F331403

General Info

Members Datasets Scaffolds Average Seq Length
219 109 219 252

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0282551|Ga0451576_0282551_673_1506
Length 277
Sequence MWGIIPAAGNGSRIQPLAFSKELLPVGSRTDNGRERPRAVSEYLVDRLLAGGARKLCFVISPSKSDILEYFGAAKLPAASMAFVVQPQPAGLCDAIFQAAPLISWKETVAVGLPDTIWFPEDALALLPAHCLSFLLFPVDHPELFDVVLTDSNLRVLAIQVKPCRPDDHWVWGAFKMPGTVFHQLHAFWRSRGCADEYFGTLINAWISQGGFAQAIRAGKAYVDVGTLHGYREAIRLLNLNPADPRSPSPVFQRIHSSSPPQNRDLYDKQSQDKQTE

Samples

Sample ID Description Type Environment
1 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
39 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
108 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
109 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 3.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.46
Rhizosphere 91.32
Stem 0
Stem Tuber 0
Unclassified 8.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_11071456 3300004803 Bacteria 1587
2 Ga0070658_10008140 3300005327 Bacteria 8432
3 Ga0070658_10054436 3300005327 Bacteria 3249
4 Ga0070658_10671567 3300005327 Bacteria 899
5 Ga0070683_100016636 3300005329 Bacteria 6490
6 Ga0070683_100037822 3300005329 Bacteria 4419
7 Ga0070683_100204550 3300005329 Bacteria 1875
8 Ga0070680_100018537 3300005336 Bacteria 5501
9 Ga0070680_100527321 3300005336 Unclassified 1011
10 Ga0070660_100045348 3300005339 Bacteria 3365
11 Ga0070660_100356284 3300005339 Bacteria 1205
12 Ga0070714_100039774 3300005435 Bacteria 3960
13 Ga0070714_100397647 3300005435 Bacteria 1302
14 Ga0070681_10011263 3300005458 Bacteria 8844
15 Ga0070681_10044178 3300005458 Bacteria 4459
16 Ga0070681_10764616 3300005458 Unclassified 883
17 Ga0070679_100021610 3300005530 Bacteria 6284
18 Ga0070679_100108417 3300005530 Bacteria 2763
19 Ga0070679_100185943 3300005530 Bacteria 2048
20 Ga0070684_100391867 3300005535 Bacteria 1280
21 Ga0070665_100000770 3300005548 Bacteria 42271
22 Ga0070665_100001718 3300005548 Bacteria 25109
23 Ga0068855_100002742 3300005563 Bacteria 21688
24 Ga0068855_100017094 3300005563 Bacteria 8726
25 Ga0068855_100018498 3300005563 Bacteria 8376
26 Ga0068854_100000167 3300005578 Bacteria 44527
27 Ga0068854_100067135 3300005578 Bacteria 2612
28 Ga0068856_100002433 3300005614 Bacteria 19150
29 Ga0068856_100010418 3300005614 Bacteria 9027
30 Ga0068856_100186460 3300005614 Bacteria 2088
31 Ga0068852_100005404 3300005616 Bacteria 9139
32 Ga0068852_100006026 3300005616 Bacteria 8734
33 Ga0068852_100021835 3300005616 Bacteria 5121
34 Ga0068852_100681798 3300005616 Viruses 1037
35 Ga0068858_100662334 3300005842 Bacteria 1015
36 Ga0081540_1111494 3300005983 Bacteria 1155
37 Ga0070716_100155891 3300006173 Unclassified 1474
38 Ga0070712_100152395 3300006175 Bacteria 1776
39 Ga0075433_10782726 3300006852 Unclassified 834
40 Ga0075436_100067034 3300006914 Bacteria 2481
41 Ga0105240_10002868 3300009093 Bacteria 27261
42 Ga0105240_10009070 3300009093 Bacteria 14120
43 Ga0105240_10013817 3300009093 Bacteria 11060
44 Ga0105240_10035763 3300009093 Bacteria 6397
45 Ga0105240_10577840 3300009093 Bacteria 1240
46 Ga0105237_10032594 3300009545 Bacteria 5275
47 Ga0105238_10014587 3300009551 Bacteria 7944
48 Ga0105238_10461504 3300009551 Bacteria 1268
49 Ga0157371_10011176 3300013102 Bacteria 6944
50 Ga0157371_10107625 3300013102 Bacteria 1978
51 Ga0157371_10151225 3300013102 Viruses 1656
52 Ga0157371_10235699 3300013102 Bacteria 1316
53 Ga0157370_10030278 3300013104 Bacteria 5304
54 Ga0157370_10144273 3300013104 Bacteria 2217
55 Ga0157370_10279324 3300013104 Viruses 1543
56 Ga0157370_10724881 3300013104 Bacteria 907
57 Ga0157369_10000185 3300013105 Bacteria 86285
58 Ga0157369_10027707 3300013105 Bacteria 6277
59 Ga0157369_10106175 3300013105 Viruses 2989
60 Ga0157369_10153284 3300013105 Bacteria 2435
61 Ga0157369_10161090 3300013105 Bacteria 2368
62 Ga0157374_10060798 3300013296 Bacteria 3536
63 Ga0157372_10000422 3300013307 Bacteria 46497
64 Ga0157372_10065548 3300013307 Bacteria 4079
65 Ga0157372_10141765 3300013307 Bacteria 2770
66 Ga0157372_10736556 3300013307 Bacteria 1146
67 Ga0182008_10198377 3300014497 Bacteria 1020
68 Ga0206356_11197868 3300020070 Bacteria 1095
69 Ga0206349_1212209 3300020075 Bacteria 1376
70 Ga0206352_10547726 3300020078 Bacteria 1123
71 Ga0206350_10481610 3300020080 Bacteria 1747
72 Ga0206354_11079401 3300020081 Bacteria 1281
73 Ga0206353_11244424 3300020082 Bacteria 1184
74 Ga0213872_10062075 3300021361 Unclassified 1689
75 Ga0213875_10001220 3300021388 Bacteria 17409
76 Ga0213875_10001754 3300021388 Bacteria 13607
77 Ga0213875_10006079 3300021388 Bacteria 6386
78 Ga0213875_10062057 3300021388 Bacteria 1748
79 Ga0213871_10021904 3300021441 Bacteria 1597
80 Ga0224712_10033272 3300022467 Bacteria 1885
81 Ga0207692_10157213 3300025898 Bacteria 1307
82 Ga0207705_10000003 3300025909 Bacteria 709270
83 Ga0207707_10011452 3300025912 Bacteria 7724
84 Ga0207707_10118559 3300025912 Bacteria 2313
85 Ga0207707_10544012 3300025912 Bacteria 987
86 Ga0207695_10003374 3300025913 Bacteria 22563
87 Ga0207695_10006107 3300025913 Bacteria 15714
88 Ga0207695_10017989 3300025913 Bacteria 8184
89 Ga0207695_10020139 3300025913 Bacteria 7651
90 Ga0207695_10021494 3300025913 Bacteria 7360
91 Ga0207695_10114154 3300025913 Bacteria 2677
92 Ga0207695_10223570 3300025913 Bacteria 1789
93 Ga0207671_10019404 3300025914 Bacteria 5198
94 Ga0207693_10016207 3300025915 Bacteria 5958
95 Ga0207663_10514930 3300025916 Unclassified 931
96 Ga0207660_10176477 3300025917 Bacteria 1657
97 Ga0207660_10458941 3300025917 Unclassified 1031
98 Ga0207662_10390153 3300025918 Bacteria 942
99 Ga0207657_10010380 3300025919 Bacteria 9295
100 Ga0207657_10044180 3300025919 Bacteria 3918
101 Ga0207649_10000453 3300025920 Bacteria 29524
102 Ga0207652_10006209 3300025921 Bacteria 9650
103 Ga0207652_10153382 3300025921 Bacteria 2063
104 Ga0207664_10085413 3300025929 Bacteria 2576
105 Ga0207664_10361859 3300025929 Bacteria 1285
106 Ga0207690_10188333 3300025932 Bacteria 1559
107 Ga0207661_10038230 3300025944 Bacteria 3760
108 Ga0207661_10053926 3300025944 Bacteria 3220
109 Ga0207667_10000056 3300025949 Bacteria 206107
110 Ga0207667_10015424 3300025949 Bacteria 8682
111 Ga0207667_10028038 3300025949 Bacteria 6119
112 Ga0207640_10000214 3300025981 Bacteria 40794
113 Ga0207640_10209653 3300025981 Bacteria 1483
114 Ga0207703_10535765 3300026035 Bacteria 1103
115 Ga0207702_10010211 3300026078 Bacteria 7860
116 Ga0207702_10013523 3300026078 Bacteria 6778
117 Ga0207702_10029415 3300026078 Bacteria 4571
118 Ga0207674_10157023 3300026116 Bacteria 2230
119 Ga0207674_10634820 3300026116 Bacteria 1031
120 Ga0207698_10002233 3300026142 Bacteria 11449
121 Ga0207698_10009102 3300026142 Bacteria 6310
122 Ga0207698_10159937 3300026142 Bacteria 1968
123 Ga0268266_10001989 3300028379 Bacteria 22898
124 Ga0307405_10024027 3300031731 Bacteria 3475
125 Ga0307410_10163388 3300031852 Bacteria 1671
126 Ga0307406_10262326 3300031901 Bacteria 1308
127 Ga0307409_100003845 3300031995 Bacteria 8290
128 Ga0307416_100006103 3300032002 Bacteria 7504
129 Ga0307414_10071147 3300032004 Bacteria 2508
130 Ga0307415_100003156 3300032126 Bacteria 8348
131 Ga0373955_0177944 3300035172 Unclassified 1261
132 Ga0373931_0121294 3300035691 Bacteria 1495
133 Ga0373933_0002985 3300035724 Bacteria 9435
134 Ga0373937_0001567 3300036401 Bacteria 19206
135 Ga0395899_0018450 3300037312 Bacteria 5305
136 Ga0395899_0124673 3300037312 Bacteria 1842
137 Ga0395900_0002171 3300037418 Bacteria 21928
138 Ga0395900_0071035 3300037418 Bacteria 3578
139 Ga0395900_0198171 3300037418 Bacteria 2033
140 Ga0395900_0222338 3300037418 Bacteria 1902
141 Ga0395900_0509017 3300037418 Bacteria 1153
142 Ga0395898_0004090 3300037466 Bacteria 15998
143 Ga0395898_0017328 3300037466 Bacteria 7359
144 Ga0395898_0203524 3300037466 Bacteria 1889
145 Ga0436364_0316960 3300037853 Bacteria 32502
146 Ga0436364_0323479 3300037853 Bacteria 7219
147 Ga0436364_0558108 3300037853 Bacteria 39499
148 Ga0436364_0813052 3300037853 Unclassified 1089
149 Ga0436364_1319090 3300037853 Unclassified 1469
150 Ga0436364_1525175 3300037853 Bacteria 4136
151 Ga0395901_0027083 3300038443 Bacteria 5887
152 Ga0395901_0291839 3300038443 Bacteria 1692
153 Ga0436365_0599706 3300039437 Unclassified 914
154 Ga0436365_0964494 3300039437 Bacteria 3217
155 Ga0436365_1724341 3300039437 Bacteria 1177
156 Ga0436360_1303967 3300039438 Bacteria 5583
157 Ga0436361_0951432 3300039447 Bacteria 1878
158 Ga0436363_0083527 3300039450 Bacteria 1446
159 Ga0436363_0613160 3300039450 Bacteria 2078
160 Ga0436363_0725166 3300039450 Bacteria 1515
161 Ga0436363_0833814 3300039450 Bacteria 1064
162 Ga0436363_0835129 3300039450 Bacteria 3814
163 Ga0436362_0319887 3300039453 Bacteria 1994
164 Ga0436362_0966250 3300039453 Bacteria 2015
165 Ga0436362_1020558 3300039453 Unclassified 1223
166 Ga0466969_0001783 3300044656 Bacteria 11466
167 Ga0466969_0002474 3300044656 Bacteria 9865
168 Ga0466969_0003665 3300044656 Bacteria 8176
169 Ga0466966_0000004 3300044684 Bacteria 223594
170 Ga0466966_0003294 3300044684 Bacteria 10652
171 Ga0466966_0007902 3300044684 Bacteria 7040
172 Ga0466966_0056013 3300044684 Bacteria 2495
173 Ga0466966_0112172 3300044684 Bacteria 1680
174 Ga0466961_0006535 3300044693 Bacteria 7413
175 Ga0466961_0014194 3300044693 Bacteria 5112
176 Ga0466961_0092813 3300044693 Bacteria 1905
177 Ga0466961_0453550 3300044693 Bacteria 776
178 Ga0466963_0016810 3300044694 Bacteria 4553
179 Ga0466963_0034900 3300044694 Unclassified 3275
180 Ga0466963_0252474 3300044694 Bacteria 1238
181 Ga0466964_0001603 3300044706 Bacteria 7802
182 Ga0466964_0054081 3300044706 Bacteria 1654
183 Ga0453684_0008472 3300044712 Bacteria 18398
184 Ga0453684_0141948 3300044712 Bacteria 2866
185 Ga0466971_0000372 3300044719 Bacteria 17205
186 Ga0466971_0004944 3300044719 Bacteria 5766
187 Ga0466968_0013990 3300044735 Bacteria 3165
188 Ga0466970_0004876 3300044765 Bacteria 6624
189 Ga0466970_0007982 3300044765 Bacteria 5316
190 Ga0466970_0088113 3300044765 Bacteria 1683
191 Ga0466957_0040246 3300044842 Bacteria 2822
192 Ga0466957_0079349 3300044842 Bacteria 2042
193 Ga0466960_0011940 3300044901 Bacteria 3654
194 Ga0466959_0003179 3300045049 Bacteria 10664
195 Ga0466959_0009739 3300045049 Bacteria 6844
196 Ga0466959_0040215 3300045049 Bacteria 3455
197 Ga0466959_0098684 3300045049 Bacteria 2092
198 Ga0466959_0373759 3300045049 Unclassified 970
199 Ga0451576_0282551 3300045051 Unclassified 1735
200 Ga0466958_0003649 3300045836 Bacteria 8031
201 Ga0466958_0042109 3300045836 Bacteria 2749
202 Ga0466958_0052379 3300045836 Bacteria 2474
203 Ga0466958_0100084 3300045836 Bacteria 1801
204 Ga0466967_0182376 3300045976 Bacteria 1981
205 Ga0466967_0239076 3300045976 Bacteria 1732
206 Ga0495592_0112165 3300046454 Bacteria 1928
207 Ga0496113_0591048 3300048916 Bacteria 889
208 Ga0501034_0020493 3300049571 Bacteria 6752
209 Ga0501043_0017274 3300049579 Bacteria 5660
210 Ga0501048_0291213 3300049582 Bacteria 1161
211 Ga0501035_0000485 3300049822 Bacteria 44767
212 Ga0501035_0193660 3300049822 Bacteria 1747
213 Ga0501044_0010982 3300049823 Bacteria 9830
214 nmdc:mga0a205_957294_c1 3300050515 Unclassified 703
215 Ga0495619_0011701 3300053085 Bacteria 5528
216 Ga0590075_015318 3300059424 Bacteria 1881
217 Ga0590077_034878 3300059426 Bacteria 1107
218 Ga0466962_0004939 3300061719 Bacteria 6414
219 Ga0466962_0009337 3300061719 Bacteria 4698

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025917 Ga0207660_10458941 Ga0207660_104589411 200
2 3300044693 Ga0466961_0453550 Ga0466961_0453550_145_759 200
3 3300048916 Ga0496113_0591048 Ga0496113_0591048_226_879 200
4 3300039453 Ga0436362_1020558 Ga0436362_1020558_569_1207 203
5 3300050515 nmdc:mga0a205_957294_c1 nmdc:mga0a205_957294_c1_27_665 203
6 3300044712 Ga0453684_0141948 Ga0453684_0141948_1214_1999 221
7 3300005329 Ga0070683_100204550 Ga0070683_1002045501 223
8 3300005458 Ga0070681_10011263 Ga0070681_100112635 223
9 3300025944 Ga0207661_10038230 Ga0207661_100382303 223
10 3300037853 Ga0436364_1319090 Ga0436364_1319090_19_705 227
11 3300039437 Ga0436365_0599706 Ga0436365_0599706_185_901 231
12 3300044712 Ga0453684_0008472 Ga0453684_0008472_2683_3459 232
13 3300005329 Ga0070683_100037822 Ga0070683_1000378223 238
14 3300049571 Ga0501034_0020493 Ga0501034_0020493_1082_1828 238
15 3300005329 Ga0070683_100016636 Ga0070683_1000166365 241
16 3300009093 Ga0105240_10009070 Ga0105240_100090705 241
17 3300025913 Ga0207695_10017989 Ga0207695_100179895 241
18 3300025944 Ga0207661_10053926 Ga0207661_100539262 241
19 3300005548 Ga0070665_100001718 Ga0070665_10000171812 243
20 3300006914 Ga0075436_100067034 Ga0075436_1000670342 243
21 3300028379 Ga0268266_10001989 Ga0268266_100019899 243
22 3300005336 Ga0070680_100018537 Ga0070680_1000185375 244
23 3300005563 Ga0068855_100002742 Ga0068855_10000274218 244
24 3300009093 Ga0105240_10013817 Ga0105240_100138174 244
25 3300009545 Ga0105237_10032594 Ga0105237_100325945 244
26 3300009551 Ga0105238_10461504 Ga0105238_104615042 244
27 3300013307 Ga0157372_10736556 Ga0157372_107365562 244
28 3300021441 Ga0213871_10021904 Ga0213871_100219042 244
29 3300025913 Ga0207695_10020139 Ga0207695_100201397 244
30 3300025913 Ga0207695_10021494 Ga0207695_100214941 244
31 3300025914 Ga0207671_10019404 Ga0207671_100194042 244
32 3300025949 Ga0207667_10028038 Ga0207667_100280382 244
33 3300039438 Ga0436360_1303967 Ga0436360_1303967_937_1671 244
34 3300039450 Ga0436363_0725166 Ga0436363_0725166_315_1049 244
35 3300039453 Ga0436362_0319887 Ga0436362_0319887_629_1363 244
36 3300044656 Ga0466969_0002474 Ga0466969_0002474_5036_5791 244
37 3300044684 Ga0466966_0056013 Ga0466966_0056013_1240_1995 244
38 3300044693 Ga0466961_0092813 Ga0466961_0092813_180_938 244
39 3300044765 Ga0466970_0088113 Ga0466970_0088113_567_1322 244
40 3300044901 Ga0466960_0011940 Ga0466960_0011940_75_809 244
41 3300045049 Ga0466959_0373759 Ga0466959_0373759_120_875 244
42 3300045836 Ga0466958_0100084 Ga0466958_0100084_90_854 244
43 3300049579 Ga0501043_0017274 Ga0501043_0017274_4702_5487 244
44 3300049822 Ga0501035_0193660 Ga0501035_0193660_876_1661 244
45 3300049823 Ga0501044_0010982 Ga0501044_0010982_6174_6959 244
46 3300005339 Ga0070660_100356284 Ga0070660_1003562841 245
47 3300005435 Ga0070714_100397647 Ga0070714_1003976472 245
48 3300005530 Ga0070679_100185943 Ga0070679_1001859431 245
49 3300005563 Ga0068855_100017094 Ga0068855_1000170946 245
50 3300005578 Ga0068854_100000167 Ga0068854_10000016736 245
51 3300005578 Ga0068854_100067135 Ga0068854_1000671352 245
52 3300005614 Ga0068856_100010418 Ga0068856_1000104186 245
53 3300005614 Ga0068856_100186460 Ga0068856_1001864602 245
54 3300005616 Ga0068852_100005404 Ga0068852_1000054049 245
55 3300005616 Ga0068852_100021835 Ga0068852_1000218352 245
56 3300005616 Ga0068852_100681798 Ga0068852_1006817981 245
57 3300009093 Ga0105240_10002868 Ga0105240_1000286812 245
58 3300009093 Ga0105240_10577840 Ga0105240_105778401 245
59 3300009551 Ga0105238_10014587 Ga0105238_100145874 245
60 3300013102 Ga0157371_10011176 Ga0157371_100111766 245
61 3300013102 Ga0157371_10107625 Ga0157371_101076252 245
62 3300013102 Ga0157371_10151225 Ga0157371_101512252 245
63 3300013102 Ga0157371_10235699 Ga0157371_102356992 245
64 3300013104 Ga0157370_10144273 Ga0157370_101442732 245
65 3300013104 Ga0157370_10279324 Ga0157370_102793242 245
66 3300013104 Ga0157370_10724881 Ga0157370_107248812 245
67 3300013105 Ga0157369_10000185 Ga0157369_1000018543 245
68 3300013105 Ga0157369_10027707 Ga0157369_100277074 245
69 3300013105 Ga0157369_10106175 Ga0157369_101061753 245
70 3300013105 Ga0157369_10153284 Ga0157369_101532842 245
71 3300013307 Ga0157372_10065548 Ga0157372_100655482 245
72 3300013307 Ga0157372_10141765 Ga0157372_101417652 245
73 3300025909 Ga0207705_10000003 Ga0207705_10000003241 245
74 3300025913 Ga0207695_10003374 Ga0207695_100033745 245
75 3300025913 Ga0207695_10114154 Ga0207695_101141542 245
76 3300025919 Ga0207657_10044180 Ga0207657_100441802 245
77 3300025920 Ga0207649_10000453 Ga0207649_1000045318 245
78 3300025921 Ga0207652_10153382 Ga0207652_101533822 245
79 3300025929 Ga0207664_10085413 Ga0207664_100854131 245
80 3300025949 Ga0207667_10015424 Ga0207667_100154246 245
81 3300025981 Ga0207640_10000214 Ga0207640_1000021436 245
82 3300025981 Ga0207640_10209653 Ga0207640_102096532 245
83 3300026078 Ga0207702_10010211 Ga0207702_100102119 245
84 3300026078 Ga0207702_10029415 Ga0207702_100294152 245
85 3300026116 Ga0207674_10634820 Ga0207674_106348202 245
86 3300026142 Ga0207698_10002233 Ga0207698_100022336 245
87 3300026142 Ga0207698_10159937 Ga0207698_101599372 245
88 3300037312 Ga0395899_0018450 Ga0395899_0018450_3554_4300 245
89 3300037312 Ga0395899_0124673 Ga0395899_0124673_274_1020 245
90 3300037418 Ga0395900_0002171 Ga0395900_0002171_4854_5600 245
91 3300037418 Ga0395900_0071035 Ga0395900_0071035_2125_2871 245
92 3300037418 Ga0395900_0198171 Ga0395900_0198171_899_1645 245
93 3300037418 Ga0395900_0222338 Ga0395900_0222338_517_1263 245
94 3300037418 Ga0395900_0509017 Ga0395900_0509017_27_773 245
95 3300037466 Ga0395898_0017328 Ga0395898_0017328_4854_5600 245
96 3300038443 Ga0395901_0027083 Ga0395901_0027083_3409_4155 245
97 3300038443 Ga0395901_0291839 Ga0395901_0291839_630_1376 245
98 3300044656 Ga0466969_0003665 Ga0466969_0003665_5745_6491 245
99 3300044684 Ga0466966_0000004 Ga0466966_0000004_36564_37310 245
100 3300044684 Ga0466966_0007902 Ga0466966_0007902_1112_1858 245
101 3300044684 Ga0466966_0112172 Ga0466966_0112172_382_1128 245
102 3300044693 Ga0466961_0014194 Ga0466961_0014194_2227_2973 245
103 3300044694 Ga0466963_0016810 Ga0466963_0016810_600_1346 245
104 3300044706 Ga0466964_0054081 Ga0466964_0054081_56_802 245
105 3300044719 Ga0466971_0004944 Ga0466971_0004944_1112_1858 245
106 3300044765 Ga0466970_0007982 Ga0466970_0007982_742_1488 245
107 3300044842 Ga0466957_0040246 Ga0466957_0040246_2062_2808 245
108 3300045049 Ga0466959_0003179 Ga0466959_0003179_2231_2977 245
109 3300045836 Ga0466958_0003649 Ga0466958_0003649_5713_6459 245
110 3300045836 Ga0466958_0052379 Ga0466958_0052379_1116_1862 245
111 3300061719 Ga0466962_0009337 Ga0466962_0009337_1006_1752 245
112 3300005530 Ga0070679_100108417 Ga0070679_1001084173 247
113 3300021388 Ga0213875_10006079 Ga0213875_100060798 247
114 3300021388 Ga0213875_10062057 Ga0213875_100620572 247
115 3300025912 Ga0207707_10118559 Ga0207707_101185593 247
116 3300025913 Ga0207695_10223570 Ga0207695_102235702 247
117 3300025917 Ga0207660_10176477 Ga0207660_101764771 247
118 3300037466 Ga0395898_0004090 Ga0395898_0004090_7889_8644 247
119 3300037466 Ga0395898_0203524 Ga0395898_0203524_43_798 247
120 3300037853 Ga0436364_0323479 Ga0436364_0323479_6157_6900 247
121 3300039450 Ga0436363_0835129 Ga0436363_0835129_2223_2981 247
122 3300044656 Ga0466969_0001783 Ga0466969_0001783_10442_11194 247
123 3300044684 Ga0466966_0003294 Ga0466966_0003294_1408_2160 247
124 3300044693 Ga0466961_0006535 Ga0466961_0006535_2996_3748 247
125 3300044706 Ga0466964_0001603 Ga0466964_0001603_5049_5801 247
126 3300044719 Ga0466971_0000372 Ga0466971_0000372_3930_4682 247
127 3300044735 Ga0466968_0013990 Ga0466968_0013990_1890_2642 247
128 3300044765 Ga0466970_0004876 Ga0466970_0004876_2580_3332 247
129 3300044842 Ga0466957_0079349 Ga0466957_0079349_316_1068 247
130 3300045049 Ga0466959_0009739 Ga0466959_0009739_3855_4607 247
131 3300045049 Ga0466959_0040215 Ga0466959_0040215_422_1177 247
132 3300045049 Ga0466959_0098684 Ga0466959_0098684_452_1207 247
133 3300045836 Ga0466958_0042109 Ga0466958_0042109_1702_2454 247
134 3300045976 Ga0466967_0182376 Ga0466967_0182376_585_1340 247
135 3300061719 Ga0466962_0004939 Ga0466962_0004939_901_1653 247
136 3300037853 Ga0436364_0813052 Ga0436364_0813052_220_975 248
137 3300044694 Ga0466963_0034900 Ga0466963_0034900_662_1417 248
138 3300049822 Ga0501035_0000485 Ga0501035_0000485_28537_29310 248
139 3300005548 Ga0070665_100000770 Ga0070665_10000077017 249
140 3300005983 Ga0081540_1111494 Ga0081540_11114942 249
141 3300006173 Ga0070716_100155891 Ga0070716_1001558912 249
142 3300013296 Ga0157374_10060798 Ga0157374_100607982 249
143 3300031731 Ga0307405_10024027 Ga0307405_100240272 249
144 3300031995 Ga0307409_100003845 Ga0307409_1000038454 249
145 3300032002 Ga0307416_100006103 Ga0307416_1000061035 249
146 3300032004 Ga0307414_10071147 Ga0307414_100711473 249
147 3300032126 Ga0307415_100003156 Ga0307415_1000031568 249
148 3300059424 Ga0590075_015318 Ga0590075_015318_258_1007 249
149 3300059426 Ga0590077_034878 Ga0590077_034878_244_993 249
150 3300005435 Ga0070714_100039774 Ga0070714_1000397742 250
151 3300005458 Ga0070681_10764616 Ga0070681_107646161 250
152 3300005842 Ga0068858_100662334 Ga0068858_1006623342 250
153 3300006175 Ga0070712_100152395 Ga0070712_1001523952 250
154 3300006852 Ga0075433_10782726 Ga0075433_107827261 250
155 3300025898 Ga0207692_10157213 Ga0207692_101572132 250
156 3300025912 Ga0207707_10544012 Ga0207707_105440121 250
157 3300025915 Ga0207693_10016207 Ga0207693_100162075 250
158 3300025916 Ga0207663_10514930 Ga0207663_105149301 250
159 3300025918 Ga0207662_10390153 Ga0207662_103901532 250
160 3300025929 Ga0207664_10361859 Ga0207664_103618592 250
161 3300026035 Ga0207703_10535765 Ga0207703_105357652 250
162 3300035691 Ga0373931_0121294 Ga0373931_0121294_25_804 250
163 3300039437 Ga0436365_1724341 Ga0436365_1724341_120_899 250
164 3300039447 Ga0436361_0951432 Ga0436361_0951432_374_1153 250
165 3300039450 Ga0436363_0083527 Ga0436363_0083527_379_1155 250
166 3300039450 Ga0436363_0833814 Ga0436363_0833814_160_939 250
167 3300039453 Ga0436362_0966250 Ga0436362_0966250_796_1575 250
168 3300044694 Ga0466963_0252474 Ga0466963_0252474_303_1082 250
169 3300045976 Ga0466967_0239076 Ga0466967_0239076_412_1191 250
170 3300039437 Ga0436365_0964494 Ga0436365_0964494_458_1219 252
171 3300039450 Ga0436363_0613160 Ga0436363_0613160_833_1594 252
172 3300005327 Ga0070658_10671567 Ga0070658_106715671 253
173 3300035172 Ga0373955_0177944 Ga0373955_0177944_219_1001 253
174 3300035724 Ga0373933_0002985 Ga0373933_0002985_1684_2466 253
175 3300036401 Ga0373937_0001567 Ga0373937_0001567_7036_7818 253
176 3300046454 Ga0495592_0112165 Ga0495592_0112165_141_923 253
177 3300049582 Ga0501048_0291213 Ga0501048_0291213_381_1142 253
178 3300053085 Ga0495619_0011701 Ga0495619_0011701_3869_4651 253
179 3300014497 Ga0182008_10198377 Ga0182008_101983771 255
180 3300025932 Ga0207690_10188333 Ga0207690_101883332 255
181 3300031901 Ga0307406_10262326 Ga0307406_102623261 256
182 3300037853 Ga0436364_1525175 Ga0436364_1525175_775_1557 257
183 3300005327 Ga0070658_10008140 Ga0070658_100081403 258
184 3300021388 Ga0213875_10001220 Ga0213875_1000122015 258
185 3300021388 Ga0213875_10001754 Ga0213875_1000175413 258
186 3300031852 Ga0307410_10163388 Ga0307410_101633882 258
187 3300037853 Ga0436364_0316960 Ga0436364_0316960_10753_11556 258
188 3300037853 Ga0436364_0558108 Ga0436364_0558108_22170_22961 258
189 3300021361 Ga0213872_10062075 Ga0213872_100620752 260
190 3300045051 Ga0451576_0282551 Ga0451576_0282551_673_1506 260
191 3300004803 Ga0058862_11071456 Ga0058862_110714561 265
192 3300005327 Ga0070658_10054436 Ga0070658_100544363 265
193 3300005336 Ga0070680_100527321 Ga0070680_1005273211 265
194 3300005339 Ga0070660_100045348 Ga0070660_1000453482 265
195 3300005458 Ga0070681_10044178 Ga0070681_100441783 265
196 3300005530 Ga0070679_100021610 Ga0070679_1000216106 265
197 3300005535 Ga0070684_100391867 Ga0070684_1003918671 265
198 3300005563 Ga0068855_100018498 Ga0068855_1000184987 265
199 3300005614 Ga0068856_100002433 Ga0068856_1000024336 265
200 3300005616 Ga0068852_100006026 Ga0068852_1000060262 265
201 3300009093 Ga0105240_10035763 Ga0105240_100357633 265
202 3300013104 Ga0157370_10030278 Ga0157370_100302785 265
203 3300013105 Ga0157369_10161090 Ga0157369_101610903 265
204 3300013307 Ga0157372_10000422 Ga0157372_1000042214 265
205 3300020070 Ga0206356_11197868 Ga0206356_111978682 265
206 3300020075 Ga0206349_1212209 Ga0206349_12122092 265
207 3300020078 Ga0206352_10547726 Ga0206352_105477262 265
208 3300020080 Ga0206350_10481610 Ga0206350_104816103 265
209 3300020081 Ga0206354_11079401 Ga0206354_110794012 265
210 3300020082 Ga0206353_11244424 Ga0206353_112444242 265
211 3300022467 Ga0224712_10033272 Ga0224712_100332721 265
212 3300025912 Ga0207707_10011452 Ga0207707_100114524 265
213 3300025913 Ga0207695_10006107 Ga0207695_100061074 265
214 3300025919 Ga0207657_10010380 Ga0207657_100103809 265
215 3300025921 Ga0207652_10006209 Ga0207652_100062094 265
216 3300025949 Ga0207667_10000056 Ga0207667_1000005687 265
217 3300026078 Ga0207702_10013523 Ga0207702_100135232 265
218 3300026116 Ga0207674_10157023 Ga0207674_101570233 265
219 3300026142 Ga0207698_10009102 Ga0207698_100091027 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

240

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z0a-assembly2.cif.gz_C-3 st0452(y97n)-glcnac binding form 0.8584 1 242
2ggo-assembly1.cif.gz_A crystal structure of glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii 0.8564 1 242
3hl3-assembly1.cif.gz_A 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose. 0.8515 1 236
3pkq-assembly3.cif.gz_C q83d variant of s. enterica rmla with dgtp 0.8512 1 239
4hoc-assembly2.cif.gz_B crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n-acetylglucosamine 0.8473 1 239
ID Description Score Start End Superfamily
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8768 1 224 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.869 1 224 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8436 2 241 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8379 1 243 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8288 3 250 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1F3XZ33-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9884 2 240 GO:0008879
GO:0045226
AF-A0A3D3G9K3-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9871 2 242 GO:0008879
GO:0045226
AF-F5XX04-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9869 27 240 GO:0008879
GO:0045226
AF-A0A4P2Q7N9-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9855 1 242 GO:0008879
GO:0045226
AF-A0A1G7D1R8-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9854 1 243 GO:0008879
GO:0045226

Feature Viewer

pLDDT pTM Quality
87.44 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map