 Ga0307512_10148211 3300030522 Bacteria 1412
62 Ga0307513_10034078 3300031456 Bacteria 5718
63 Ga0307509_10013317 3300031507 Bacteria 9747
64 Ga0316576_10007065 3300031727 Bacteria 7032
65 Ga0316576_10009792 3300031727 Bacteria 6204
66 Ga0316576_10031738 3300031727 Bacteria 3750
67 Ga0316576_10073939 3300031727 Bacteria 2519
68 Ga0316576_10104482 3300031727 Bacteria 2120
69 Ga0316578_10011905 3300031728 Bacteria 4570
70 Ga0316578_10054929 3300031728 Bacteria 2336
71 Ga0307516_10010622 3300031730 Bacteria 10101
72 Ga0307405_10147151 3300031731 Bacteria 1652
73 Ga0307405_10184193 3300031731 Bacteria 1502
74 Ga0307410_10056268 3300031852 Bacteria 2674
75 Ga0307412_10051250 3300031911 Bacteria 2727
76 Ga0307409_100001479 3300031995 Bacteria 11588
77 Ga0307409_100132950 3300031995 Bacteria 2130
78 Ga0307416_100051619 3300032002 Bacteria 3286
79 Ga0307416_100279623 3300032002 Bacteria 1645
80 Ga0307415_100000049 3300032126 Bacteria 51581
81 Ga0307507_10014382 3300033179 Bacteria 9449
82 Ga0307510_10023461 3300033180 Bacteria 7151
83 Ga0307510_10101545 3300033180 Bacteria 2663
84 Ga0316574_0008512 3300035398 Bacteria 5701
85 Ga0316574_0012469 3300035398 Bacteria 4863
86 Ga0316574_0091753 3300035398 Bacteria 1937
87 Ga0316582_0101320 3300036647 Bacteria 1908
88 Ga0316584_0039084 3300036712 Bacteria 3532
89 Ga0395900_0163070 3300037418 Bacteria 2273
90 Ga0395900_0339640 3300037418 Bacteria 1478
91 Ga0395898_0035483 3300037466 Bacteria 4957
92 Ga0395898_0285508 3300037466 Bacteria 1574
93 Ga0395901_0013730 3300038443 Bacteria 8232
94 Ga0450910_002571 3300042147 Bacteria 2389
95 Ga0466966_0019797 3300044684 Bacteria 4426
96 Ga0466961_0052383 3300044693 Bacteria 2604
97 Ga0466963_0020866 3300044694 Bacteria 4126
98 Ga0466963_0075809 3300044694 Bacteria 2270
99 Ga0466964_0030389 3300044706 Bacteria 2138
100 Ga0466971_0036856 3300044719 Bacteria 2193
101 Ga0466970_0069960 3300044765 Bacteria 1887
102 Ga0466957_0031667 3300044842 Bacteria 3162
103 Ga0466960_0003229 3300044901 Bacteria 6254
104 Ga0466959_0144676 3300045049 Bacteria 1678
105 Ga0466967_0049211 3300045976 Bacteria 3685
106 Ga0495592_0037914 3300046454 Bacteria 3627
107 Ga0495603_0001385 3300046455 Bacteria 14073
108 Ga0495603_0007074 3300046455 Bacteria 6732
109 Ga0495603_0017695 3300046455 Bacteria 4313
110 Ga0495629_0005757 3300046459 Bacteria 9251
111 Ga0495629_0059212 3300046459 Bacteria 2677
112 Ga0495651_0001542 3300046462 Bacteria 17799
113 Ga0495650_0023146 3300046471 Bacteria 2963
114 Ga0495580_0030441 3300046472 Bacteria 3908
115 Ga0495582_0071587 3300046473 Bacteria 1918
116 Ga0495662_0000678 3300046476 Bacteria 16092
117 Ga0495662_0068757 3300046476 Bacteria 1715
118 Ga0495664_0007213 3300046477 Bacteria 6164
119 Ga0495594_0014519 3300046499 Bacteria 4129
120 Ga0495594_0051839 3300046499 Bacteria 2258
121 Ga0495606_0004190 3300046507 Bacteria 14610
122 Ga0495616_0001838 3300046513 Bacteria 14375
123 Ga0495643_0012100 3300046522 Bacteria 5216
124 Ga0495644_0031988 3300046523 Bacteria 1989
125 Ga0495663_0006557 3300046525 Bacteria 3212
126 Ga0495666_0065662 3300046526 Bacteria 1730
127 Ga0495652_0007294 3300046529 Bacteria 10201
128 Ga0495640_0035894 3300046533 Bacteria 3506
129 Ga0495587_0011981 3300046536 Bacteria 5479
130 Ga0495587_0131907 3300046536 Bacteria 1428
131 Ga0495645_0053421 3300046543 Bacteria 2937
132 Ga0495622_0005138 3300046557 Bacteria 6067
133 Ga0495667_0040098 3300046559 Bacteria 3111
134 Ga0495656_0005188 3300046615 Bacteria 4492
135 Ga0495634_0002923 3300046642 Bacteria 13959
136 Ga0495634_0069263 3300046642 Bacteria 2328
137 Ga0495611_0075565 3300046648 Bacteria 1544
138 Ga0495625_0005701 3300046660 Bacteria 11276
139 Ga0495635_0011484 3300046663 Bacteria 6209
140 Ga0495588_0002901 3300046674 Bacteria 7393
141 Ga0495588_0012619 3300046674 Bacteria 3999
142 Ga0495657_0005445 3300046675 Bacteria 10080
143 Ga0495657_0010808 3300046675 Bacteria 6855
144 Ga0495646_0004089 3300046680 Bacteria 9152
145 Ga0495658_0045723 3300046683 Bacteria 2458
146 Ga0495613_0002152 3300046689 Bacteria 14944
147 Ga0495613_0055840 3300046689 Bacteria 2900
148 Ga0495624_0025618 3300046690 Bacteria 3871
149 Ga0495649_0075382 3300046694 Bacteria 1806
150 Ga0495589_0062383 3300046794 Bacteria 1828
151 Ga0495600_0012525 3300046809 Bacteria 5307
152 Ga0495581_0007375 3300047315 Bacteria 6357
153 Ga0495604_0000392 3300047317 Bacteria 39604
154 Ga0495676_0029997 3300047321 Bacteria 4623
155 Ga0495676_0036593 3300047321 Bacteria 4096
156 Ga0495687_003806 3300047443 Bacteria 10643
157 Ga0495685_016340 3300047447 Bacteria 2535
158 Ga0495681_0002761 3300047470 Bacteria 12422
159 Ga0495593_0005187 3300047673 Bacteria 7701
160 Ga0495614_0010365 3300048089 Bacteria 4109
161 Ga0495626_0028510 3300048091 Bacteria 2706
162 Ga0496104_0246223 3300048907 Bacteria 1700
163 Ga0496105_0245463 3300048908 Bacteria 1452
164 Ga0496106_0135662 3300048909 Bacteria 1933
165 Ga0496108_0040566 3300048911 Bacteria 3881
166 Ga0496109_0021980 3300048912 Bacteria 5647
167 Ga0496110_0043863 3300048913 Bacteria 3904
168 Ga0496111_0014423 3300048914 Bacteria 5397
169 Ga0496112_0033527 3300048915 Bacteria 4993
170 Ga0496112_0189086 3300048915 Bacteria 2022
171 Ga0496114_0302761 3300048917 Bacteria 1411
172 Ga0501033_0003298 3300049570 Bacteria 13339
173 Ga0501034_0010357 3300049571 Bacteria 9716
174 Ga0501034_0103283 3300049571 Bacteria 2843
175 Ga0501036_0011803 3300049572 Bacteria 7241
176 Ga0501038_0004113 3300049574 Bacteria 13535
177 Ga0501038_0032733 3300049574 Bacteria 4585
178 Ga0501039_0004847 3300049575 Bacteria 10185
179 Ga0501043_0039543 3300049579 Bacteria 3706
180 Ga0501047_0064288 3300049581 Bacteria 3539
181 Ga0501067_0040184 3300049583 Bacteria 2598
182 Ga0501069_0007347 3300049585 Bacteria 5782
183 Ga0501069_0065946 3300049585 Bacteria 2025
184 Ga0501070_0239890 3300049586 Bacteria 1484
185 Ga0501074_0035492 3300049590 Bacteria 3612
186 Ga0501081_0031593 3300049743 Bacteria 3589
187 Ga0501035_0012036 3300049822 Bacteria 8003
188 Ga0501044_0001923 3300049823 Bacteria 24042
189 Ga0501044_0004591 3300049823 Bacteria 15443
190 nmdc:mga03n38_119392_c1 3300050490 Bacteria 1294
191 nmdc:mga03n38_70649_c1 3300050490 Bacteria 1615
192 nmdc:mga06z11_39975_c1 3300050494 Bacteria 2337
193 nmdc:mga04h51_1987_c1 3300050495 Bacteria 4777
194 nmdc:mga05p37_2287_c1 3300050507 Bacteria 22335
195 nmdc:mga05p37_296796_c1 3300050507 Bacteria 1921
196 nmdc:mga05p37_81835_c1 3300050507 Bacteria 3978
197 nmdc:mga09592_122902_c1 3300050508 Bacteria 2230
198 nmdc:mga09592_2856_c1 3300050508 Bacteria 14014
199 nmdc:mga0qj67_128227_c1 3300050509 Bacteria 2053
200 nmdc:mga0qj67_2264_c1 3300050509 Bacteria 13679
201 nmdc:mga08y16_2071_c1 3300050511 Bacteria 20559
202 nmdc:mga0a205_193950_c1 3300050515 Bacteria 1923
203 nmdc:mga0a205_48745_c1 3300050515 Bacteria 4088
204 Ga0495619_0027767 3300053085 Bacteria 3649
205 Ga0500644_0018978 3300053088 Bacteria 2023
206 Ga0500640_001019 3300053095 Bacteria 7972
207 Ga0501084_0084417 3300054114 Bacteria 2666
208 Ga0587079_008051 3300059647 Bacteria 1598
209 Ga0466962_0037737 3300061719 Bacteria 2314
210 Ga0530510_0015904 3300061734 Bacteria 5319
211 2585311902 2582581314 Bacteria 11452267
212 2616699087 2616644814 Bacteria 11555299
213 2643946800 2643221587 Bacteria 7586415
214 2808914799 2808606375 Bacteria 9466072
215 2819745321 2818991472 Bacteria 10089953
216 2862283174 2862281513 Bacteria 9621493
217 2912727113 2912723979 Bacteria 8557534
218 2954382630 2954380949 Bacteria 10050426
219 8008575349 8008574985 Bacteria 7815457
220 8056834646 8056829672 Bacteria 9045328
221 Ga0207674_10180963
222 JGI24737J22298_10009899
223 JGI25153J46596_10015077
224 Ga0058859_10017229
225 Ga0070683_100138889
226 Ga0070698_100129646
227 Ga0068864_100150963
228 Ga0081455_10007155
229 Ga0081455_10094122
230 Ga0081455_10158249
231 Ga0081455_10185793
232 Ga0081538_10000466
233 Ga0081538_10017243
234 Ga0081540_1000153
235 Ga0081539_10038309
236 Ga0075368_10008336
237 Ga0075363_100007143
238 Ga0075363_100007758
239 Ga0075364_10164220
240 Ga0075432_10007525
241 Ga0075367_10000070
242 Ga0075370_10098415
243 Ga0075428_100017672
244 Ga0075428_100095410
245 Ga0075430_100010398
246 Ga0075430_100090931
247 Ga0075430_100137896
248 Ga0075431_100005051
249 Ga0075433_10120183
250 Ga0075434_100184599
251 Ga0075429_100028628
252 Ga0105245_10110796
253 Ga0114129_10170366
254 Ga0114129_10226157
255 Ga0114129_10341444
256 Ga0105241_10096953
257 Ga0105242_10059867
258 Ga0105242_10178558
259 Ga0105248_10326482
260 Ga0105249_10090710
261 Ga0105249_10504412
262 Ga0105246_10042077
263 Ga0163162_10008544
264 Ga0163162_10129037
265 Ga0163162_10305396
266 Ga0183367_1001
267 Ga0163161_10037065
268 Ga0209758_1005098
269 Ga0209758_1012947
270 Ga0207687_10045868
271 Ga0207661_10087726
272 Ga0207712_10231623
273 Ga0207676_10144411
274 Ga0207676_10149711
275 Ga0209813_10006574
276 Ga0207428_10016369
277 Ga0207428_10123072
278 Ga0307515_10000441
279 Ga0307511_10000078
280 Ga0307512_10003190
281 Ga0307512_10148211
282 Ga0307513_10034078
283 Ga0307509_10013317
284 Ga0316576_10007065
285 Ga0316576_10009792
286 Ga0316576_10031738
287 Ga0316576_10073939
288 Ga0316576_10104482
289 Ga0316578_10011905
290 Ga0316578_10054929
291 Ga0307516_10010622
292 Ga0307405_10147151
293 Ga0307405_10184193
294 Ga0307410_10056268
295 Ga0307412_10051250
296 Ga0307409_100001479
297 Ga0307409_100132950
298 Ga0307416_100051619
299 Ga0307416_100279623
300 Ga0307415_100000049
301 Ga0307507_10014382
302 Ga0307510_10023461
303 Ga0307510_10101545
304 Ga0316574_0008512
305 Ga0316574_0012469
306 Ga0316574_0091753
307 Ga0316582_0101320
308 Ga0316584_0039084
309 Ga0395900_0163070
310 Ga0395900_0339640
311 Ga0395898_0035483
312 Ga0395898_0285508
313 Ga0395901_0013730
314 Ga0450910_002571
315 Ga0466966_0019797
316 Ga0466961_0052383
317 Ga0466963_0020866
318 Ga0466963_0075809
319 Ga0466964_0030389
320 Ga0466971_0036856
321 Ga0466970_0069960
322 Ga0466957_0031667
323 Ga0466960_0003229
324 Ga0466959_0144676
325 Ga0466967_0049211
326 Ga0495592_0037914
327 Ga0495603_0001385
328 Ga0495603_0007074
329 Ga0495603_0017695
330 Ga0495629_0005757
331 Ga0495629_0059212
332 Ga0495651_0001542
333 Ga0495650_0023146
334 Ga0495580_0030441
335 Ga0495582_0071587
336 Ga0495662_0000678
337 Ga0495662_0068757
338 Ga0495664_0007213
339 Ga0495594_0014519
340 Ga0495594_0051839
341 Ga0495606_0004190
342 Ga0495616_0001838
343 Ga0495643_0012100
344 Ga0495644_0031988
345 Ga0495663_0006557
346 Ga0495666_0065662
347 Ga0495652_0007294
348 Ga0495640_0035894
349 Ga0495587_0011981
350 Ga0495587_0131907
351 Ga0495645_0053421
352 Ga0495622_0005138
353 Ga0495667_0040098
354 Ga0495656_0005188
355 Ga0495634_0002923
356 Ga0495634_0069263
357 Ga0495611_0075565
358 Ga0495625_0005701
359 Ga0495635_0011484
360 Ga0495588_0002901
361 Ga0495588_0012619
362 Ga0495657_0005445
363 Ga0495657_0010808
364 Ga0495646_0004089
365 Ga0495658_0045723
366 Ga0495613_0002152
367 Ga0495613_0055840
368 Ga0495624_0025618
369 Ga0495649_0075382
370 Ga0495589_0062383
371 Ga0495600_0012525
372 Ga0495581_0007375
373 Ga0495604_0000392
374 Ga0495676_0029997
375 Ga0495676_0036593
376 Ga0495687_003806
377 Ga0495685_016340
378 Ga0495681_0002761
379 Ga0495593_0005187
380 Ga0495614_0010365
381 Ga0495626_0028510
382 Ga0496104_0246223
383 Ga0496105_0245463
384 Ga0496106_0135662
385 Ga0496108_0040566
386 Ga0496109_0021980
387 Ga0496110_0043863
388 Ga0496111_0014423
389 Ga0496112_0033527
390 Ga0496112_0189086
391 Ga0496114_0302761
392 Ga0501033_0003298
393 Ga0501034_0010357
394 Ga0501034_0103283
395 Ga0501036_0011803
396 Ga0501038_0004113
397 Ga0501038_0032733
398 Ga0501039_0004847
399 Ga0501043_0039543
400 Ga0501047_0064288
401 Ga0501067_0040184
402 Ga0501069_0007347
403 Ga0501069_0065946
404 Ga0501070_0239890
405 Ga0501074_0035492
406 Ga0501081_0031593
407 Ga0501035_0012036
408 Ga0501044_0001923
409 Ga0501044_0004591
410 nmdc:mga03n38_119392_c1
411 nmdc:mga03n38_70649_c1
412 nmdc:mga06z11_39975_c1
413 nmdc:mga04h51_1987_c1
414 nmdc:mga05p37_2287_c1
415 nmdc:mga05p37_296796_c1
416 nmdc:mga05p37_81835_c1
417 nmdc:mga09592_122902_c1
418 nmdc:mga09592_2856_c1
419 nmdc:mga0qj67_128227_c1
420 nmdc:mga0qj67_2264_c1
421 nmdc:mga08y16_2071_c1
422 nmdc:mga0a205_193950_c1
423 nmdc:mga0a205_48745_c1
424 Ga0495619_0027767
425 Ga0500644_0018978
426 Ga0500640_001019
427 Ga0501084_0084417
428 Ga0587079_008051
429 Ga0466962_0037737
430 Ga0530510_0015904
431 2585311902
432 2616699087
433 2643946800
434 2808914799
435 2819745321
436 2862283174
437 2912727113
438 2954382630
439 8008575349
440 8056834646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

114

371

0.84

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

66

335

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nlp-assembly2.cif.gz_B the crystal structure of an abc transporter periplasmic binding protein ydcs from escherichia coli bw25113 0.7981 24 358
4gl0-assembly1.cif.gz_A putative spermidine/putrescine abc transporter from listeria monocytogenes 0.7794 28 357
4gl0-assembly1.cif.gz_A putative spermidine/putrescine abc transporter from listeria monocytogenes 0.7685 28 357
6nlp-assembly2.cif.gz_B the crystal structure of an abc transporter periplasmic binding protein ydcs from escherichia coli bw25113 0.7618 24 358
7xjn-assembly4.cif.gz_D structure of vcpotd1 in complex with norspermidine 0.7508 26 358
ID Description Score Start End Superfamily
af_P76108_147_279_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9336 125 251 3.40.190.10
af_P76108_33_144_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8936 27 118 3.40.190.10
af_P76108_147_279_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8862 125 251 3.40.190.10
af_P0AFK9_132_347_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8283 122 357 3.40.190.10
af_P0AFK9_132_347_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8179 122 357 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1M7MYR2-F1-model_v4 Putative spermidine/putrescine transport system substrate-binding protein 0.9649 15 358
AF-A0A2A8B068-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein 0.963 151 260
AF-A0A1H4NI33-F1-model_v4 deleted 0.9596 19 358
AF-A0A1A9GK26-F1-model_v4 Spermidine/putrescine-binding periplasmic protein 0.948 19 358
AF-A0A2A8B068-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein 0.9462 151 260

Map