F331403
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 219 | 109 | 219 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0282551|Ga0451576_0282551_673_1506 |
| Length | 277 |
| Sequence | MWGIIPAAGNGSRIQPLAFSKELLPVGSRTDNGRERPRAVSEYLVDRLLAGGARKLCFVISPSKSDILEYFGAAKLPAASMAFVVQPQPAGLCDAIFQAAPLISWKETVAVGLPDTIWFPEDALALLPAHCLSFLLFPVDHPELFDVVLTDSNLRVLAIQVKPCRPDDHWVWGAFKMPGTVFHQLHAFWRSRGCADEYFGTLINAWISQGGFAQAIRAGKAYVDVGTLHGYREAIRLLNLNPADPRSPSPVFQRIHSSSPPQNRDLYDKQSQDKQTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 12 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 13 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 14 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 15 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 16 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 20 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 21 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 30 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 31 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 32 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 33 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 34 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 35 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 36 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 37 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 38 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 39 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 40 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 63 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 64 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 65 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 66 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 67 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 68 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 69 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 70 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 71 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 72 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 73 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 74 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 75 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 76 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 77 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 78 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 79 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 80 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 81 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 82 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 83 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 84 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 85 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 86 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 87 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 88 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 89 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 90 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 91 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 92 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 93 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 94 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 95 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 96 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 97 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 98 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 100 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 103 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 105 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 106 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 108 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 109 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.35 |
| Metatranscriptomes | 3.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.46 |
| Rhizosphere | 91.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058862_11071456 | 3300004803 | Bacteria | 1587 |
| 2 | Ga0070658_10008140 | 3300005327 | Bacteria | 8432 |
| 3 | Ga0070658_10054436 | 3300005327 | Bacteria | 3249 |
| 4 | Ga0070658_10671567 | 3300005327 | Bacteria | 899 |
| 5 | Ga0070683_100016636 | 3300005329 | Bacteria | 6490 |
| 6 | Ga0070683_100037822 | 3300005329 | Bacteria | 4419 |
| 7 | Ga0070683_100204550 | 3300005329 | Bacteria | 1875 |
| 8 | Ga0070680_100018537 | 3300005336 | Bacteria | 5501 |
| 9 | Ga0070680_100527321 | 3300005336 | Unclassified | 1011 |
| 10 | Ga0070660_100045348 | 3300005339 | Bacteria | 3365 |
| 11 | Ga0070660_100356284 | 3300005339 | Bacteria | 1205 |
| 12 | Ga0070714_100039774 | 3300005435 | Bacteria | 3960 |
| 13 | Ga0070714_100397647 | 3300005435 | Bacteria | 1302 |
| 14 | Ga0070681_10011263 | 3300005458 | Bacteria | 8844 |
| 15 | Ga0070681_10044178 | 3300005458 | Bacteria | 4459 |
| 16 | Ga0070681_10764616 | 3300005458 | Unclassified | 883 |
| 17 | Ga0070679_100021610 | 3300005530 | Bacteria | 6284 |
| 18 | Ga0070679_100108417 | 3300005530 | Bacteria | 2763 |
| 19 | Ga0070679_100185943 | 3300005530 | Bacteria | 2048 |
| 20 | Ga0070684_100391867 | 3300005535 | Bacteria | 1280 |
| 21 | Ga0070665_100000770 | 3300005548 | Bacteria | 42271 |
| 22 | Ga0070665_100001718 | 3300005548 | Bacteria | 25109 |
| 23 | Ga0068855_100002742 | 3300005563 | Bacteria | 21688 |
| 24 | Ga0068855_100017094 | 3300005563 | Bacteria | 8726 |
| 25 | Ga0068855_100018498 | 3300005563 | Bacteria | 8376 |
| 26 | Ga0068854_100000167 | 3300005578 | Bacteria | 44527 |
| 27 | Ga0068854_100067135 | 3300005578 | Bacteria | 2612 |
| 28 | Ga0068856_100002433 | 3300005614 | Bacteria | 19150 |
| 29 | Ga0068856_100010418 | 3300005614 | Bacteria | 9027 |
| 30 | Ga0068856_100186460 | 3300005614 | Bacteria | 2088 |
| 31 | Ga0068852_100005404 | 3300005616 | Bacteria | 9139 |
| 32 | Ga0068852_100006026 | 3300005616 | Bacteria | 8734 |
| 33 | Ga0068852_100021835 | 3300005616 | Bacteria | 5121 |
| 34 | Ga0068852_100681798 | 3300005616 | Viruses | 1037 |
| 35 | Ga0068858_100662334 | 3300005842 | Bacteria | 1015 |
| 36 | Ga0081540_1111494 | 3300005983 | Bacteria | 1155 |
| 37 | Ga0070716_100155891 | 3300006173 | Unclassified | 1474 |
| 38 | Ga0070712_100152395 | 3300006175 | Bacteria | 1776 |
| 39 | Ga0075433_10782726 | 3300006852 | Unclassified | 834 |
| 40 | Ga0075436_100067034 | 3300006914 | Bacteria | 2481 |
| 41 | Ga0105240_10002868 | 3300009093 | Bacteria | 27261 |
| 42 | Ga0105240_10009070 | 3300009093 | Bacteria | 14120 |
| 43 | Ga0105240_10013817 | 3300009093 | Bacteria | 11060 |
| 44 | Ga0105240_10035763 | 3300009093 | Bacteria | 6397 |
| 45 | Ga0105240_10577840 | 3300009093 | Bacteria | 1240 |
| 46 | Ga0105237_10032594 | 3300009545 | Bacteria | 5275 |
| 47 | Ga0105238_10014587 | 3300009551 | Bacteria | 7944 |
| 48 | Ga0105238_10461504 | 3300009551 | Bacteria | 1268 |
| 49 | Ga0157371_10011176 | 3300013102 | Bacteria | 6944 |
| 50 | Ga0157371_10107625 | 3300013102 | Bacteria | 1978 |
| 51 | Ga0157371_10151225 | 3300013102 | Viruses | 1656 |
| 52 | Ga0157371_10235699 | 3300013102 | Bacteria | 1316 |
| 53 | Ga0157370_10030278 | 3300013104 | Bacteria | 5304 |
| 54 | Ga0157370_10144273 | 3300013104 | Bacteria | 2217 |
| 55 | Ga0157370_10279324 | 3300013104 | Viruses | 1543 |
| 56 | Ga0157370_10724881 | 3300013104 | Bacteria | 907 |
| 57 | Ga0157369_10000185 | 3300013105 | Bacteria | 86285 |
| 58 | Ga0157369_10027707 | 3300013105 | Bacteria | 6277 |
| 59 | Ga0157369_10106175 | 3300013105 | Viruses | 2989 |
| 60 | Ga0157369_10153284 | 3300013105 | Bacteria | 2435 |
| 61 | Ga0157369_10161090 | 3300013105 | Bacteria | 2368 |
| 62 | Ga0157374_10060798 | 3300013296 | Bacteria | 3536 |
| 63 | Ga0157372_10000422 | 3300013307 | Bacteria | 46497 |
| 64 | Ga0157372_10065548 | 3300013307 | Bacteria | 4079 |
| 65 | Ga0157372_10141765 | 3300013307 | Bacteria | 2770 |
| 66 | Ga0157372_10736556 | 3300013307 | Bacteria | 1146 |
| 67 | Ga0182008_10198377 | 3300014497 | Bacteria | 1020 |
| 68 | Ga0206356_11197868 | 3300020070 | Bacteria | 1095 |
| 69 | Ga0206349_1212209 | 3300020075 | Bacteria | 1376 |
| 70 | Ga0206352_10547726 | 3300020078 | Bacteria | 1123 |
| 71 | Ga0206350_10481610 | 3300020080 | Bacteria | 1747 |
| 72 | Ga0206354_11079401 | 3300020081 | Bacteria | 1281 |
| 73 | Ga0206353_11244424 | 3300020082 | Bacteria | 1184 |
| 74 | Ga0213872_10062075 | 3300021361 | Unclassified | 1689 |
| 75 | Ga0213875_10001220 | 3300021388 | Bacteria | 17409 |
| 76 | Ga0213875_10001754 | 3300021388 | Bacteria | 13607 |
| 77 | Ga0213875_10006079 | 3300021388 | Bacteria | 6386 |
| 78 | Ga0213875_10062057 | 3300021388 | Bacteria | 1748 |
| 79 | Ga0213871_10021904 | 3300021441 | Bacteria | 1597 |
| 80 | Ga0224712_10033272 | 3300022467 | Bacteria | 1885 |
| 81 | Ga0207692_10157213 | 3300025898 | Bacteria | 1307 |
| 82 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 83 | Ga0207707_10011452 | 3300025912 | Bacteria | 7724 |
| 84 | Ga0207707_10118559 | 3300025912 | Bacteria | 2313 |
| 85 | Ga0207707_10544012 | 3300025912 | Bacteria | 987 |
| 86 | Ga0207695_10003374 | 3300025913 | Bacteria | 22563 |
| 87 | Ga0207695_10006107 | 3300025913 | Bacteria | 15714 |
| 88 | Ga0207695_10017989 | 3300025913 | Bacteria | 8184 |
| 89 | Ga0207695_10020139 | 3300025913 | Bacteria | 7651 |
| 90 | Ga0207695_10021494 | 3300025913 | Bacteria | 7360 |
| 91 | Ga0207695_10114154 | 3300025913 | Bacteria | 2677 |
| 92 | Ga0207695_10223570 | 3300025913 | Bacteria | 1789 |
| 93 | Ga0207671_10019404 | 3300025914 | Bacteria | 5198 |
| 94 | Ga0207693_10016207 | 3300025915 | Bacteria | 5958 |
| 95 | Ga0207663_10514930 | 3300025916 | Unclassified | 931 |
| 96 | Ga0207660_10176477 | 3300025917 | Bacteria | 1657 |
| 97 | Ga0207660_10458941 | 3300025917 | Unclassified | 1031 |
| 98 | Ga0207662_10390153 | 3300025918 | Bacteria | 942 |
| 99 | Ga0207657_10010380 | 3300025919 | Bacteria | 9295 |
| 100 | Ga0207657_10044180 | 3300025919 | Bacteria | 3918 |
| 101 | Ga0207649_10000453 | 3300025920 | Bacteria | 29524 |
| 102 | Ga0207652_10006209 | 3300025921 | Bacteria | 9650 |
| 103 | Ga0207652_10153382 | 3300025921 | Bacteria | 2063 |
| 104 | Ga0207664_10085413 | 3300025929 | Bacteria | 2576 |
| 105 | Ga0207664_10361859 | 3300025929 | Bacteria | 1285 |
| 106 | Ga0207690_10188333 | 3300025932 | Bacteria | 1559 |
| 107 | Ga0207661_10038230 | 3300025944 | Bacteria | 3760 |
| 108 | Ga0207661_10053926 | 3300025944 | Bacteria | 3220 |
| 109 | Ga0207667_10000056 | 3300025949 | Bacteria | 206107 |
| 110 | Ga0207667_10015424 | 3300025949 | Bacteria | 8682 |
| 111 | Ga0207667_10028038 | 3300025949 | Bacteria | 6119 |
| 112 | Ga0207640_10000214 | 3300025981 | Bacteria | 40794 |
| 113 | Ga0207640_10209653 | 3300025981 | Bacteria | 1483 |
| 114 | Ga0207703_10535765 | 3300026035 | Bacteria | 1103 |
| 115 | Ga0207702_10010211 | 3300026078 | Bacteria | 7860 |
| 116 | Ga0207702_10013523 | 3300026078 | Bacteria | 6778 |
| 117 | Ga0207702_10029415 | 3300026078 | Bacteria | 4571 |
| 118 | Ga0207674_10157023 | 3300026116 | Bacteria | 2230 |
| 119 | Ga0207674_10634820 | 3300026116 | Bacteria | 1031 |
| 120 | Ga0207698_10002233 | 3300026142 | Bacteria | 11449 |
| 121 | Ga0207698_10009102 | 3300026142 | Bacteria | 6310 |
| 122 | Ga0207698_10159937 | 3300026142 | Bacteria | 1968 |
| 123 | Ga0268266_10001989 | 3300028379 | Bacteria | 22898 |
| 124 | Ga0307405_10024027 | 3300031731 | Bacteria | 3475 |
| 125 | Ga0307410_10163388 | 3300031852 | Bacteria | 1671 |
| 126 | Ga0307406_10262326 | 3300031901 | Bacteria | 1308 |
| 127 | Ga0307409_100003845 | 3300031995 | Bacteria | 8290 |
| 128 | Ga0307416_100006103 | 3300032002 | Bacteria | 7504 |
| 129 | Ga0307414_10071147 | 3300032004 | Bacteria | 2508 |
| 130 | Ga0307415_100003156 | 3300032126 | Bacteria | 8348 |
| 131 | Ga0373955_0177944 | 3300035172 | Unclassified | 1261 |
| 132 | Ga0373931_0121294 | 3300035691 | Bacteria | 1495 |
| 133 | Ga0373933_0002985 | 3300035724 | Bacteria | 9435 |
| 134 | Ga0373937_0001567 | 3300036401 | Bacteria | 19206 |
| 135 | Ga0395899_0018450 | 3300037312 | Bacteria | 5305 |
| 136 | Ga0395899_0124673 | 3300037312 | Bacteria | 1842 |
| 137 | Ga0395900_0002171 | 3300037418 | Bacteria | 21928 |
| 138 | Ga0395900_0071035 | 3300037418 | Bacteria | 3578 |
| 139 | Ga0395900_0198171 | 3300037418 | Bacteria | 2033 |
| 140 | Ga0395900_0222338 | 3300037418 | Bacteria | 1902 |
| 141 | Ga0395900_0509017 | 3300037418 | Bacteria | 1153 |
| 142 | Ga0395898_0004090 | 3300037466 | Bacteria | 15998 |
| 143 | Ga0395898_0017328 | 3300037466 | Bacteria | 7359 |
| 144 | Ga0395898_0203524 | 3300037466 | Bacteria | 1889 |
| 145 | Ga0436364_0316960 | 3300037853 | Bacteria | 32502 |
| 146 | Ga0436364_0323479 | 3300037853 | Bacteria | 7219 |
| 147 | Ga0436364_0558108 | 3300037853 | Bacteria | 39499 |
| 148 | Ga0436364_0813052 | 3300037853 | Unclassified | 1089 |
| 149 | Ga0436364_1319090 | 3300037853 | Unclassified | 1469 |
| 150 | Ga0436364_1525175 | 3300037853 | Bacteria | 4136 |
| 151 | Ga0395901_0027083 | 3300038443 | Bacteria | 5887 |
| 152 | Ga0395901_0291839 | 3300038443 | Bacteria | 1692 |
| 153 | Ga0436365_0599706 | 3300039437 | Unclassified | 914 |
| 154 | Ga0436365_0964494 | 3300039437 | Bacteria | 3217 |
| 155 | Ga0436365_1724341 | 3300039437 | Bacteria | 1177 |
| 156 | Ga0436360_1303967 | 3300039438 | Bacteria | 5583 |
| 157 | Ga0436361_0951432 | 3300039447 | Bacteria | 1878 |
| 158 | Ga0436363_0083527 | 3300039450 | Bacteria | 1446 |
| 159 | Ga0436363_0613160 | 3300039450 | Bacteria | 2078 |
| 160 | Ga0436363_0725166 | 3300039450 | Bacteria | 1515 |
| 161 | Ga0436363_0833814 | 3300039450 | Bacteria | 1064 |
| 162 | Ga0436363_0835129 | 3300039450 | Bacteria | 3814 |
| 163 | Ga0436362_0319887 | 3300039453 | Bacteria | 1994 |
| 164 | Ga0436362_0966250 | 3300039453 | Bacteria | 2015 |
| 165 | Ga0436362_1020558 | 3300039453 | Unclassified | 1223 |
| 166 | Ga0466969_0001783 | 3300044656 | Bacteria | 11466 |
| 167 | Ga0466969_0002474 | 3300044656 | Bacteria | 9865 |
| 168 | Ga0466969_0003665 | 3300044656 | Bacteria | 8176 |
| 169 | Ga0466966_0000004 | 3300044684 | Bacteria | 223594 |
| 170 | Ga0466966_0003294 | 3300044684 | Bacteria | 10652 |
| 171 | Ga0466966_0007902 | 3300044684 | Bacteria | 7040 |
| 172 | Ga0466966_0056013 | 3300044684 | Bacteria | 2495 |
| 173 | Ga0466966_0112172 | 3300044684 | Bacteria | 1680 |
| 174 | Ga0466961_0006535 | 3300044693 | Bacteria | 7413 |
| 175 | Ga0466961_0014194 | 3300044693 | Bacteria | 5112 |
| 176 | Ga0466961_0092813 | 3300044693 | Bacteria | 1905 |
| 177 | Ga0466961_0453550 | 3300044693 | Bacteria | 776 |
| 178 | Ga0466963_0016810 | 3300044694 | Bacteria | 4553 |
| 179 | Ga0466963_0034900 | 3300044694 | Unclassified | 3275 |
| 180 | Ga0466963_0252474 | 3300044694 | Bacteria | 1238 |
| 181 | Ga0466964_0001603 | 3300044706 | Bacteria | 7802 |
| 182 | Ga0466964_0054081 | 3300044706 | Bacteria | 1654 |
| 183 | Ga0453684_0008472 | 3300044712 | Bacteria | 18398 |
| 184 | Ga0453684_0141948 | 3300044712 | Bacteria | 2866 |
| 185 | Ga0466971_0000372 | 3300044719 | Bacteria | 17205 |
| 186 | Ga0466971_0004944 | 3300044719 | Bacteria | 5766 |
| 187 | Ga0466968_0013990 | 3300044735 | Bacteria | 3165 |
| 188 | Ga0466970_0004876 | 3300044765 | Bacteria | 6624 |
| 189 | Ga0466970_0007982 | 3300044765 | Bacteria | 5316 |
| 190 | Ga0466970_0088113 | 3300044765 | Bacteria | 1683 |
| 191 | Ga0466957_0040246 | 3300044842 | Bacteria | 2822 |
| 192 | Ga0466957_0079349 | 3300044842 | Bacteria | 2042 |
| 193 | Ga0466960_0011940 | 3300044901 | Bacteria | 3654 |
| 194 | Ga0466959_0003179 | 3300045049 | Bacteria | 10664 |
| 195 | Ga0466959_0009739 | 3300045049 | Bacteria | 6844 |
| 196 | Ga0466959_0040215 | 3300045049 | Bacteria | 3455 |
| 197 | Ga0466959_0098684 | 3300045049 | Bacteria | 2092 |
| 198 | Ga0466959_0373759 | 3300045049 | Unclassified | 970 |
| 199 | Ga0451576_0282551 | 3300045051 | Unclassified | 1735 |
| 200 | Ga0466958_0003649 | 3300045836 | Bacteria | 8031 |
| 201 | Ga0466958_0042109 | 3300045836 | Bacteria | 2749 |
| 202 | Ga0466958_0052379 | 3300045836 | Bacteria | 2474 |
| 203 | Ga0466958_0100084 | 3300045836 | Bacteria | 1801 |
| 204 | Ga0466967_0182376 | 3300045976 | Bacteria | 1981 |
| 205 | Ga0466967_0239076 | 3300045976 | Bacteria | 1732 |
| 206 | Ga0495592_0112165 | 3300046454 | Bacteria | 1928 |
| 207 | Ga0496113_0591048 | 3300048916 | Bacteria | 889 |
| 208 | Ga0501034_0020493 | 3300049571 | Bacteria | 6752 |
| 209 | Ga0501043_0017274 | 3300049579 | Bacteria | 5660 |
| 210 | Ga0501048_0291213 | 3300049582 | Bacteria | 1161 |
| 211 | Ga0501035_0000485 | 3300049822 | Bacteria | 44767 |
| 212 | Ga0501035_0193660 | 3300049822 | Bacteria | 1747 |
| 213 | Ga0501044_0010982 | 3300049823 | Bacteria | 9830 |
| 214 | nmdc:mga0a205_957294_c1 | 3300050515 | Unclassified | 703 |
| 215 | Ga0495619_0011701 | 3300053085 | Bacteria | 5528 |
| 216 | Ga0590075_015318 | 3300059424 | Bacteria | 1881 |
| 217 | Ga0590077_034878 | 3300059426 | Bacteria | 1107 |
| 218 | Ga0466962_0004939 | 3300061719 | Bacteria | 6414 |
| 219 | Ga0466962_0009337 | 3300061719 | Bacteria | 4698 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025917 | Ga0207660_10458941 | Ga0207660_104589411 | 200 |
| 2 | 3300044693 | Ga0466961_0453550 | Ga0466961_0453550_145_759 | 200 |
| 3 | 3300048916 | Ga0496113_0591048 | Ga0496113_0591048_226_879 | 200 |
| 4 | 3300039453 | Ga0436362_1020558 | Ga0436362_1020558_569_1207 | 203 |
| 5 | 3300050515 | nmdc:mga0a205_957294_c1 | nmdc:mga0a205_957294_c1_27_665 | 203 |
| 6 | 3300044712 | Ga0453684_0141948 | Ga0453684_0141948_1214_1999 | 221 |
| 7 | 3300005329 | Ga0070683_100204550 | Ga0070683_1002045501 | 223 |
| 8 | 3300005458 | Ga0070681_10011263 | Ga0070681_100112635 | 223 |
| 9 | 3300025944 | Ga0207661_10038230 | Ga0207661_100382303 | 223 |
| 10 | 3300037853 | Ga0436364_1319090 | Ga0436364_1319090_19_705 | 227 |
| 11 | 3300039437 | Ga0436365_0599706 | Ga0436365_0599706_185_901 | 231 |
| 12 | 3300044712 | Ga0453684_0008472 | Ga0453684_0008472_2683_3459 | 232 |
| 13 | 3300005329 | Ga0070683_100037822 | Ga0070683_1000378223 | 238 |
| 14 | 3300049571 | Ga0501034_0020493 | Ga0501034_0020493_1082_1828 | 238 |
| 15 | 3300005329 | Ga0070683_100016636 | Ga0070683_1000166365 | 241 |
| 16 | 3300009093 | Ga0105240_10009070 | Ga0105240_100090705 | 241 |
| 17 | 3300025913 | Ga0207695_10017989 | Ga0207695_100179895 | 241 |
| 18 | 3300025944 | Ga0207661_10053926 | Ga0207661_100539262 | 241 |
| 19 | 3300005548 | Ga0070665_100001718 | Ga0070665_10000171812 | 243 |
| 20 | 3300006914 | Ga0075436_100067034 | Ga0075436_1000670342 | 243 |
| 21 | 3300028379 | Ga0268266_10001989 | Ga0268266_100019899 | 243 |
| 22 | 3300005336 | Ga0070680_100018537 | Ga0070680_1000185375 | 244 |
| 23 | 3300005563 | Ga0068855_100002742 | Ga0068855_10000274218 | 244 |
| 24 | 3300009093 | Ga0105240_10013817 | Ga0105240_100138174 | 244 |
| 25 | 3300009545 | Ga0105237_10032594 | Ga0105237_100325945 | 244 |
| 26 | 3300009551 | Ga0105238_10461504 | Ga0105238_104615042 | 244 |
| 27 | 3300013307 | Ga0157372_10736556 | Ga0157372_107365562 | 244 |
| 28 | 3300021441 | Ga0213871_10021904 | Ga0213871_100219042 | 244 |
| 29 | 3300025913 | Ga0207695_10020139 | Ga0207695_100201397 | 244 |
| 30 | 3300025913 | Ga0207695_10021494 | Ga0207695_100214941 | 244 |
| 31 | 3300025914 | Ga0207671_10019404 | Ga0207671_100194042 | 244 |
| 32 | 3300025949 | Ga0207667_10028038 | Ga0207667_100280382 | 244 |
| 33 | 3300039438 | Ga0436360_1303967 | Ga0436360_1303967_937_1671 | 244 |
| 34 | 3300039450 | Ga0436363_0725166 | Ga0436363_0725166_315_1049 | 244 |
| 35 | 3300039453 | Ga0436362_0319887 | Ga0436362_0319887_629_1363 | 244 |
| 36 | 3300044656 | Ga0466969_0002474 | Ga0466969_0002474_5036_5791 | 244 |
| 37 | 3300044684 | Ga0466966_0056013 | Ga0466966_0056013_1240_1995 | 244 |
| 38 | 3300044693 | Ga0466961_0092813 | Ga0466961_0092813_180_938 | 244 |
| 39 | 3300044765 | Ga0466970_0088113 | Ga0466970_0088113_567_1322 | 244 |
| 40 | 3300044901 | Ga0466960_0011940 | Ga0466960_0011940_75_809 | 244 |
| 41 | 3300045049 | Ga0466959_0373759 | Ga0466959_0373759_120_875 | 244 |
| 42 | 3300045836 | Ga0466958_0100084 | Ga0466958_0100084_90_854 | 244 |
| 43 | 3300049579 | Ga0501043_0017274 | Ga0501043_0017274_4702_5487 | 244 |
| 44 | 3300049822 | Ga0501035_0193660 | Ga0501035_0193660_876_1661 | 244 |
| 45 | 3300049823 | Ga0501044_0010982 | Ga0501044_0010982_6174_6959 | 244 |
| 46 | 3300005339 | Ga0070660_100356284 | Ga0070660_1003562841 | 245 |
| 47 | 3300005435 | Ga0070714_100397647 | Ga0070714_1003976472 | 245 |
| 48 | 3300005530 | Ga0070679_100185943 | Ga0070679_1001859431 | 245 |
| 49 | 3300005563 | Ga0068855_100017094 | Ga0068855_1000170946 | 245 |
| 50 | 3300005578 | Ga0068854_100000167 | Ga0068854_10000016736 | 245 |
| 51 | 3300005578 | Ga0068854_100067135 | Ga0068854_1000671352 | 245 |
| 52 | 3300005614 | Ga0068856_100010418 | Ga0068856_1000104186 | 245 |
| 53 | 3300005614 | Ga0068856_100186460 | Ga0068856_1001864602 | 245 |
| 54 | 3300005616 | Ga0068852_100005404 | Ga0068852_1000054049 | 245 |
| 55 | 3300005616 | Ga0068852_100021835 | Ga0068852_1000218352 | 245 |
| 56 | 3300005616 | Ga0068852_100681798 | Ga0068852_1006817981 | 245 |
| 57 | 3300009093 | Ga0105240_10002868 | Ga0105240_1000286812 | 245 |
| 58 | 3300009093 | Ga0105240_10577840 | Ga0105240_105778401 | 245 |
| 59 | 3300009551 | Ga0105238_10014587 | Ga0105238_100145874 | 245 |
| 60 | 3300013102 | Ga0157371_10011176 | Ga0157371_100111766 | 245 |
| 61 | 3300013102 | Ga0157371_10107625 | Ga0157371_101076252 | 245 |
| 62 | 3300013102 | Ga0157371_10151225 | Ga0157371_101512252 | 245 |
| 63 | 3300013102 | Ga0157371_10235699 | Ga0157371_102356992 | 245 |
| 64 | 3300013104 | Ga0157370_10144273 | Ga0157370_101442732 | 245 |
| 65 | 3300013104 | Ga0157370_10279324 | Ga0157370_102793242 | 245 |
| 66 | 3300013104 | Ga0157370_10724881 | Ga0157370_107248812 | 245 |
| 67 | 3300013105 | Ga0157369_10000185 | Ga0157369_1000018543 | 245 |
| 68 | 3300013105 | Ga0157369_10027707 | Ga0157369_100277074 | 245 |
| 69 | 3300013105 | Ga0157369_10106175 | Ga0157369_101061753 | 245 |
| 70 | 3300013105 | Ga0157369_10153284 | Ga0157369_101532842 | 245 |
| 71 | 3300013307 | Ga0157372_10065548 | Ga0157372_100655482 | 245 |
| 72 | 3300013307 | Ga0157372_10141765 | Ga0157372_101417652 | 245 |
| 73 | 3300025909 | Ga0207705_10000003 | Ga0207705_10000003241 | 245 |
| 74 | 3300025913 | Ga0207695_10003374 | Ga0207695_100033745 | 245 |
| 75 | 3300025913 | Ga0207695_10114154 | Ga0207695_101141542 | 245 |
| 76 | 3300025919 | Ga0207657_10044180 | Ga0207657_100441802 | 245 |
| 77 | 3300025920 | Ga0207649_10000453 | Ga0207649_1000045318 | 245 |
| 78 | 3300025921 | Ga0207652_10153382 | Ga0207652_101533822 | 245 |
| 79 | 3300025929 | Ga0207664_10085413 | Ga0207664_100854131 | 245 |
| 80 | 3300025949 | Ga0207667_10015424 | Ga0207667_100154246 | 245 |
| 81 | 3300025981 | Ga0207640_10000214 | Ga0207640_1000021436 | 245 |
| 82 | 3300025981 | Ga0207640_10209653 | Ga0207640_102096532 | 245 |
| 83 | 3300026078 | Ga0207702_10010211 | Ga0207702_100102119 | 245 |
| 84 | 3300026078 | Ga0207702_10029415 | Ga0207702_100294152 | 245 |
| 85 | 3300026116 | Ga0207674_10634820 | Ga0207674_106348202 | 245 |
| 86 | 3300026142 | Ga0207698_10002233 | Ga0207698_100022336 | 245 |
| 87 | 3300026142 | Ga0207698_10159937 | Ga0207698_101599372 | 245 |
| 88 | 3300037312 | Ga0395899_0018450 | Ga0395899_0018450_3554_4300 | 245 |
| 89 | 3300037312 | Ga0395899_0124673 | Ga0395899_0124673_274_1020 | 245 |
| 90 | 3300037418 | Ga0395900_0002171 | Ga0395900_0002171_4854_5600 | 245 |
| 91 | 3300037418 | Ga0395900_0071035 | Ga0395900_0071035_2125_2871 | 245 |
| 92 | 3300037418 | Ga0395900_0198171 | Ga0395900_0198171_899_1645 | 245 |
| 93 | 3300037418 | Ga0395900_0222338 | Ga0395900_0222338_517_1263 | 245 |
| 94 | 3300037418 | Ga0395900_0509017 | Ga0395900_0509017_27_773 | 245 |
| 95 | 3300037466 | Ga0395898_0017328 | Ga0395898_0017328_4854_5600 | 245 |
| 96 | 3300038443 | Ga0395901_0027083 | Ga0395901_0027083_3409_4155 | 245 |
| 97 | 3300038443 | Ga0395901_0291839 | Ga0395901_0291839_630_1376 | 245 |
| 98 | 3300044656 | Ga0466969_0003665 | Ga0466969_0003665_5745_6491 | 245 |
| 99 | 3300044684 | Ga0466966_0000004 | Ga0466966_0000004_36564_37310 | 245 |
| 100 | 3300044684 | Ga0466966_0007902 | Ga0466966_0007902_1112_1858 | 245 |
| 101 | 3300044684 | Ga0466966_0112172 | Ga0466966_0112172_382_1128 | 245 |
| 102 | 3300044693 | Ga0466961_0014194 | Ga0466961_0014194_2227_2973 | 245 |
| 103 | 3300044694 | Ga0466963_0016810 | Ga0466963_0016810_600_1346 | 245 |
| 104 | 3300044706 | Ga0466964_0054081 | Ga0466964_0054081_56_802 | 245 |
| 105 | 3300044719 | Ga0466971_0004944 | Ga0466971_0004944_1112_1858 | 245 |
| 106 | 3300044765 | Ga0466970_0007982 | Ga0466970_0007982_742_1488 | 245 |
| 107 | 3300044842 | Ga0466957_0040246 | Ga0466957_0040246_2062_2808 | 245 |
| 108 | 3300045049 | Ga0466959_0003179 | Ga0466959_0003179_2231_2977 | 245 |
| 109 | 3300045836 | Ga0466958_0003649 | Ga0466958_0003649_5713_6459 | 245 |
| 110 | 3300045836 | Ga0466958_0052379 | Ga0466958_0052379_1116_1862 | 245 |
| 111 | 3300061719 | Ga0466962_0009337 | Ga0466962_0009337_1006_1752 | 245 |
| 112 | 3300005530 | Ga0070679_100108417 | Ga0070679_1001084173 | 247 |
| 113 | 3300021388 | Ga0213875_10006079 | Ga0213875_100060798 | 247 |
| 114 | 3300021388 | Ga0213875_10062057 | Ga0213875_100620572 | 247 |
| 115 | 3300025912 | Ga0207707_10118559 | Ga0207707_101185593 | 247 |
| 116 | 3300025913 | Ga0207695_10223570 | Ga0207695_102235702 | 247 |
| 117 | 3300025917 | Ga0207660_10176477 | Ga0207660_101764771 | 247 |
| 118 | 3300037466 | Ga0395898_0004090 | Ga0395898_0004090_7889_8644 | 247 |
| 119 | 3300037466 | Ga0395898_0203524 | Ga0395898_0203524_43_798 | 247 |
| 120 | 3300037853 | Ga0436364_0323479 | Ga0436364_0323479_6157_6900 | 247 |
| 121 | 3300039450 | Ga0436363_0835129 | Ga0436363_0835129_2223_2981 | 247 |
| 122 | 3300044656 | Ga0466969_0001783 | Ga0466969_0001783_10442_11194 | 247 |
| 123 | 3300044684 | Ga0466966_0003294 | Ga0466966_0003294_1408_2160 | 247 |
| 124 | 3300044693 | Ga0466961_0006535 | Ga0466961_0006535_2996_3748 | 247 |
| 125 | 3300044706 | Ga0466964_0001603 | Ga0466964_0001603_5049_5801 | 247 |
| 126 | 3300044719 | Ga0466971_0000372 | Ga0466971_0000372_3930_4682 | 247 |
| 127 | 3300044735 | Ga0466968_0013990 | Ga0466968_0013990_1890_2642 | 247 |
| 128 | 3300044765 | Ga0466970_0004876 | Ga0466970_0004876_2580_3332 | 247 |
| 129 | 3300044842 | Ga0466957_0079349 | Ga0466957_0079349_316_1068 | 247 |
| 130 | 3300045049 | Ga0466959_0009739 | Ga0466959_0009739_3855_4607 | 247 |
| 131 | 3300045049 | Ga0466959_0040215 | Ga0466959_0040215_422_1177 | 247 |
| 132 | 3300045049 | Ga0466959_0098684 | Ga0466959_0098684_452_1207 | 247 |
| 133 | 3300045836 | Ga0466958_0042109 | Ga0466958_0042109_1702_2454 | 247 |
| 134 | 3300045976 | Ga0466967_0182376 | Ga0466967_0182376_585_1340 | 247 |
| 135 | 3300061719 | Ga0466962_0004939 | Ga0466962_0004939_901_1653 | 247 |
| 136 | 3300037853 | Ga0436364_0813052 | Ga0436364_0813052_220_975 | 248 |
| 137 | 3300044694 | Ga0466963_0034900 | Ga0466963_0034900_662_1417 | 248 |
| 138 | 3300049822 | Ga0501035_0000485 | Ga0501035_0000485_28537_29310 | 248 |
| 139 | 3300005548 | Ga0070665_100000770 | Ga0070665_10000077017 | 249 |
| 140 | 3300005983 | Ga0081540_1111494 | Ga0081540_11114942 | 249 |
| 141 | 3300006173 | Ga0070716_100155891 | Ga0070716_1001558912 | 249 |
| 142 | 3300013296 | Ga0157374_10060798 | Ga0157374_100607982 | 249 |
| 143 | 3300031731 | Ga0307405_10024027 | Ga0307405_100240272 | 249 |
| 144 | 3300031995 | Ga0307409_100003845 | Ga0307409_1000038454 | 249 |
| 145 | 3300032002 | Ga0307416_100006103 | Ga0307416_1000061035 | 249 |
| 146 | 3300032004 | Ga0307414_10071147 | Ga0307414_100711473 | 249 |
| 147 | 3300032126 | Ga0307415_100003156 | Ga0307415_1000031568 | 249 |
| 148 | 3300059424 | Ga0590075_015318 | Ga0590075_015318_258_1007 | 249 |
| 149 | 3300059426 | Ga0590077_034878 | Ga0590077_034878_244_993 | 249 |
| 150 | 3300005435 | Ga0070714_100039774 | Ga0070714_1000397742 | 250 |
| 151 | 3300005458 | Ga0070681_10764616 | Ga0070681_107646161 | 250 |
| 152 | 3300005842 | Ga0068858_100662334 | Ga0068858_1006623342 | 250 |
| 153 | 3300006175 | Ga0070712_100152395 | Ga0070712_1001523952 | 250 |
| 154 | 3300006852 | Ga0075433_10782726 | Ga0075433_107827261 | 250 |
| 155 | 3300025898 | Ga0207692_10157213 | Ga0207692_101572132 | 250 |
| 156 | 3300025912 | Ga0207707_10544012 | Ga0207707_105440121 | 250 |
| 157 | 3300025915 | Ga0207693_10016207 | Ga0207693_100162075 | 250 |
| 158 | 3300025916 | Ga0207663_10514930 | Ga0207663_105149301 | 250 |
| 159 | 3300025918 | Ga0207662_10390153 | Ga0207662_103901532 | 250 |
| 160 | 3300025929 | Ga0207664_10361859 | Ga0207664_103618592 | 250 |
| 161 | 3300026035 | Ga0207703_10535765 | Ga0207703_105357652 | 250 |
| 162 | 3300035691 | Ga0373931_0121294 | Ga0373931_0121294_25_804 | 250 |
| 163 | 3300039437 | Ga0436365_1724341 | Ga0436365_1724341_120_899 | 250 |
| 164 | 3300039447 | Ga0436361_0951432 | Ga0436361_0951432_374_1153 | 250 |
| 165 | 3300039450 | Ga0436363_0083527 | Ga0436363_0083527_379_1155 | 250 |
| 166 | 3300039450 | Ga0436363_0833814 | Ga0436363_0833814_160_939 | 250 |
| 167 | 3300039453 | Ga0436362_0966250 | Ga0436362_0966250_796_1575 | 250 |
| 168 | 3300044694 | Ga0466963_0252474 | Ga0466963_0252474_303_1082 | 250 |
| 169 | 3300045976 | Ga0466967_0239076 | Ga0466967_0239076_412_1191 | 250 |
| 170 | 3300039437 | Ga0436365_0964494 | Ga0436365_0964494_458_1219 | 252 |
| 171 | 3300039450 | Ga0436363_0613160 | Ga0436363_0613160_833_1594 | 252 |
| 172 | 3300005327 | Ga0070658_10671567 | Ga0070658_106715671 | 253 |
| 173 | 3300035172 | Ga0373955_0177944 | Ga0373955_0177944_219_1001 | 253 |
| 174 | 3300035724 | Ga0373933_0002985 | Ga0373933_0002985_1684_2466 | 253 |
| 175 | 3300036401 | Ga0373937_0001567 | Ga0373937_0001567_7036_7818 | 253 |
| 176 | 3300046454 | Ga0495592_0112165 | Ga0495592_0112165_141_923 | 253 |
| 177 | 3300049582 | Ga0501048_0291213 | Ga0501048_0291213_381_1142 | 253 |
| 178 | 3300053085 | Ga0495619_0011701 | Ga0495619_0011701_3869_4651 | 253 |
| 179 | 3300014497 | Ga0182008_10198377 | Ga0182008_101983771 | 255 |
| 180 | 3300025932 | Ga0207690_10188333 | Ga0207690_101883332 | 255 |
| 181 | 3300031901 | Ga0307406_10262326 | Ga0307406_102623261 | 256 |
| 182 | 3300037853 | Ga0436364_1525175 | Ga0436364_1525175_775_1557 | 257 |
| 183 | 3300005327 | Ga0070658_10008140 | Ga0070658_100081403 | 258 |
| 184 | 3300021388 | Ga0213875_10001220 | Ga0213875_1000122015 | 258 |
| 185 | 3300021388 | Ga0213875_10001754 | Ga0213875_1000175413 | 258 |
| 186 | 3300031852 | Ga0307410_10163388 | Ga0307410_101633882 | 258 |
| 187 | 3300037853 | Ga0436364_0316960 | Ga0436364_0316960_10753_11556 | 258 |
| 188 | 3300037853 | Ga0436364_0558108 | Ga0436364_0558108_22170_22961 | 258 |
| 189 | 3300021361 | Ga0213872_10062075 | Ga0213872_100620752 | 260 |
| 190 | 3300045051 | Ga0451576_0282551 | Ga0451576_0282551_673_1506 | 260 |
| 191 | 3300004803 | Ga0058862_11071456 | Ga0058862_110714561 | 265 |
| 192 | 3300005327 | Ga0070658_10054436 | Ga0070658_100544363 | 265 |
| 193 | 3300005336 | Ga0070680_100527321 | Ga0070680_1005273211 | 265 |
| 194 | 3300005339 | Ga0070660_100045348 | Ga0070660_1000453482 | 265 |
| 195 | 3300005458 | Ga0070681_10044178 | Ga0070681_100441783 | 265 |
| 196 | 3300005530 | Ga0070679_100021610 | Ga0070679_1000216106 | 265 |
| 197 | 3300005535 | Ga0070684_100391867 | Ga0070684_1003918671 | 265 |
| 198 | 3300005563 | Ga0068855_100018498 | Ga0068855_1000184987 | 265 |
| 199 | 3300005614 | Ga0068856_100002433 | Ga0068856_1000024336 | 265 |
| 200 | 3300005616 | Ga0068852_100006026 | Ga0068852_1000060262 | 265 |
| 201 | 3300009093 | Ga0105240_10035763 | Ga0105240_100357633 | 265 |
| 202 | 3300013104 | Ga0157370_10030278 | Ga0157370_100302785 | 265 |
| 203 | 3300013105 | Ga0157369_10161090 | Ga0157369_101610903 | 265 |
| 204 | 3300013307 | Ga0157372_10000422 | Ga0157372_1000042214 | 265 |
| 205 | 3300020070 | Ga0206356_11197868 | Ga0206356_111978682 | 265 |
| 206 | 3300020075 | Ga0206349_1212209 | Ga0206349_12122092 | 265 |
| 207 | 3300020078 | Ga0206352_10547726 | Ga0206352_105477262 | 265 |
| 208 | 3300020080 | Ga0206350_10481610 | Ga0206350_104816103 | 265 |
| 209 | 3300020081 | Ga0206354_11079401 | Ga0206354_110794012 | 265 |
| 210 | 3300020082 | Ga0206353_11244424 | Ga0206353_112444242 | 265 |
| 211 | 3300022467 | Ga0224712_10033272 | Ga0224712_100332721 | 265 |
| 212 | 3300025912 | Ga0207707_10011452 | Ga0207707_100114524 | 265 |
| 213 | 3300025913 | Ga0207695_10006107 | Ga0207695_100061074 | 265 |
| 214 | 3300025919 | Ga0207657_10010380 | Ga0207657_100103809 | 265 |
| 215 | 3300025921 | Ga0207652_10006209 | Ga0207652_100062094 | 265 |
| 216 | 3300025949 | Ga0207667_10000056 | Ga0207667_1000005687 | 265 |
| 217 | 3300026078 | Ga0207702_10013523 | Ga0207702_100135232 | 265 |
| 218 | 3300026116 | Ga0207674_10157023 | Ga0207674_101570233 | 265 |
| 219 | 3300026142 | Ga0207698_10009102 | Ga0207698_100091027 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z0a-assembly2.cif.gz_C-3 | st0452(y97n)-glcnac binding form | 0.8584 | 1 | 242 |
| 2ggo-assembly1.cif.gz_A | crystal structure of glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii | 0.8564 | 1 | 242 |
| 3hl3-assembly1.cif.gz_A | 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose. | 0.8515 | 1 | 236 |
| 3pkq-assembly3.cif.gz_C | q83d variant of s. enterica rmla with dgtp | 0.8512 | 1 | 239 |
| 4hoc-assembly2.cif.gz_B | crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n-acetylglucosamine | 0.8473 | 1 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8768 | 1 | 224 | 3.90.550.10 |
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.869 | 1 | 224 | 3.90.550.10 |
| af_L7N6A5_2_240_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8436 | 2 | 241 | 3.90.550.10 |
| af_Q8ILP1_1_241_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8379 | 1 | 243 | 3.90.550.10 |
| 4ecmA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8288 | 3 | 250 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3XZ33-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9884 | 2 | 240 |
GO:0008879
GO:0045226 |
| AF-A0A3D3G9K3-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9871 | 2 | 242 |
GO:0008879
GO:0045226 |
| AF-F5XX04-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9869 | 27 | 240 |
GO:0008879
GO:0045226 |
| AF-A0A4P2Q7N9-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9855 | 1 | 242 |
GO:0008879
GO:0045226 |
| AF-A0A1G7D1R8-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9854 | 1 | 243 |
GO:0008879
GO:0045226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar