F332074

General Info

Members Datasets Scaffolds Average Seq Length
220 162 440 324

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10333281|Ga0070717_103332811
Length 384
Sequence MRSRFYKEASEPNQTIQPTADRCDASLQFMKHVHCKPRSLSLAVADLILVRRNEVHIVRRNTRWSTLLFVVVVCAGTEMPAVTQQYPTKPVLVIEPFGTGGGPDLLARTLAQQLSKLWGQPVRVENVPGAGATAGPAQVAKSPPDGYTLLLTTSAQAYSAVFSKSLPYDPLKDFIPIVPLSSQPYVLVAGKSAGITTVGELIAAAKAKPGQLKFGSTGVGTGTHLGLEKFNLAAGIKAVHSPGGPADAIADVIAHNIAGDTTYMMAPISLALPDIHKGKLRALGVSGARRSSLLPEVPTIAEAGVAGFNFPIWYGVWAPAGTPTGVVDKLVKDIGYVLGGRDLRDWLAKNGGEPMNMTQPEFARFVLSESESAAQIIKAAEIKR

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
109 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
162 2857537821 Achromobacter sp. R-71975 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 5.45
Rhizosphere 86.82
Stem 0
Stem Tuber 0
Unclassified 8.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10333281 3300006028 Unclassified 1354
2 Ga0055536_1008947 3300003781 Bacteria 4222
3 Ga0065712_10092309 3300005290 Bacteria 2336
4 Ga0070658_10016841 3300005327 Bacteria 5850
5 Ga0070676_10103664 3300005328 Bacteria 1761
6 Ga0070677_10017682 3300005333 Bacteria 2557
7 Ga0070666_10110851 3300005335 Unclassified 1898
8 Ga0070691_10025723 3300005341 Bacteria 2742
9 Ga0070661_100100272 3300005344 Bacteria 2153
10 Ga0070668_100501009 3300005347 Bacteria 1051
11 Ga0070669_100245558 3300005353 Bacteria 1424
12 Ga0070674_100002807 3300005356 Bacteria 9632
13 Ga0070673_100385196 3300005364 Bacteria 1251
14 Ga0070713_100137598 3300005436 Bacteria 2160
15 Ga0070710_10008752 3300005437 Plasmid 4936
16 Ga0070700_100138045 3300005441 Bacteria 1653
17 Ga0070678_100179980 3300005456 Bacteria 1730
18 Ga0068867_100021767 3300005459 Bacteria 4577
19 Ga0068867_100086917 3300005459 Bacteria 2366
20 Ga0068867_100335471 3300005459 Bacteria 1257
21 Ga0070698_100215558 3300005471 Bacteria 1854
22 Ga0070697_100027725 3300005536 Bacteria 4532
23 Ga0070672_100129956 3300005543 Bacteria 2069
24 Ga0070686_100275182 3300005544 Bacteria 1239
25 Ga0070695_100043197 3300005545 Bacteria 2865
26 Ga0070665_100010287 3300005548 Bacteria 9467
27 Ga0070702_100235731 3300005615 Bacteria 1232
28 Ga0068859_100552698 3300005617 Bacteria 1246
29 Ga0068866_10009475 3300005718 Bacteria 4136
30 Ga0068861_100095751 3300005719 Bacteria 2352
31 Ga0068861_100182972 3300005719 Bacteria 1746
32 Ga0068860_100032396 3300005843 Bacteria 5022
33 Ga0068862_100068468 3300005844 Bacteria 3062
34 Ga0075363_100026712 3300006048 Bacteria 2955
35 Ga0070712_100083272 3300006175 Bacteria 2322
36 Ga0070712_100220658 3300006175 Bacteria 1501
37 Ga0070712_100323341 3300006175 Bacteria 1255
38 Ga0075362_10068444 3300006177 Bacteria 1617
39 Ga0075366_10016746 3300006195 Bacteria 4215
40 Ga0097621_100248235 3300006237 Bacteria 1558
41 Ga0075370_10073927 3300006353 Bacteria 1953
42 Ga0075428_100001520 3300006844 Bacteria 24799
43 Ga0075428_100006302 3300006844 Bacteria 13189
44 Ga0075428_100117171 3300006844 Bacteria 2901
45 Ga0075428_100341280 3300006844 Bacteria 1608
46 Ga0075430_100000014 3300006846 Bacteria 90404
47 Ga0075430_100008406 3300006846 Bacteria 8716
48 Ga0075430_100009944 3300006846 Bacteria 8046
49 Ga0075431_100260313 3300006847 Bacteria 1760
50 Ga0075434_100000032 3300006871 Bacteria 63711
51 Ga0075429_100002217 3300006880 Bacteria 16266
52 Ga0075429_100050612 3300006880 Bacteria 3614
53 Ga0075429_100059866 3300006880 Bacteria 3318
54 Ga0075436_100056483 3300006914 Bacteria 2711
55 Ga0097620_100552736 3300006931 Bacteria 1246
56 Ga0075435_100136919 3300007076 Bacteria 2052
57 Ga0099795_10079347 3300007788 Bacteria 1253
58 Ga0111539_10003502 3300009094 Bacteria 20702
59 Ga0111539_10015634 3300009094 Bacteria 9436
60 Ga0111539_10103540 3300009094 Bacteria 3340
61 Ga0111539_10413608 3300009094 Bacteria 1571
62 Ga0105245_10556793 3300009098 Bacteria 1169
63 Ga0114129_10020070 3300009147 Bacteria 9511
64 Ga0105243_10170312 3300009148 Bacteria 1885
65 Ga0105242_10078519 3300009176 Unclassified 2756
66 Ga0105242_10187191 3300009176 Bacteria 1830
67 Ga0105248_10065424 3300009177 Unclassified 4082
68 Ga0105249_10135170 3300009553 Bacteria 2359
69 Ga0157374_10067786 3300013296 Unclassified 3356
70 Ga0157378_10304731 3300013297 Unclassified 1543
71 Ga0163162_10010351 3300013306 Bacteria 9065
72 Ga0163162_10028934 3300013306 Bacteria 5484
73 Ga0163162_10151192 3300013306 Bacteria 2439
74 Ga0157380_10121217 3300014326 Bacteria 2215
75 Ga0157380_10266599 3300014326 Bacteria 1559
76 Ga0157380_10602710 3300014326 Bacteria 1087
77 Ga0183362_10008 3300015683 Bacteria 223037
78 Ga0163161_10026851 3300017792 Bacteria 4081
79 Ga0207645_10001883 3300025907 Bacteria 16941
80 Ga0207645_10094095 3300025907 Bacteria 1928
81 Ga0207693_10017149 3300025915 Bacteria 5777
82 Ga0207700_10101602 3300025928 Unclassified 2294
83 Ga0207706_10027387 3300025933 Bacteria 5096
84 Ga0207686_10100125 3300025934 Bacteria 1933
85 Ga0207669_10026240 3300025937 Bacteria 3165
86 Ga0207691_10150736 3300025940 Bacteria 2044
87 Ga0207668_10183902 3300025972 Bacteria 1651
88 Ga0207668_10320583 3300025972 Bacteria 1286
89 Ga0207658_10186042 3300025986 Bacteria 1723
90 Ga0207708_10021817 3300026075 Bacteria 4832
91 Ga0207708_10184637 3300026075 Bacteria 1657
92 Ga0207641_10545899 3300026088 Bacteria 1130
93 Ga0207648_10013718 3300026089 Bacteria 7522
94 Ga0207648_10053179 3300026089 Bacteria 3540
95 Ga0207648_10182333 3300026089 Unclassified 1858
96 Ga0207675_100019435 3300026118 Bacteria 6338
97 Ga0207683_10080975 3300026121 Bacteria 2881
98 Ga0207683_10462107 3300026121 Bacteria 1171
99 Ga0207698_10300110 3300026142 Bacteria 1495
100 Ga0209179_1014585 3300027512 Bacteria 1446
101 Ga0207428_10003077 3300027907 Bacteria 16411
102 Ga0207428_10012720 3300027907 Bacteria 7380
103 Ga0268266_10416716 3300028379 Unclassified 1272
104 Ga0268264_10559861 3300028381 Bacteria 1122
105 Ga0265318_10015905 3300028577 Bacteria 3116
106 Ga0307515_10009209 3300028794 Bacteria 19123
107 Ga0307515_10109241 3300028794 Bacteria 3250
108 Ga0265330_10034828 3300031235 Bacteria 2248
109 Ga0265325_10028878 3300031241 Bacteria 2985
110 Ga0265329_10009404 3300031242 Bacteria 3652
111 Ga0265340_10051493 3300031247 Bacteria 1993
112 Ga0265327_10008944 3300031251 Bacteria 7345
113 Ga0265316_10071650 3300031344 Bacteria 2671
114 Ga0307513_10103877 3300031456 Bacteria 2857
115 Ga0307408_100026539 3300031548 Bacteria 3980
116 Ga0265313_10020510 3300031595 Bacteria 3644
117 Ga0265313_10090901 3300031595 Bacteria 1371
118 Ga0265314_10075963 3300031711 Bacteria 2234
119 Ga0265342_10050847 3300031712 Bacteria 2474
120 Ga0307410_10004843 3300031852 Bacteria 7034
121 Ga0307406_10001568 3300031901 Bacteria 12590
122 Ga0307412_10000379 3300031911 Bacteria 27722
123 Ga0307412_10035905 3300031911 Bacteria 3170
124 Ga0307409_100008407 3300031995 Bacteria 6261
125 Ga0307416_100028557 3300032002 Bacteria 4150
126 Ga0307414_10027086 3300032004 Bacteria 3699
127 Ga0307414_10239427 3300032004 Bacteria 1501
128 Ga0307411_10014943 3300032005 Bacteria 4339
129 Ga0373943_0058772 3300035170 Bacteria 1915
130 Ga0373943_0225741 3300035170 Unclassified 1045
131 Ga0373946_0058676 3300035171 Bacteria 1631
132 Ga0373935_0169567 3300035692 Bacteria 1492
133 Ga0373927_0304215 3300035695 Bacteria 1049
134 Ga0373925_0012675 3300037068 Bacteria 6104
135 Ga0373925_0136468 3300037068 Bacteria 1917
136 Ga0373925_0371125 3300037068 Bacteria 1164
137 Ga0395898_0335037 3300037466 Bacteria 1443
138 Ga0395905_0044208 3300037471 Bacteria 4180
139 Ga0436364_0006977 3300037853 Unclassified 1822
140 Ga0242420_019432 3300038996 Unclassified 1203
141 Ga0436361_0109213 3300039447 Bacteria 1720
142 Ga0439445_0033508 3300042004 Bacteria 1343
143 Ga0450911_000642 3300042115 Bacteria 10478
144 Ga0451577_0117732 3300042876 Bacteria 2380
145 Ga0451577_0343361 3300042876 Bacteria 1354
146 Ga0495629_0186977 3300046459 Bacteria 1434
147 Ga0495653_0209348 3300046463 Bacteria 1318
148 Ga0495650_0002119 3300046471 Bacteria 16976
149 Ga0495650_0003635 3300046471 Bacteria 11087
150 Ga0495580_0036977 3300046472 Unclassified 3505
151 Ga0495580_0124442 3300046472 Bacteria 1789
152 Ga0495582_0124750 3300046473 Bacteria 1452
153 Ga0495582_0240935 3300046473 Bacteria 1036
154 Ga0495662_0057048 3300046476 Bacteria 1886
155 Ga0495664_0088423 3300046477 Bacteria 1862
156 Ga0495643_0014178 3300046522 Bacteria 4748
157 Ga0495643_0047811 3300046522 Bacteria 2315
158 Ga0495652_0197408 3300046529 Bacteria 1530
159 Ga0495665_0059791 3300046531 Bacteria 2012
160 Ga0495640_0021915 3300046533 Bacteria 4680
161 Ga0495640_0031329 3300046533 Bacteria 3796
162 Ga0495640_0260958 3300046533 Unclassified 1083
163 Ga0495645_0088880 3300046543 Bacteria 2209
164 Ga0495645_0211885 3300046543 Bacteria 1308
165 Ga0495667_0238836 3300046559 Bacteria 1158
166 Ga0495656_0045661 3300046615 Bacteria 1850
167 Ga0495656_0160771 3300046615 Bacteria 1091
168 Ga0495634_0090660 3300046642 Bacteria 1985
169 Ga0495634_0105499 3300046642 Bacteria 1817
170 Ga0495635_0120971 3300046663 Bacteria 1786
171 Ga0495588_0012089 3300046674 Bacteria 4070
172 Ga0495599_0207124 3300046678 Bacteria 1204
173 Ga0495658_0048065 3300046683 Bacteria 2404
174 Ga0495670_0022287 3300046691 Unclassified 3127
175 Ga0495670_0075049 3300046691 Bacteria 1716
176 Ga0495636_0014615 3300047318 Bacteria 3123
177 Ga0495674_0021469 3300047319 Bacteria 5972
178 Ga0495674_0177214 3300047319 Bacteria 1776
179 Ga0495681_0129426 3300047470 Bacteria 1076
180 Ga0495684_0175635 3300047471 Bacteria 1590
181 Ga0496100_0096604 3300048903 Bacteria 2027
182 Ga0496101_0000861 3300048904 Bacteria 17921
183 Ga0496102_0048197 3300048905 Bacteria 3874
184 Ga0496103_0070315 3300048906 Bacteria 2189
185 Ga0496104_0107867 3300048907 Unclassified 2668
186 Ga0496104_0184422 3300048907 Bacteria 1997
187 Ga0496105_0006241 3300048908 Bacteria 9150
188 Ga0496105_0062435 3300048908 Unclassified 3074
189 Ga0496107_0036604 3300048910 Bacteria 3520
190 Ga0496108_0042412 3300048911 Bacteria 3798
191 Ga0496115_0074359 3300048918 Bacteria 2759
192 Ga0496121_0009318 3300048924 Bacteria 11323
193 Ga0496124_0101485 3300048927 Bacteria 2331
194 Ga0496125_0008173 3300048928 Bacteria 11015
195 nmdc:mga03683_70322_c1 3300050489 Bacteria 1495
196 nmdc:mga0k408_7130_c1 3300050493 Bacteria 5430
197 nmdc:mga05p37_191741_c1 3300050507 Bacteria 2481
198 nmdc:mga05p37_297294_c1 3300050507 Bacteria 1920
199 nmdc:mga09592_47894_c1 3300050508 Bacteria 3603
200 nmdc:mga09592_675_c1 3300050508 Bacteria 26098
201 nmdc:mga0qj67_11078_c1 3300050509 Bacteria 6751
202 nmdc:mga0qj67_189_c1 3300050509 Bacteria 41860
203 nmdc:mga0qj67_3936_c1 3300050509 Bacteria 10747
204 nmdc:mga08y16_25509_c1 3300050511 Bacteria 6235
205 nmdc:mga08y16_2832_c1 3300050511 Bacteria 17827
206 nmdc:mga0n895_120_c1 3300050512 Bacteria 46697
207 nmdc:mga0n895_88538_c1 3300050512 Bacteria 3096
208 nmdc:mga0rr50_19324_c1 3300050513 Bacteria 4596
209 nmdc:mga0rr50_275740_c1 3300050513 Bacteria 1402
210 nmdc:mga08x19_43934_c1 3300050514 Bacteria 2851
211 nmdc:mga0a205_254187_c1 3300050515 Bacteria 1636
212 Ga0495595_0086516 3300053084 Bacteria 1500
213 Ga0495619_0025535 3300053085 Bacteria 3795
214 Ga0495619_0027189 3300053085 Bacteria 3685
215 Ga0495619_0191097 3300053085 Bacteria 1417
216 Ga0495619_0193243 3300053085 Unclassified 1409
217 Ga0500562_009831 3300053108 Bacteria 2419
218 Ga0500616_0133789 3300053153 Bacteria 1168
219 2599905773 2599185292 Bacteria 6290804
220 2857541105 2857537821 Bacteria 5248181
221 Ga0070717_10333281
222 Ga0055536_1008947
223 Ga0065712_10092309
224 Ga0070658_10016841
225 Ga0070676_10103664
226 Ga0070677_10017682
227 Ga0070666_10110851
228 Ga0070691_10025723
229 Ga0070661_100100272
230 Ga0070668_100501009
231 Ga0070669_100245558
232 Ga0070674_100002807
233 Ga0070673_100385196
234 Ga0070713_100137598
235 Ga0070710_10008752
236 Ga0070700_100138045
237 Ga0070678_100179980
238 Ga0068867_100021767
239 Ga0068867_100086917
240 Ga0068867_100335471
241 Ga0070698_100215558
242 Ga0070697_100027725
243 Ga0070672_100129956
244 Ga0070686_100275182
245 Ga0070695_100043197
246 Ga0070665_100010287
247 Ga0070702_100235731
248 Ga0068859_100552698
249 Ga0068866_10009475
250 Ga0068861_100095751
251 Ga0068861_100182972
252 Ga0068860_100032396
253 Ga0068862_100068468
254 Ga0075363_100026712
255 Ga0070712_100083272
256 Ga0070712_100220658
257 Ga0070712_100323341
258 Ga0075362_10068444
259 Ga0075366_10016746
260 Ga0097621_100248235
261 Ga0075370_10073927
262 Ga0075428_100001520
263 Ga0075428_100006302
264 Ga0075428_100117171
265 Ga0075428_100341280
266 Ga0075430_100000014
267 Ga0075430_100008406
268 Ga0075430_100009944
269 Ga0075431_100260313
270 Ga0075434_100000032
271 Ga0075429_100002217
272 Ga0075429_100050612
273 Ga0075429_100059866
274 Ga0075436_100056483
275 Ga0097620_100552736
276 Ga0075435_100136919
277 Ga0099795_10079347
278 Ga0111539_10003502
279 Ga0111539_10015634
280 Ga0111539_10103540
281 Ga0111539_10413608
282 Ga0105245_10556793
283 Ga0114129_10020070
284 Ga0105243_10170312
285 Ga0105242_10078519
286 Ga0105242_10187191
287 Ga0105248_10065424
288 Ga0105249_10135170
289 Ga0157374_10067786
290 Ga0157378_10304731
291 Ga0163162_10010351
292 Ga0163162_10028934
293 Ga0163162_10151192
294 Ga0157380_10121217
295 Ga0157380_10266599
296 Ga0157380_10602710
297 Ga0183362_10008
298 Ga0163161_10026851
299 Ga0207645_10001883
300 Ga0207645_10094095
301 Ga0207693_10017149
302 Ga0207700_10101602
303 Ga0207706_10027387
304 Ga0207686_10100125
305 Ga0207669_10026240
306 Ga0207691_10150736
307 Ga0207668_10183902
308 Ga0207668_10320583
309 Ga0207658_10186042
310 Ga0207708_10021817
311 Ga0207708_10184637
312 Ga0207641_10545899
313 Ga0207648_10013718
314 Ga0207648_10053179
315 Ga0207648_10182333
316 Ga0207675_100019435
317 Ga0207683_10080975
318 Ga0207683_10462107
319 Ga0207698_10300110
320 Ga0209179_1014585
321 Ga0207428_10003077
322 Ga0207428_10012720
323 Ga0268266_10416716
324 Ga0268264_10559861
325 Ga0265318_10015905
326 Ga0307515_10009209
327 Ga0307515_10109241
328 Ga0265330_10034828
329 Ga0265325_10028878
330 Ga0265329_10009404
331 Ga0265340_10051493
332 Ga0265327_10008944
333 Ga0265316_10071650
334 Ga0307513_10103877
335 Ga0307408_100026539
336 Ga0265313_10020510
337 Ga0265313_10090901
338 Ga0265314_10075963
339 Ga0265342_10050847
340 Ga0307410_10004843
341 Ga0307406_10001568
342 Ga0307412_10000379
343 Ga0307412_10035905
344 Ga0307409_100008407
345 Ga0307416_100028557
346 Ga0307414_10027086
347 Ga0307414_10239427
348 Ga0307411_10014943
349 Ga0373943_0058772
350 Ga0373943_0225741
351 Ga0373946_0058676
352 Ga0373935_0169567
353 Ga0373927_0304215
354 Ga0373925_0012675
355 Ga0373925_0136468
356 Ga0373925_0371125
357 Ga0395898_0335037
358 Ga0395905_0044208
359 Ga0436364_0006977
360 Ga0242420_019432
361 Ga0436361_0109213
362 Ga0439445_0033508
363 Ga0450911_000642
364 Ga0451577_0117732
365 Ga0451577_0343361
366 Ga0495629_0186977
367 Ga0495653_0209348
368 Ga0495650_0002119
369 Ga0495650_0003635
370 Ga0495580_0036977
371 Ga0495580_0124442
372 Ga0495582_0124750
373 Ga0495582_0240935
374 Ga0495662_0057048
375 Ga0495664_0088423
376 Ga0495643_0014178
377 Ga0495643_0047811
378 Ga0495652_0197408
379 Ga0495665_0059791
380 Ga0495640_0021915
381 Ga0495640_0031329
382 Ga0495640_0260958
383 Ga0495645_0088880
384 Ga0495645_0211885
385 Ga0495667_0238836
386 Ga0495656_0045661
387 Ga0495656_0160771
388 Ga0495634_0090660
389 Ga0495634_0105499
390 Ga0495635_0120971
391 Ga0495588_0012089
392 Ga0495599_0207124
393 Ga0495658_0048065
394 Ga0495670_0022287
395 Ga0495670_0075049
396 Ga0495636_0014615
397 Ga0495674_0021469
398 Ga0495674_0177214
399 Ga0495681_0129426
400 Ga0495684_0175635
401 Ga0496100_0096604
402 Ga0496101_0000861
403 Ga0496102_0048197
404 Ga0496103_0070315
405 Ga0496104_0107867
406 Ga0496104_0184422
407 Ga0496105_0006241
408 Ga0496105_0062435
409 Ga0496107_0036604
410 Ga0496108_0042412
411 Ga0496115_0074359
412 Ga0496121_0009318
413 Ga0496124_0101485
414 Ga0496125_0008173
415 nmdc:mga03683_70322_c1
416 nmdc:mga0k408_7130_c1
417 nmdc:mga05p37_191741_c1
418 nmdc:mga05p37_297294_c1
419 nmdc:mga09592_47894_c1
420 nmdc:mga09592_675_c1
421 nmdc:mga0qj67_11078_c1
422 nmdc:mga0qj67_189_c1
423 nmdc:mga0qj67_3936_c1
424 nmdc:mga08y16_25509_c1
425 nmdc:mga08y16_2832_c1
426 nmdc:mga0n895_120_c1
427 nmdc:mga0n895_88538_c1
428 nmdc:mga0rr50_19324_c1
429 nmdc:mga0rr50_275740_c1
430 nmdc:mga08x19_43934_c1
431 nmdc:mga0a205_254187_c1
432 Ga0495595_0086516
433 Ga0495619_0025535
434 Ga0495619_0027189
435 Ga0495619_0191097
436 Ga0495619_0193243
437 Ga0500562_009831
438 Ga0500616_0133789
439 2599905773
440 2857541105

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

106

382

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.959 31 325
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9528 31 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9523 30 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.946 30 325
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9368 34 322
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9513 129 246 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9369 30 325 3.40.190.150
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9361 129 244 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9308 30 325 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9261 30 325 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A4Q2LCI4-F1-model_v4 deleted 0.9739 44 325
AF-A0A157PDM5-F1-model_v4 Putattive exported protein 0.9701 23 325
AF-A0A4Q7NEM1-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9695 29 325
AF-A0A1Q4BAC4-F1-model_v4 ABC transporter substrate-binding protein 0.9694 23 325
AF-A0A2L1CQM3-F1-model_v4 deleted 0.9691 59 325

Map