F330650

General Info

Members Datasets Scaffolds Average Seq Length
219 162 219 122

Family's Representative Sequence

Representative Sequence 3300004800|Ga0058861_12065329|Ga0058861_120653297
Length 125
Sequence VAQQENAPNKPVHLMYLVGAVILFYLLQWSIDWVWGTFTPSTPSDFKISLAAAIGATVVGIVTYRNDRIYHLANEVASELKKVTWPTAKETRRSTMTVIFMAILSALILFTFDLVWSGITERVYG

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
98 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
101 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
107 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
117 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
127 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
128 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
129 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
130 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
131 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
132 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
133 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
134 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
135 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
136 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
143 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
144 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
145 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
146 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
147 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
148 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
149 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
150 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
151 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
152 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
153 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
154 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
155 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
156 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
157 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
158 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
159 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
160 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
161 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.87
Metatranscriptomes 9.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.24
Nodule 0
Rhizoplane 2.74
Rhizosphere 73.06
Stem 0
Stem Tuber 0
Unclassified 10.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F6ESG4R02I87JQ 2088090002 Bacteria 531
2 Ga0006759J45824_1147936 3300003163 Unclassified 862
3 Ga0006770J48903_1076339 3300003305 Unclassified 774
4 Ga0032354_1101976 3300003693 Bacteria 815
5 Ga0058858_1426757 3300004785 Bacteria 1094
6 Ga0058859_10006983 3300004798 Bacteria 661
7 Ga0058859_10059082 3300004798 Bacteria 1141
8 Ga0058859_11787805 3300004798 Bacteria 623
9 Ga0058859_11812860 3300004798 Bacteria 585
10 Ga0058859_11822122 3300004798 Bacteria 602
11 Ga0058859_11831134 3300004798 Unclassified 546
12 Ga0058863_11952190 3300004799 Bacteria 3622
13 Ga0058863_11961233 3300004799 Bacteria 961
14 Ga0058861_12065329 3300004800 Bacteria 4943
15 Ga0058860_10021991 3300004801 Bacteria 799
16 Ga0058860_10182724 3300004801 Bacteria 1245
17 Ga0058860_12186430 3300004801 Bacteria 647
18 Ga0058860_12224448 3300004801 Bacteria 678
19 Ga0058860_12242599 3300004801 Bacteria 1112
20 Ga0058862_10136446 3300004803 Bacteria 1363
21 Ga0070683_101750095 3300005329 Bacteria 598
22 Ga0070690_100117496 3300005330 Bacteria 1781
23 Ga0068869_100149485 3300005334 Bacteria 1810
24 Ga0068869_100181439 3300005334 Bacteria 1650
25 Ga0068869_100325385 3300005334 Bacteria 1248
26 Ga0070680_101748823 3300005336 Bacteria 539
27 Ga0070682_100171395 3300005337 Bacteria 1509
28 Ga0068868_101901359 3300005338 Bacteria 564
29 Ga0070689_100073374 3300005340 Bacteria 2676
30 Ga0070689_100934850 3300005340 Bacteria 768
31 Ga0070689_100962638 3300005340 Bacteria 758
32 Ga0070687_100084769 3300005343 Bacteria 1737
33 Ga0070687_100186768 3300005343 Bacteria 1246
34 Ga0070687_100408251 3300005343 Bacteria 892
35 Ga0070687_100835137 3300005343 Bacteria 656
36 Ga0070692_11196749 3300005345 Bacteria 541
37 Ga0070669_101034226 3300005353 Bacteria 706
38 Ga0070688_100087105 3300005365 Bacteria 2033
39 Ga0070688_100865803 3300005365 Bacteria 711
40 Ga0070667_100045841 3300005367 Bacteria 3677
41 Ga0070714_102420539 3300005435 Bacteria 510
42 Ga0070711_100982378 3300005439 Bacteria 724
43 Ga0070705_100347097 3300005440 Bacteria 1081
44 Ga0070700_100725891 3300005441 Bacteria 792
45 Ga0070700_101006224 3300005441 Bacteria 685
46 Ga0070681_10466224 3300005458 Bacteria 1176
47 Ga0068867_102038934 3300005459 Bacteria 543
48 Ga0070698_100024917 3300005471 Bacteria 6236
49 Ga0070679_100237833 3300005530 Bacteria 1779
50 Ga0070684_100384095 3300005535 Bacteria 1294
51 Ga0070684_100695740 3300005535 Bacteria 948
52 Ga0070686_100372504 3300005544 Bacteria 1079
53 Ga0070686_100752397 3300005544 Bacteria 782
54 Ga0070695_101442800 3300005545 Bacteria 572
55 Ga0070665_100002326 3300005548 Bacteria 21094
56 Ga0070665_100795441 3300005548 Bacteria 959
57 Ga0070704_102176148 3300005549 Bacteria 516
58 Ga0068857_101073915 3300005577 Bacteria 777
59 Ga0068856_100200820 3300005614 Bacteria 2008
60 Ga0068852_100282119 3300005616 Bacteria 1602
61 Ga0068859_100982875 3300005617 Bacteria 927
62 Ga0068864_101009487 3300005618 Bacteria 825
63 Ga0068864_102348423 3300005618 Bacteria 540
64 Ga0068861_100350566 3300005719 Bacteria 1295
65 Ga0068861_100402057 3300005719 Bacteria 1215
66 Ga0068863_100362284 3300005841 Bacteria 1414
67 Ga0068863_100384082 3300005841 Bacteria 1372
68 Ga0068863_100578293 3300005841 Bacteria 1111
69 Ga0068860_100965355 3300005843 Bacteria 870
70 Ga0068860_102747204 3300005843 Bacteria 511
71 Ga0081455_10037718 3300005937 Bacteria 4287
72 Ga0070717_10071780 3300006028 Bacteria 2889
73 Ga0070717_10491414 3300006028 Bacteria 1109
74 Ga0075362_10205415 3300006177 Bacteria 960
75 Ga0075362_10644990 3300006177 Bacteria 550
76 Ga0075366_10532612 3300006195 Bacteria 727
77 Ga0097621_100476474 3300006237 Bacteria 1128
78 Ga0097621_100510722 3300006237 Bacteria 1090
79 Ga0068865_100778751 3300006881 Bacteria 824
80 Ga0097620_100982960 3300006931 Bacteria 927
81 Ga0075435_100791240 3300007076 Bacteria 826
82 Ga0105240_10287595 3300009093 Bacteria 1886
83 Ga0105245_10012171 3300009098 Bacteria 7483
84 Ga0105245_12883800 3300009098 Bacteria 533
85 Ga0105248_10468581 3300009177 Bacteria 1420
86 Ga0105237_10243892 3300009545 Bacteria 1798
87 Ga0105238_11283834 3300009551 Bacteria 758
88 Ga0105249_10055674 3300009553 Bacteria 3619
89 Ga0105239_10096735 3300010375 Bacteria 3262
90 Ga0105246_10266589 3300011119 Bacteria 1367
91 Ga0105246_10400910 3300011119 Bacteria 1139
92 Ga0157374_10280653 3300013296 Bacteria 1644
93 Ga0157374_11384329 3300013296 Bacteria 726
94 Ga0157378_10034587 3300013297 Bacteria 4468
95 Ga0157378_12355730 3300013297 Bacteria 584
96 Ga0157372_12294401 3300013307 Bacteria 620
97 Ga0157379_11867803 3300014968 Bacteria 591
98 Ga0157376_10736536 3300014969 Bacteria 994
99 Ga0157376_11478444 3300014969 Bacteria 712
100 Ga0207653_10193714 3300025885 Bacteria 764
101 Ga0207710_10024897 3300025900 Bacteria 2581
102 Ga0207707_10281687 3300025912 Bacteria 1440
103 Ga0207671_10378592 3300025914 Bacteria 1124
104 Ga0207662_10207834 3300025918 Bacteria 1270
105 Ga0207662_10870507 3300025918 Bacteria 637
106 Ga0207652_10225897 3300025921 Bacteria 1687
107 Ga0207687_10011839 3300025927 Bacteria 5707
108 Ga0207670_10062669 3300025936 Bacteria 2542
109 Ga0207670_10124923 3300025936 Bacteria 1876
110 Ga0207670_10653773 3300025936 Bacteria 867
111 Ga0207704_10314490 3300025938 Bacteria 1205
112 Ga0207711_10286076 3300025941 Bacteria 1519
113 Ga0207689_10083088 3300025942 Bacteria 2633
114 Ga0207689_10149694 3300025942 Bacteria 1924
115 Ga0207667_10505986 3300025949 Bacteria 1225
116 Ga0207712_10030461 3300025961 Bacteria 3628
117 Ga0207712_11345786 3300025961 Bacteria 639
118 Ga0207658_11657839 3300025986 Bacteria 584
119 Ga0207677_12099850 3300026023 Bacteria 525
120 Ga0207703_11542888 3300026035 Bacteria 639
121 Ga0207708_10622835 3300026075 Bacteria 916
122 Ga0207702_10408117 3300026078 Bacteria 1311
123 Ga0207641_10348754 3300026088 Bacteria 1410
124 Ga0207641_10492725 3300026088 Bacteria 1189
125 Ga0207641_10614523 3300026088 Bacteria 1065
126 Ga0207676_10907710 3300026095 Bacteria 864
127 Ga0207675_101257459 3300026118 Bacteria 761
128 Ga0207698_10342853 3300026142 Bacteria 1408
129 Ga0207698_11804819 3300026142 Bacteria 627
130 Ga0268266_10013004 3300028379 Bacteria 7176
131 Ga0268266_11189159 3300028379 Bacteria 737
132 Ga0268265_10911600 3300028380 Bacteria 864
133 Ga0268264_10367744 3300028381 Bacteria 1373
134 Ga0268264_10817826 3300028381 Unclassified 932
135 Ga0268264_11089969 3300028381 Bacteria 807
136 Ga0307517_10138879 3300028786 Bacteria 1715
137 Ga0307515_10019188 3300028794 Bacteria 12327
138 Ga0307513_10065116 3300031456 Bacteria 3835
139 Ga0307509_10000112 3300031507 Bacteria 117028
140 Ga0307509_10007627 3300031507 Bacteria 14066
141 Ga0307509_10277335 3300031507 Bacteria 1440
142 Ga0307509_10408107 3300031507 Bacteria 1063
143 Ga0307508_10007968 3300031616 Bacteria 9825
144 Ga0307516_10296479 3300031730 Bacteria 1294
145 Ga0307415_100220161 3300032126 Bacteria 1521
146 Ga0307507_10134606 3300033179 Bacteria 1920
147 Ga0373958_0152491 3300034819 Bacteria 579
148 Ga0373936_0000006 3300035113 Bacteria 318697
149 Ga0373941_0371174 3300035115 Bacteria 586
150 Ga0373961_0000367 3300035241 Bacteria 19355
151 Ga0373925_0710288 3300037068 Bacteria 829
152 Ga0395905_0178386 3300037471 Bacteria 1994
153 Ga0395905_0419351 3300037471 Bacteria 1234
154 Ga0436365_1130276 3300039437 Bacteria 607
155 Ga0436362_0510327 3300039453 Bacteria 603
156 Ga0451802_2185325 3300041460 Bacteria 569
157 Ga0451805_081873 3300041461 Bacteria 733
158 Ga0451807_0167465 3300041486 Bacteria 736
159 Ga0451853_0353232 3300041512 Bacteria 1327
160 Ga0495590_0063326 3300046457 Bacteria 1294
161 Ga0495666_0093194 3300046526 Bacteria 1421
162 Ga0495622_0062328 3300046557 Bacteria 1726
163 Ga0496105_0225325 3300048908 Bacteria 1525
164 Ga0496112_0847768 3300048915 Bacteria 837
165 Ga0496115_0959701 3300048918 Bacteria 656
166 Ga0501292_001202 3300049515 Bacteria 3188
167 Ga0501299_006155 3300049522 Bacteria 1874
168 Ga0501033_0298405 3300049570 Bacteria 1135
169 Ga0501034_0513979 3300049571 Bacteria 1110
170 Ga0501036_0164935 3300049572 Bacteria 1868
171 Ga0501047_0301238 3300049581 Bacteria 1445
172 Ga0501047_0319238 3300049581 Bacteria 1393
173 Ga0501068_0030996 3300049584 Bacteria 3175
174 Ga0501070_0038089 3300049586 Bacteria 4012
175 Ga0501070_0114787 3300049586 Bacteria 2225
176 Ga0501071_0176407 3300049587 Bacteria 1601
177 Ga0501077_0872115 3300049593 Bacteria 579
178 Ga0501209_063849 3300049656 Bacteria 1033
179 Ga0501216_006624 3300049660 Bacteria 1782
180 Ga0501217_007146 3300049661 Bacteria 2388
181 Ga0501223_101120 3300049663 Bacteria 594
182 Ga0501227_003435 3300049665 Bacteria 3431
183 Ga0501230_000491 3300049667 Bacteria 3972
184 Ga0501233_029563 3300049668 Bacteria 1230
185 Ga0501236_024240 3300049670 Bacteria 919
186 Ga0501249_159294 3300049679 Unclassified 572
187 Ga0501225_0005523 3300049705 Bacteria 3706
188 Ga0501229_008244 3300049706 Bacteria 1302
189 Ga0501079_1336058 3300049741 Bacteria 564
190 Ga0501267_014830 3300049764 Bacteria 821
191 Ga0501044_0142419 3300049823 Bacteria 2385
192 Ga0501044_0606618 3300049823 Bacteria 987
193 nmdc:mga03683_147433_c1 3300050489 Bacteria 1060
194 nmdc:mga0k408_486021_c1 3300050493 Bacteria 732
195 Ga0500578_0035091 3300053086 Bacteria 3223
196 Ga0500647_0451775 3300053091 Bacteria 508
197 Ga0500583_0109543 3300053092 Bacteria 1359
198 Ga0500566_0016265 3300053094 Bacteria 4367
199 Ga0500640_005421 3300053095 Bacteria 4760
200 Ga0500554_001686 3300053102 Bacteria 4249
201 Ga0500557_030638 3300053105 Bacteria 1627
202 Ga0500595_002152 3300053119 Bacteria 10023
203 Ga0500597_023440 3300053120 Bacteria 2466
204 Ga0500597_153568 3300053120 Bacteria 987
205 Ga0500614_001423 3300053123 Bacteria 5738
206 Ga0500614_068470 3300053123 Bacteria 969
207 Ga0500658_0109308 3300053134 Bacteria 1215
208 Ga0500658_0110177 3300053134 Bacteria 1211
209 Ga0500559_0023083 3300053136 Bacteria 2640
210 Ga0500577_0022921 3300053142 Bacteria 2079
211 Ga0500585_080767 3300053144 Bacteria 1175
212 Ga0500585_283916 3300053144 Bacteria 509
213 Ga0500604_0016971 3300053151 Bacteria 2010
214 Ga0500619_136952 3300053154 Bacteria 834
215 Ga0500622_0173600 3300053156 Bacteria 1001
216 Ga0500638_047424 3300053162 Bacteria 2080
217 Ga0500639_031184 3300053163 Bacteria 2818
218 Ga0500637_0585423 3300053178 Bacteria 532
219 Ga0501082_0087185 3300060353 Bacteria 2693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_12883800 Ga0105245_128838001 102
2 3300035115 Ga0373941_0371174 Ga0373941_0371174_10_327 104
3 3300009551 Ga0105238_11283834 Ga0105238_112838342 107
4 3300034819 Ga0373958_0152491 Ga0373958_0152491_47_421 107
5 3300004798 Ga0058859_11831134 Ga0058859_118311342 108
6 3300004798 Ga0058859_11822122 Ga0058859_118221221 110
7 3300005439 Ga0070711_100982378 Ga0070711_1009823782 110
8 3300005458 Ga0070681_10466224 Ga0070681_104662242 110
9 3300014969 Ga0157376_10736536 Ga0157376_107365362 110
10 3300025912 Ga0207707_10281687 Ga0207707_102816873 110
11 3300031507 Ga0307509_10277335 Ga0307509_102773353 110
12 3300037068 Ga0373925_0710288 Ga0373925_0710288_181_555 110
13 3300041460 Ga0451802_2185325 Ga0451802_2185325_78_410 110
14 3300049586 Ga0501070_0114787 Ga0501070_0114787_265_603 110
15 3300049660 Ga0501216_006624 Ga0501216_006624_805_1140 110
16 3300049706 Ga0501229_008244 Ga0501229_008244_662_997 110
17 3300049823 Ga0501044_0606618 Ga0501044_0606618_27_365 110
18 3300004785 Ga0058858_1426757 Ga0058858_14267572 111
19 3300004801 Ga0058860_10182724 Ga0058860_101827242 111
20 3300005340 Ga0070689_100073374 Ga0070689_1000733743 111
21 3300005365 Ga0070688_100087105 Ga0070688_1000871051 111
22 3300005841 Ga0068863_100578293 Ga0068863_1005782932 111
23 3300005937 Ga0081455_10037718 Ga0081455_100377189 111
24 3300014968 Ga0157379_11867803 Ga0157379_118678031 111
25 3300025936 Ga0207670_10124923 Ga0207670_101249232 111
26 3300026088 Ga0207641_10492725 Ga0207641_104927252 111
27 3300025885 Ga0207653_10193714 Ga0207653_101937141 114
28 3300026035 Ga0207703_11542888 Ga0207703_115428882 114
29 3300004799 Ga0058863_11952190 Ga0058863_119521903 115
30 3300004801 Ga0058860_12242599 Ga0058860_122425993 115
31 3300005334 Ga0068869_100325385 Ga0068869_1003253852 115
32 3300005617 Ga0068859_100982875 Ga0068859_1009828753 115
33 3300005618 Ga0068864_102348423 Ga0068864_1023484232 115
34 3300005719 Ga0068861_100350566 Ga0068861_1003505662 115
35 3300005841 Ga0068863_100384082 Ga0068863_1003840822 115
36 3300005843 Ga0068860_100965355 Ga0068860_1009653552 115
37 3300006931 Ga0097620_100982960 Ga0097620_1009829603 115
38 3300011119 Ga0105246_10266589 Ga0105246_102665893 115
39 3300025900 Ga0207710_10024897 Ga0207710_100248975 115
40 3300025942 Ga0207689_10149694 Ga0207689_101496942 115
41 3300026088 Ga0207641_10348754 Ga0207641_103487542 115
42 3300028381 Ga0268264_11089969 Ga0268264_110899693 115
43 3300041486 Ga0451807_0167465 Ga0451807_0167465_239_616 115
44 3300028380 Ga0268265_10911600 Ga0268265_109116002 116
45 3300053163 Ga0500639_031184 Ga0500639_031184_2026_2400 118
46 2088090002 CNA_F6ESG4R02I87JQ CNA_00581100 123
47 3300003163 Ga0006759J45824_1147936 Ga0006759J45824_11479362 123
48 3300003305 Ga0006770J48903_1076339 Ga0006770J48903_10763392 123
49 3300003693 Ga0032354_1101976 Ga0032354_11019762 123
50 3300004798 Ga0058859_10006983 Ga0058859_100069832 123
51 3300004798 Ga0058859_10059082 Ga0058859_100590822 123
52 3300004798 Ga0058859_11787805 Ga0058859_117878052 123
53 3300004798 Ga0058859_11812860 Ga0058859_118128601 123
54 3300004799 Ga0058863_11961233 Ga0058863_119612333 123
55 3300004800 Ga0058861_12065329 Ga0058861_120653297 123
56 3300004801 Ga0058860_10021991 Ga0058860_100219912 123
57 3300004801 Ga0058860_12186430 Ga0058860_121864301 123
58 3300004801 Ga0058860_12224448 Ga0058860_122244482 123
59 3300004803 Ga0058862_10136446 Ga0058862_101364463 123
60 3300005329 Ga0070683_101750095 Ga0070683_1017500951 123
61 3300005330 Ga0070690_100117496 Ga0070690_1001174963 123
62 3300005334 Ga0068869_100149485 Ga0068869_1001494852 123
63 3300005334 Ga0068869_100181439 Ga0068869_1001814392 123
64 3300005336 Ga0070680_101748823 Ga0070680_1017488231 123
65 3300005337 Ga0070682_100171395 Ga0070682_1001713952 123
66 3300005338 Ga0068868_101901359 Ga0068868_1019013592 123
67 3300005340 Ga0070689_100934850 Ga0070689_1009348502 123
68 3300005340 Ga0070689_100962638 Ga0070689_1009626382 123
69 3300005343 Ga0070687_100084769 Ga0070687_1000847692 123
70 3300005343 Ga0070687_100186768 Ga0070687_1001867683 123
71 3300005343 Ga0070687_100408251 Ga0070687_1004082513 123
72 3300005343 Ga0070687_100835137 Ga0070687_1008351371 123
73 3300005345 Ga0070692_11196749 Ga0070692_111967491 123
74 3300005353 Ga0070669_101034226 Ga0070669_1010342261 123
75 3300005365 Ga0070688_100865803 Ga0070688_1008658032 123
76 3300005367 Ga0070667_100045841 Ga0070667_1000458419 123
77 3300005435 Ga0070714_102420539 Ga0070714_1024205391 123
78 3300005440 Ga0070705_100347097 Ga0070705_1003470971 123
79 3300005441 Ga0070700_100725891 Ga0070700_1007258912 123
80 3300005441 Ga0070700_101006224 Ga0070700_1010062242 123
81 3300005459 Ga0068867_102038934 Ga0068867_1020389341 123
82 3300005471 Ga0070698_100024917 Ga0070698_1000249173 123
83 3300005530 Ga0070679_100237833 Ga0070679_1002378333 123
84 3300005535 Ga0070684_100384095 Ga0070684_1003840954 123
85 3300005535 Ga0070684_100695740 Ga0070684_1006957402 123
86 3300005544 Ga0070686_100372504 Ga0070686_1003725042 123
87 3300005544 Ga0070686_100752397 Ga0070686_1007523972 123
88 3300005545 Ga0070695_101442800 Ga0070695_1014428001 123
89 3300005548 Ga0070665_100002326 Ga0070665_1000023264 123
90 3300005548 Ga0070665_100795441 Ga0070665_1007954412 123
91 3300005549 Ga0070704_102176148 Ga0070704_1021761481 123
92 3300005577 Ga0068857_101073915 Ga0068857_1010739152 123
93 3300005614 Ga0068856_100200820 Ga0068856_1002008203 123
94 3300005616 Ga0068852_100282119 Ga0068852_1002821192 123
95 3300005618 Ga0068864_101009487 Ga0068864_1010094871 123
96 3300005719 Ga0068861_100402057 Ga0068861_1004020573 123
97 3300005841 Ga0068863_100362284 Ga0068863_1003622842 123
98 3300005843 Ga0068860_102747204 Ga0068860_1027472041 123
99 3300006028 Ga0070717_10071780 Ga0070717_100717803 123
100 3300006028 Ga0070717_10491414 Ga0070717_104914142 123
101 3300006177 Ga0075362_10205415 Ga0075362_102054152 123
102 3300006177 Ga0075362_10644990 Ga0075362_106449901 123
103 3300006195 Ga0075366_10532612 Ga0075366_105326122 123
104 3300006237 Ga0097621_100476474 Ga0097621_1004764742 123
105 3300006237 Ga0097621_100510722 Ga0097621_1005107221 123
106 3300006881 Ga0068865_100778751 Ga0068865_1007787512 123
107 3300007076 Ga0075435_100791240 Ga0075435_1007912402 123
108 3300009093 Ga0105240_10287595 Ga0105240_102875953 123
109 3300009098 Ga0105245_10012171 Ga0105245_100121713 123
110 3300009177 Ga0105248_10468581 Ga0105248_104685812 123
111 3300009545 Ga0105237_10243892 Ga0105237_102438922 123
112 3300009553 Ga0105249_10055674 Ga0105249_100556745 123
113 3300010375 Ga0105239_10096735 Ga0105239_100967354 123
114 3300011119 Ga0105246_10400910 Ga0105246_104009101 123
115 3300013296 Ga0157374_10280653 Ga0157374_102806533 123
116 3300013296 Ga0157374_11384329 Ga0157374_113843292 123
117 3300013297 Ga0157378_10034587 Ga0157378_100345874 123
118 3300013297 Ga0157378_12355730 Ga0157378_123557302 123
119 3300013307 Ga0157372_12294401 Ga0157372_122944012 123
120 3300014969 Ga0157376_11478444 Ga0157376_114784442 123
121 3300025914 Ga0207671_10378592 Ga0207671_103785922 123
122 3300025918 Ga0207662_10207834 Ga0207662_102078342 123
123 3300025918 Ga0207662_10870507 Ga0207662_108705072 123
124 3300025921 Ga0207652_10225897 Ga0207652_102258972 123
125 3300025927 Ga0207687_10011839 Ga0207687_100118397 123
126 3300025936 Ga0207670_10062669 Ga0207670_100626693 123
127 3300025936 Ga0207670_10653773 Ga0207670_106537732 123
128 3300025938 Ga0207704_10314490 Ga0207704_103144903 123
129 3300025941 Ga0207711_10286076 Ga0207711_102860763 123
130 3300025942 Ga0207689_10083088 Ga0207689_100830883 123
131 3300025949 Ga0207667_10505986 Ga0207667_105059862 123
132 3300025961 Ga0207712_10030461 Ga0207712_100304619 123
133 3300025961 Ga0207712_11345786 Ga0207712_113457862 123
134 3300025986 Ga0207658_11657839 Ga0207658_116578392 123
135 3300026023 Ga0207677_12099850 Ga0207677_120998501 123
136 3300026075 Ga0207708_10622835 Ga0207708_106228352 123
137 3300026078 Ga0207702_10408117 Ga0207702_104081172 123
138 3300026088 Ga0207641_10614523 Ga0207641_106145232 123
139 3300026095 Ga0207676_10907710 Ga0207676_109077102 123
140 3300026118 Ga0207675_101257459 Ga0207675_1012574593 123
141 3300026142 Ga0207698_10342853 Ga0207698_103428533 123
142 3300026142 Ga0207698_11804819 Ga0207698_118048192 123
143 3300028379 Ga0268266_10013004 Ga0268266_100130047 123
144 3300028379 Ga0268266_11189159 Ga0268266_111891592 123
145 3300028381 Ga0268264_10367744 Ga0268264_103677442 123
146 3300028381 Ga0268264_10817826 Ga0268264_108178262 123
147 3300028786 Ga0307517_10138879 Ga0307517_101388793 123
148 3300028794 Ga0307515_10019188 Ga0307515_100191889 123
149 3300031456 Ga0307513_10065116 Ga0307513_100651163 123
150 3300031507 Ga0307509_10000112 Ga0307509_1000011270 123
151 3300031507 Ga0307509_10007627 Ga0307509_100076272 123
152 3300031507 Ga0307509_10408107 Ga0307509_104081073 123
153 3300031616 Ga0307508_10007968 Ga0307508_100079686 123
154 3300031730 Ga0307516_10296479 Ga0307516_102964792 123
155 3300032126 Ga0307415_100220161 Ga0307415_1002201612 123
156 3300033179 Ga0307507_10134606 Ga0307507_101346063 123
157 3300035113 Ga0373936_0000006 Ga0373936_0000006_99689_100060 123
158 3300035241 Ga0373961_0000367 Ga0373961_0000367_18525_18896 123
159 3300037471 Ga0395905_0178386 Ga0395905_0178386_473_847 123
160 3300037471 Ga0395905_0419351 Ga0395905_0419351_396_776 123
161 3300039437 Ga0436365_1130276 Ga0436365_1130276_198_572 123
162 3300039453 Ga0436362_0510327 Ga0436362_0510327_166_546 123
163 3300041461 Ga0451805_081873 Ga0451805_081873_328_699 123
164 3300041512 Ga0451853_0353232 Ga0451853_0353232_560_934 123
165 3300046457 Ga0495590_0063326 Ga0495590_0063326_172_543 123
166 3300046526 Ga0495666_0093194 Ga0495666_0093194_491_883 123
167 3300046557 Ga0495622_0062328 Ga0495622_0062328_1183_1575 123
168 3300048908 Ga0496105_0225325 Ga0496105_0225325_1081_1455 123
169 3300048915 Ga0496112_0847768 Ga0496112_0847768_131_505 123
170 3300048918 Ga0496115_0959701 Ga0496115_0959701_30_404 123
171 3300049515 Ga0501292_001202 Ga0501292_001202_436_822 123
172 3300049522 Ga0501299_006155 Ga0501299_006155_962_1348 123
173 3300049570 Ga0501033_0298405 Ga0501033_0298405_368_745 123
174 3300049571 Ga0501034_0513979 Ga0501034_0513979_364_738 123
175 3300049572 Ga0501036_0164935 Ga0501036_0164935_1295_1669 123
176 3300049581 Ga0501047_0301238 Ga0501047_0301238_905_1279 123
177 3300049581 Ga0501047_0319238 Ga0501047_0319238_375_752 123
178 3300049584 Ga0501068_0030996 Ga0501068_0030996_1958_2350 123
179 3300049586 Ga0501070_0038089 Ga0501070_0038089_3163_3555 123
180 3300049587 Ga0501071_0176407 Ga0501071_0176407_485_862 123
181 3300049593 Ga0501077_0872115 Ga0501077_0872115_105_479 123
182 3300049656 Ga0501209_063849 Ga0501209_063849_578_964 123
183 3300049661 Ga0501217_007146 Ga0501217_007146_584_970 123
184 3300049663 Ga0501223_101120 Ga0501223_101120_149_535 123
185 3300049665 Ga0501227_003435 Ga0501227_003435_2459_2845 123
186 3300049667 Ga0501230_000491 Ga0501230_000491_814_1200 123
187 3300049668 Ga0501233_029563 Ga0501233_029563_435_821 123
188 3300049670 Ga0501236_024240 Ga0501236_024240_380_766 123
189 3300049679 Ga0501249_159294 Ga0501249_159294_168_554 123
190 3300049705 Ga0501225_0005523 Ga0501225_0005523_472_858 123
191 3300049741 Ga0501079_1336058 Ga0501079_1336058_151_543 123
192 3300049764 Ga0501267_014830 Ga0501267_014830_233_604 123
193 3300049823 Ga0501044_0142419 Ga0501044_0142419_1561_1938 123
194 3300050489 nmdc:mga03683_147433_c1 nmdc:mga03683_147433_c1_130_504 123
195 3300050493 nmdc:mga0k408_486021_c1 nmdc:mga0k408_486021_c1_266_640 123
196 3300053086 Ga0500578_0035091 Ga0500578_0035091_555_926 123
197 3300053091 Ga0500647_0451775 Ga0500647_0451775_105_476 123
198 3300053092 Ga0500583_0109543 Ga0500583_0109543_105_479 123
199 3300053094 Ga0500566_0016265 Ga0500566_0016265_507_878 123
200 3300053095 Ga0500640_005421 Ga0500640_005421_3976_4347 123
201 3300053102 Ga0500554_001686 Ga0500554_001686_3035_3406 123
202 3300053105 Ga0500557_030638 Ga0500557_030638_793_1164 123
203 3300053119 Ga0500595_002152 Ga0500595_002152_9219_9590 123
204 3300053120 Ga0500597_023440 Ga0500597_023440_1410_1802 123
205 3300053120 Ga0500597_153568 Ga0500597_153568_431_802 123
206 3300053123 Ga0500614_001423 Ga0500614_001423_5224_5595 123
207 3300053123 Ga0500614_068470 Ga0500614_068470_163_555 123
208 3300053134 Ga0500658_0109308 Ga0500658_0109308_636_1010 123
209 3300053134 Ga0500658_0110177 Ga0500658_0110177_260_637 123
210 3300053136 Ga0500559_0023083 Ga0500559_0023083_1323_1694 123
211 3300053142 Ga0500577_0022921 Ga0500577_0022921_1223_1594 123
212 3300053144 Ga0500585_080767 Ga0500585_080767_454_825 123
213 3300053144 Ga0500585_283916 Ga0500585_283916_14_385 123
214 3300053151 Ga0500604_0016971 Ga0500604_0016971_236_607 123
215 3300053154 Ga0500619_136952 Ga0500619_136952_57_428 123
216 3300053156 Ga0500622_0173600 Ga0500622_0173600_184_555 123
217 3300053162 Ga0500638_047424 Ga0500638_047424_91_483 123
218 3300053178 Ga0500637_0585423 Ga0500637_0585423_102_494 123
219 3300060353 Ga0501082_0087185 Ga0501082_0087185_1969_2361 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00584

SecE

SecE/Sec61-gamma subunits of protein translocation complex

71

124

0.93

Feature Viewer

pLDDT pTM Quality
68.81 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map