F331399

General Info

Members Datasets Scaffolds Average Seq Length
219 170 438 321

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0019475|Ga0466970_0019475_1746_2843
Length 365
Sequence MTHDDTTAHADEQDALRAGRTAGPRDASRASRPSTGRRWATAAAVAGASALVLTGCGLQPAASFVPGAEPGSIQRIDDLPDGASLTVTSKNFTEQLVLGKIAVLAAKAAGFDVTDETNVPGSVAVRELMTSHSADFTYEYTGTAWLTFMAHEQGIPDKTEQWQAVKDEDAGNGLTWLEPAPMNNTYAFAVRDEAVSELDDVKTLSDITKLPIDQRTFCVESEFNSRADGFKPMLEKYGLELGGSGENGVPTSNVSILDTGTVYTATDRGKCNFGEVFTTDGRIKSLGLTVLEDDRGFFPAYNVAPVIDSETLEEYPQLRDVYDQISPELTDEALQELNRQVDVEGREPADVAFDWMVDKGFITAP

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
49 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
60 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
113 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
120 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
121 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
122 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
123 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
124 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
125 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
126 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
127 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
128 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
129 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
130 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
131 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
132 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
133 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
134 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
135 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
136 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
137 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
138 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
139 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
140 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
141 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
142 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
143 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
144 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
145 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
146 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
147 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
148 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
149 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
150 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
151 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
152 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
153 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
154 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
155 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
156 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
157 2920879853 Kocuria salina CV6 Isolate Unclassified
158 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
159 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
160 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
161 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
162 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
163 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
164 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
165 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
166 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
167 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
168 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
169 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
170 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.89
Metatranscriptomes 1.83
Isolates 23.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 13.7
Nodule 1.83
Rhizoplane 6.39
Rhizosphere 63.93
Stem 0
Stem Tuber 0.46
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0019475 3300044765 Bacteria 3518
2 JGI24743J22301_10010485 3300001991 Bacteria 1656
3 JGI24034J26672_10007720 3300002239 Bacteria 1565
4 Ga0055540_1002796 3300003792 Bacteria 8929
5 Ga0070682_100073243 3300005337 Bacteria 2197
6 Ga0070682_100074448 3300005337 Bacteria 2181
7 Ga0070682_100257841 3300005337 Bacteria 1260
8 Ga0070659_100084501 3300005366 Bacteria 2538
9 Ga0070659_100111909 3300005366 Bacteria 2205
10 Ga0070659_100198241 3300005366 Bacteria 1652
11 Ga0070714_100104559 3300005435 Bacteria 2499
12 Ga0070679_100193487 3300005530 Bacteria 2002
13 Ga0070684_100183412 3300005535 Bacteria 1903
14 Ga0070665_100009629 3300005548 Bacteria 9773
15 Ga0070665_100489266 3300005548 Bacteria 1241
16 Ga0070664_100300520 3300005564 Bacteria 1450
17 Ga0068854_100035972 3300005578 Bacteria 3469
18 Ga0068852_100052820 3300005616 Bacteria 3495
19 Ga0068863_100149928 3300005841 Bacteria 2231
20 Ga0068860_100107254 3300005843 Bacteria 2669
21 Ga0075365_10014342 3300006038 Bacteria 4765
22 Ga0075363_100000051 3300006048 Bacteria 22810
23 Ga0075363_100000291 3300006048 Bacteria 14586
24 Ga0075363_100003542 3300006048 Bacteria 6664
25 Ga0075364_10002650 3300006051 Bacteria 10049
26 Ga0075364_10055397 3300006051 Bacteria 2594
27 Ga0075364_10133595 3300006051 Bacteria 1666
28 Ga0075362_10026537 3300006177 Bacteria 2475
29 Ga0075367_10158018 3300006178 Bacteria 1409
30 Ga0075369_10018779 3300006186 Bacteria 2818
31 Ga0075370_10009250 3300006353 Bacteria 5108
32 Ga0075370_10011011 3300006353 Bacteria 4743
33 Ga0105242_10009138 3300009176 Bacteria 7612
34 Ga0105237_10148480 3300009545 Bacteria 2340
35 Ga0105035_100510 3300009988 Bacteria 2406
36 Ga0105239_10025788 3300010375 Bacteria 6474
37 Ga0105246_10109692 3300011119 Bacteria 2025
38 Ga0157372_10056829 3300013307 Bacteria 4373
39 Ga0157372_10083908 3300013307 Bacteria 3609
40 Ga0157372_10292123 3300013307 Bacteria 1896
41 Ga0163163_10296589 3300014325 Bacteria 1669
42 Ga0209051_1000557 3300025303 Bacteria 45433
43 Ga0207660_10209954 3300025917 Bacteria 1524
44 Ga0207657_10031720 3300025919 Bacteria 4781
45 Ga0207694_10099839 3300025924 Bacteria 2299
46 Ga0207687_10115216 3300025927 Bacteria 2002
47 Ga0207664_10073406 3300025929 Bacteria 2761
48 Ga0207644_10002599 3300025931 Bacteria 11632
49 Ga0207690_10331840 3300025932 Bacteria 1198
50 Ga0207679_10277467 3300025945 Bacteria 1436
51 Ga0207668_10130361 3300025972 Bacteria 1919
52 Ga0207640_10007204 3300025981 Bacteria 6132
53 Ga0207678_10002629 3300026067 Bacteria 16358
54 Ga0207708_10335650 3300026075 Bacteria 1237
55 Ga0207641_10215591 3300026088 Bacteria 1777
56 Ga0207698_10072327 3300026142 Bacteria 2741
57 Ga0268266_10295489 3300028379 Bacteria 1510
58 Ga0268264_10009011 3300028381 Bacteria 8278
59 Ga0307408_100299816 3300031548 Bacteria 1346
60 Ga0316575_10002592 3300031665 Bacteria 6087
61 Ga0316578_10103256 3300031728 Bacteria 1709
62 Ga0307413_10025674 3300031824 Bacteria 3234
63 Ga0307410_10027817 3300031852 Bacteria 3577
64 Ga0307406_10326264 3300031901 Bacteria 1190
65 Ga0307407_10017392 3300031903 Bacteria 3607
66 Ga0307412_10159676 3300031911 Bacteria 1673
67 Ga0307409_100015154 3300031995 Bacteria 5046
68 Ga0307409_100395135 3300031995 Bacteria 1319
69 Ga0307416_100015099 3300032002 Bacteria 5320
70 Ga0307416_100060649 3300032002 Bacteria 3082
71 Ga0307411_10160905 3300032005 Bacteria 1681
72 Ga0307415_100098507 3300032126 Bacteria 2137
73 Ga0316583_10010864 3300032133 Bacteria 3279
74 Ga0316580_10004679 3300032139 Bacteria 3976
75 Ga0316593_10014708 3300032168 Bacteria 2340
76 Ga0316592_1009157 3300033524 Bacteria 1976
77 Ga0316586_1006403 3300033527 Bacteria 1689
78 Ga0316587_1018181 3300033529 Bacteria 1183
79 Ga0316574_0168399 3300035398 Bacteria 1410
80 Ga0316582_0202189 3300036647 Bacteria 1355
81 Ga0316584_0013226 3300036712 Bacteria 5836
82 Ga0395899_0137307 3300037312 Bacteria 1742
83 Ga0395900_0119419 3300037418 Bacteria 2706
84 Ga0395898_0142968 3300037466 Bacteria 2290
85 Ga0395898_0485390 3300037466 Bacteria 1175
86 Ga0395901_0215379 3300038443 Bacteria 2009
87 Ga0451853_1268373 3300041512 Bacteria 2525
88 Ga0466969_0061491 3300044656 Bacteria 1824
89 Ga0466972_0001955 3300044658 Bacteria 10112
90 Ga0466972_0005516 3300044658 Bacteria 6337
91 Ga0466972_0066039 3300044658 Bacteria 1730
92 Ga0466972_0066892 3300044658 Bacteria 1717
93 Ga0466965_0002257 3300044683 Bacteria 8121
94 Ga0466965_0016271 3300044683 Bacteria 3538
95 Ga0466965_0028489 3300044683 Bacteria 2714
96 Ga0466966_0034915 3300044684 Bacteria 3251
97 Ga0466966_0191075 3300044684 Bacteria 1240
98 Ga0466961_0009523 3300044693 Bacteria 6184
99 Ga0466961_0021096 3300044693 Bacteria 4193
100 Ga0466963_0009565 3300044694 Bacteria 5841
101 Ga0466971_0004140 3300044719 Bacteria 6249
102 Ga0466968_0003912 3300044735 Bacteria 5528
103 Ga0466970_0002884 3300044765 Bacteria 8321
104 Ga0466970_0020852 3300044765 Bacteria 3410
105 Ga0466970_0046882 3300044765 Bacteria 2302
106 Ga0466970_0061866 3300044765 Bacteria 2006
107 Ga0466970_0173681 3300044765 Bacteria 1195
108 Ga0466957_0002202 3300044842 Bacteria 10447
109 Ga0466960_0000553 3300044901 Bacteria 12875
110 Ga0466960_0001021 3300044901 Bacteria 10011
111 Ga0466960_0003507 3300044901 Bacteria 6036
112 Ga0466960_0009282 3300044901 Bacteria 4049
113 Ga0466960_0037696 3300044901 Bacteria 2268
114 Ga0466959_0002918 3300045049 Bacteria 11028
115 Ga0466959_0213677 3300045049 Bacteria 1339
116 Ga0466958_0018904 3300045836 Bacteria 4005
117 Ga0466958_0034968 3300045836 Bacteria 3000
118 Ga0466967_0020342 3300045976 Bacteria 5362
119 Ga0466967_0185607 3300045976 Bacteria 1964
120 Ga0466967_0243589 3300045976 Bacteria 1716
121 Ga0495650_0073961 3300046471 Bacteria 1330
122 Ga0496100_0122422 3300048903 Bacteria 1822
123 Ga0496102_0220964 3300048905 Bacteria 1786
124 Ga0496103_0007340 3300048906 Bacteria 6569
125 Ga0496106_0037849 3300048909 Bacteria 3609
126 Ga0496107_0014369 3300048910 Bacteria 5544
127 Ga0496108_0161991 3300048911 Bacteria 1934
128 Ga0496108_0224548 3300048911 Bacteria 1632
129 Ga0496109_0005013 3300048912 Bacteria 11058
130 Ga0496109_0030298 3300048912 Bacteria 4850
131 Ga0496110_0023098 3300048913 Bacteria 5289
132 Ga0496111_0009979 3300048914 Bacteria 6352
133 Ga0496112_0006823 3300048915 Bacteria 10064
134 Ga0496112_0039365 3300048915 Bacteria 4620
135 Ga0496112_0343940 3300048915 Bacteria 1435
136 Ga0496117_0000455 3300048920 Bacteria 68272
137 Ga0496118_0000447 3300048921 Bacteria 68342
138 Ga0496119_0169623 3300048922 Bacteria 1154
139 Ga0496123_0040438 3300048926 Bacteria 3247
140 Ga0496124_0002503 3300048927 Bacteria 23903
141 Ga0496124_0026566 3300048927 Bacteria 5217
142 Ga0496126_0428793 3300048929 Bacteria 1068
143 Ga0501033_0155941 3300049570 Bacteria 1645
144 Ga0501040_0192858 3300049576 Bacteria 1446
145 Ga0501047_0032254 3300049581 Bacteria 5056
146 Ga0501067_0010290 3300049583 Bacteria 5176
147 Ga0501068_0201411 3300049584 Bacteria 1262
148 Ga0501069_0072906 3300049585 Bacteria 1925
149 Ga0501070_0056060 3300049586 Bacteria 3267
150 Ga0501080_0160813 3300049742 Bacteria 2074
151 Ga0501044_0019536 3300049823 Bacteria 7246
152 nmdc:mga03683_66368_c1 3300050489 Bacteria 1534
153 nmdc:mga03683_95136_c1 3300050489 Bacteria 1303
154 nmdc:mga03n38_16735_c1 3300050490 Bacteria 2859
155 nmdc:mga03n38_34369_c1 3300050490 Bacteria 2165
156 nmdc:mga03n38_34598_c1 3300050490 Bacteria 2159
157 nmdc:mga03n38_79119_c1 3300050490 Bacteria 1540
158 nmdc:mga00v17_11587_c1 3300050491 Bacteria 4847
159 nmdc:mga00v17_30271_c1 3300050491 Bacteria 3184
160 nmdc:mga00v17_4952_c1 3300050491 Bacteria 6986
161 nmdc:mga00v17_8779_c1 3300050491 Bacteria 5443
162 nmdc:mga0yw44_41450_c1 3300050492 Bacteria 2741
163 nmdc:mga06z11_130683_c1 3300050494 Bacteria 1410
164 nmdc:mga07m45_4383_c1 3300050496 Bacteria 6909
165 nmdc:mga07m45_9781_c1 3300050496 Bacteria 4987
166 nmdc:mga0sz30_64659_c1 3300050516 Bacteria 1567
167 nmdc:mga0sz30_7839_c1 3300050516 Bacteria 3419
168 Ga0466962_0006997 3300061719 Bacteria 5407
169 2515494649 2515154088 Bacteria 5526283
170 2515718644 2515154129 Bacteria 5584369
171 2515758969 2515154137 Bacteria 5711575
172 2516086129 2515154202 Bacteria 5471270
173 2516089952 2515154203 Bacteria 5458536
174 2555230921 2554235227 Bacteria 3637389
175 2623501839 2622736605 Bacteria 4992138
176 2623590239 2622736626 Bacteria 7181580
177 2644456911 2643221681 Bacteria 3707866
178 2655033788 2654587600 Bacteria 3911798
179 2676474964 2675903058 Bacteria 6822861
180 2691515995 2690315906 Bacteria 4517044
181 2739207113 2738543005 Bacteria 5278128
182 2739240283 2738543011 Bacteria 5731169
183 2753037902 2751185725 Bacteria 5740550
184 2753075549 2751185734 Bacteria 8863695
185 2753303829 2751185788 Bacteria 4541048
186 2753325770 2751185792 Bacteria 5739090
187 2816510783 2816332139 Bacteria 9138787
188 2827630868 2827628540 Bacteria 6858585
189 2842137919 2842134933 Bacteria 5847019
190 2857482392 2857481737 Bacteria 4761446
191 2857711387 2857710386 Bacteria 3186771
192 2862296881 2862290372 Bacteria 7471434
193 2862391720 2862382967 Bacteria 10317375
194 2866612424 2866612099 Bacteria 7543886
195 2870725005 2870721527 Bacteria 9689237
196 2889302802 2889300758 Bacteria 5690814
197 2891331904 2891326441 Bacteria 6439512
198 2899376154 2899370129 Bacteria 6781179
199 2904432267 2904430863 Bacteria 3486923
200 2904501939 2904501621 Bacteria 3401437
201 2908676006 2908674828 Bacteria 3382763
202 2909076483 2909074476 Bacteria 3436050
203 2915359562 2915358134 Bacteria 6050864
204 2919040188 2919039151 Bacteria 3391018
205 2919043048 2919042368 Bacteria 3905917
206 2920883129 2920879853 Bacteria 4216831
207 2928105339 2928104781 Bacteria 3877447
208 2928143940 2928142448 Bacteria 5288925
209 2928501120 2928500415 Bacteria 3384541
210 2929216142 2929212328 Bacteria 7708288
211 2939748010 2939743619 Bacteria 5762299
212 2954000716 2953998280 Bacteria 4812144
213 2984552119 2984551494 Bacteria 3877562
214 2995465733 2995463766 Bacteria 8577691
215 2996223475 2996221748 Bacteria 6799777
216 8008560651 8008558824 Bacteria 10610750
217 8047712995 8047710418 Bacteria 11023148
218 8054477335 8054472261 Bacteria 7464355
219 8055417922 8055412473 Bacteria 6257500
220 Ga0466970_0019475
221 JGI24743J22301_10010485
222 JGI24034J26672_10007720
223 Ga0055540_1002796
224 Ga0070682_100073243
225 Ga0070682_100074448
226 Ga0070682_100257841
227 Ga0070659_100084501
228 Ga0070659_100111909
229 Ga0070659_100198241
230 Ga0070714_100104559
231 Ga0070679_100193487
232 Ga0070684_100183412
233 Ga0070665_100009629
234 Ga0070665_100489266
235 Ga0070664_100300520
236 Ga0068854_100035972
237 Ga0068852_100052820
238 Ga0068863_100149928
239 Ga0068860_100107254
240 Ga0075365_10014342
241 Ga0075363_100000051
242 Ga0075363_100000291
243 Ga0075363_100003542
244 Ga0075364_10002650
245 Ga0075364_10055397
246 Ga0075364_10133595
247 Ga0075362_10026537
248 Ga0075367_10158018
249 Ga0075369_10018779
250 Ga0075370_10009250
251 Ga0075370_10011011
252 Ga0105242_10009138
253 Ga0105237_10148480
254 Ga0105035_100510
255 Ga0105239_10025788
256 Ga0105246_10109692
257 Ga0157372_10056829
258 Ga0157372_10083908
259 Ga0157372_10292123
260 Ga0163163_10296589
261 Ga0209051_1000557
262 Ga0207660_10209954
263 Ga0207657_10031720
264 Ga0207694_10099839
265 Ga0207687_10115216
266 Ga0207664_10073406
267 Ga0207644_10002599
268 Ga0207690_10331840
269 Ga0207679_10277467
270 Ga0207668_10130361
271 Ga0207640_10007204
272 Ga0207678_10002629
273 Ga0207708_10335650
274 Ga0207641_10215591
275 Ga0207698_10072327
276 Ga0268266_10295489
277 Ga0268264_10009011
278 Ga0307408_100299816
279 Ga0316575_10002592
280 Ga0316578_10103256
281 Ga0307413_10025674
282 Ga0307410_10027817
283 Ga0307406_10326264
284 Ga0307407_10017392
285 Ga0307412_10159676
286 Ga0307409_100015154
287 Ga0307409_100395135
288 Ga0307416_100015099
289 Ga0307416_100060649
290 Ga0307411_10160905
291 Ga0307415_100098507
292 Ga0316583_10010864
293 Ga0316580_10004679
294 Ga0316593_10014708
295 Ga0316592_1009157
296 Ga0316586_1006403
297 Ga0316587_1018181
298 Ga0316574_0168399
299 Ga0316582_0202189
300 Ga0316584_0013226
301 Ga0395899_0137307
302 Ga0395900_0119419
303 Ga0395898_0142968
304 Ga0395898_0485390
305 Ga0395901_0215379
306 Ga0451853_1268373
307 Ga0466969_0061491
308 Ga0466972_0001955
309 Ga0466972_0005516
310 Ga0466972_0066039
311 Ga0466972_0066892
312 Ga0466965_0002257
313 Ga0466965_0016271
314 Ga0466965_0028489
315 Ga0466966_0034915
316 Ga0466966_0191075
317 Ga0466961_0009523
318 Ga0466961_0021096
319 Ga0466963_0009565
320 Ga0466971_0004140
321 Ga0466968_0003912
322 Ga0466970_0002884
323 Ga0466970_0020852
324 Ga0466970_0046882
325 Ga0466970_0061866
326 Ga0466970_0173681
327 Ga0466957_0002202
328 Ga0466960_0000553
329 Ga0466960_0001021
330 Ga0466960_0003507
331 Ga0466960_0009282
332 Ga0466960_0037696
333 Ga0466959_0002918
334 Ga0466959_0213677
335 Ga0466958_0018904
336 Ga0466958_0034968
337 Ga0466967_0020342
338 Ga0466967_0185607
339 Ga0466967_0243589
340 Ga0495650_0073961
341 Ga0496100_0122422
342 Ga0496102_0220964
343 Ga0496103_0007340
344 Ga0496106_0037849
345 Ga0496107_0014369
346 Ga0496108_0161991
347 Ga0496108_0224548
348 Ga0496109_0005013
349 Ga0496109_0030298
350 Ga0496110_0023098
351 Ga0496111_0009979
352 Ga0496112_0006823
353 Ga0496112_0039365
354 Ga0496112_0343940
355 Ga0496117_0000455
356 Ga0496118_0000447
357 Ga0496119_0169623
358 Ga0496123_0040438
359 Ga0496124_0002503
360 Ga0496124_0026566
361 Ga0496126_0428793
362 Ga0501033_0155941
363 Ga0501040_0192858
364 Ga0501047_0032254
365 Ga0501067_0010290
366 Ga0501068_0201411
367 Ga0501069_0072906
368 Ga0501070_0056060
369 Ga0501080_0160813
370 Ga0501044_0019536
371 nmdc:mga03683_66368_c1
372 nmdc:mga03683_95136_c1
373 nmdc:mga03n38_16735_c1
374 nmdc:mga03n38_34369_c1
375 nmdc:mga03n38_34598_c1
376 nmdc:mga03n38_79119_c1
377 nmdc:mga00v17_11587_c1
378 nmdc:mga00v17_30271_c1
379 nmdc:mga00v17_4952_c1
380 nmdc:mga00v17_8779_c1
381 nmdc:mga0yw44_41450_c1
382 nmdc:mga06z11_130683_c1
383 nmdc:mga07m45_4383_c1
384 nmdc:mga07m45_9781_c1
385 nmdc:mga0sz30_64659_c1
386 nmdc:mga0sz30_7839_c1
387 Ga0466962_0006997
388 2515494649
389 2515718644
390 2515758969
391 2516086129
392 2516089952
393 2555230921
394 2623501839
395 2623590239
396 2644456911
397 2655033788
398 2676474964
399 2691515995
400 2739207113
401 2739240283
402 2753037902
403 2753075549
404 2753303829
405 2753325770
406 2816510783
407 2827630868
408 2842137919
409 2857482392
410 2857711387
411 2862296881
412 2862391720
413 2866612424
414 2870725005
415 2889302802
416 2891331904
417 2899376154
418 2904432267
419 2904501939
420 2908676006
421 2909076483
422 2915359562
423 2919040188
424 2919043048
425 2920883129
426 2928105339
427 2928143940
428 2928501120
429 2929216142
430 2939748010
431 2954000716
432 2984552119
433 2995465733
434 2996223475
435 8008560651
436 8047712995
437 8054477335
438 8055417922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

83

358

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o66-assembly1.cif.gz_A crystal structure of glycine betaine/carnitine/choline abc transporter 0.9335 55 326
7s7w-assembly1.cif.gz_A crystal structure of inicsnfr3a nicotine sensor precursor binding protein 0.9264 54 330
3o66-assembly2.cif.gz_B crystal structure of glycine betaine/carnitine/choline abc transporter 0.9229 56 326
7s7y-assembly1.cif.gz_A crystal structure of icytsnfr cytisine sensor precursor binding protein 0.9146 55 330
3mam-assembly1.cif.gz_A a molecular switch changes the low to the high affinity state in the substrate binding protein afprox 0.9144 55 330
ID Description Score Start End Superfamily
af_Q2FVH0_34_306_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9204 56 326 3.40.190.10
af_P33362_23_301_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9198 54 325 3.30.479.30
af_O69725_44_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9144 58 328 3.40.190.10
af_O69725_44_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9078 58 328 3.40.190.10
af_Q2FVH0_34_306_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.901 56 326 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7Z9PUU7-F1-model_v4 ABC transporter permease subunit 0.9615 54 326 GO:0022857
GO:0031460
GO:0043190
AF-X1D8A1-F1-model_v4 ABC-type glycine betaine transport system substrate-binding domain-containing protein 0.9582 154 331 GO:0022857
GO:0043190
AF-A0A4Q2WGU3-F1-model_v4 deleted 0.9555 119 329
AF-A0A5S9IP58-F1-model_v4 ABC transporter permease 0.9543 55 330 GO:0022857
GO:0031460
GO:0043190
AF-A0A178U775-F1-model_v4 Uncharacterized protein 0.9538 52 323 GO:0005524
GO:0016887
GO:0022857
GO:0043190

Map