F330331

General Info

Members Datasets Scaffolds Average Seq Length
218 169 436 132

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0183431|Ga0495642_0183431_412_879
Length 155
Sequence MAGSRQRRSAARKNLNKLKEAKMPMVRISLLKGKPRAYVQALSDGIHRAMVESFDVPRDDRFQVIHQHEPEELVFDRHYMGGPRSDDYVLICITAGKPRSTSMKEAFYRRLTEVLAESPGIDPKDVMVVIGMTSFDGWSFGNGVATLFPREEGEQ

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
43 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
82 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
83 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
110 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
111 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
112 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
155 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
161 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
165 2643221640 Caulobacter sp. Root342 Isolate Unclassified
166 2643221642 Caulobacter sp. Root343 Isolate Unclassified
167 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
168 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
169 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 0.92
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.84
Nodule 2.75
Rhizoplane 1.83
Rhizosphere 72.02
Stem 0
Stem Tuber 0
Unclassified 7.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0183431 3300046528 Bacteria 911
2 rootH2_10010672 3300003320 Bacteria 8204
3 rootH2_10088206 3300003320 Bacteria 3747
4 rootL2_10022117 3300003322 Bacteria 9981
5 rootL2_10155201 3300003322 Bacteria 1792
6 rootL2_10158166 3300003322 Bacteria 1026
7 rootH1_10012876 3300003323 Bacteria 4272
8 rootH1_10243540 3300003323 Bacteria 5844
9 Ga0055524_1000316 3300003775 Bacteria 45600
10 Ga0055540_1007955 3300003792 Bacteria 3896
11 Ga0055531_10006090 3300003794 Bacteria 6908
12 Ga0065165_1000001 3300005262 Bacteria 494087
13 Ga0070680_100232771 3300005336 Bacteria 1556
14 Ga0070682_100553065 3300005337 Bacteria 901
15 Ga0070660_100032077 3300005339 Bacteria 3950
16 Ga0070687_100096384 3300005343 Bacteria 1647
17 Ga0070661_100399449 3300005344 Unclassified 1086
18 Ga0070709_10236710 3300005434 Bacteria 1309
19 Ga0070701_10269859 3300005438 Bacteria 1035
20 Ga0070705_100002189 3300005440 Bacteria 9919
21 Ga0070694_100047470 3300005444 Bacteria 2886
22 Ga0070694_100113524 3300005444 Bacteria 1933
23 Ga0070708_100843108 3300005445 Bacteria 861
24 Ga0070707_100377213 3300005468 Bacteria 1378
25 Ga0070699_100023469 3300005518 Bacteria 5314
26 Ga0070679_100305499 3300005530 Bacteria 1541
27 Ga0070697_100034098 3300005536 Bacteria 4102
28 Ga0068853_100229256 3300005539 Bacteria 1699
29 Ga0070686_100063931 3300005544 Bacteria 2385
30 Ga0070695_100001685 3300005545 Bacteria 12462
31 Ga0070695_100016717 3300005545 Bacteria 4442
32 Ga0070695_100025412 3300005545 Bacteria 3657
33 Ga0070696_100052325 3300005546 Bacteria 2841
34 Ga0070696_100150383 3300005546 Bacteria 1708
35 Ga0070696_100323615 3300005546 Bacteria 1187
36 Ga0070696_100727282 3300005546 Bacteria 811
37 Ga0070693_100958270 3300005547 Unclassified 645
38 Ga0070704_100089650 3300005549 Bacteria 2288
39 Ga0070664_100875610 3300005564 Bacteria 841
40 Ga0070702_100149365 3300005615 Bacteria 1498
41 Ga0068859_100226296 3300005617 Bacteria 1958
42 Ga0068859_100344736 3300005617 Bacteria 1584
43 Ga0075365_11001131 3300006038 Bacteria 589
44 Ga0070716_100032862 3300006173 Bacteria 2834
45 Ga0075366_10236511 3300006195 Bacteria 1113
46 Ga0075366_10346081 3300006195 Bacteria 912
47 Ga0075366_10429751 3300006195 Bacteria 814
48 Ga0097621_100284095 3300006237 Bacteria 1457
49 Ga0075370_10028265 3300006353 Bacteria 3116
50 Ga0075370_10268507 3300006353 Bacteria 1012
51 Ga0068871_100092128 3300006358 Bacteria 2527
52 Ga0075434_100055068 3300006871 Bacteria 3952
53 Ga0075434_101826551 3300006871 Unclassified 614
54 Ga0068865_100676130 3300006881 Bacteria 880
55 Ga0075436_100251831 3300006914 Bacteria 1258
56 Ga0075436_101070690 3300006914 Unclassified 606
57 Ga0097620_100226295 3300006931 Bacteria 1958
58 Ga0097620_100344776 3300006931 Bacteria 1584
59 Ga0099824_1003466 3300006942 Bacteria 23028
60 Ga0099822_1003106 3300006943 Bacteria 21147
61 Ga0105240_10034207 3300009093 Bacteria 6558
62 Ga0105240_10046521 3300009093 Bacteria 5497
63 Ga0105240_10274802 3300009093 Unclassified 1939
64 Ga0105242_10094116 3300009176 Bacteria 2527
65 Ga0105248_10674034 3300009177 Bacteria 1167
66 Ga0105239_10014843 3300010375 Bacteria 8637
67 Ga0105239_10232483 3300010375 Bacteria 2068
68 Ga0105239_10455278 3300010375 Bacteria 1452
69 Ga0157319_1000017 3300012497 Bacteria 110340
70 Ga0157370_10000347 3300013104 Bacteria 58677
71 Ga0157370_10094918 3300013104 Bacteria 2798
72 Ga0157370_10372311 3300013104 Bacteria 1316
73 Ga0157370_12127052 3300013104 Unclassified 503
74 Ga0157369_10000553 3300013105 Bacteria 49107
75 Ga0157376_10488029 3300014969 Bacteria 1208
76 Ga0213872_10052645 3300021361 Unclassified 1847
77 Ga0213875_10249632 3300021388 Bacteria 837
78 Ga0209676_1123254 3300025292 Bacteria 516
79 Ga0209564_1025215 3300025295 Bacteria 2009
80 Ga0209256_1000249 3300025299 Bacteria 95279
81 Ga0207426_1044586 3300025302 Bacteria 1355
82 Ga0209051_1001995 3300025303 Bacteria 15619
83 Ga0209257_1003717 3300025304 Bacteria 12677
84 Ga0207647_10012276 3300025904 Bacteria 5969
85 Ga0207654_10402061 3300025911 Bacteria 952
86 Ga0207695_10036842 3300025913 Bacteria 5282
87 Ga0207695_10043902 3300025913 Bacteria 4759
88 Ga0207695_11629022 3300025913 Unclassified 526
89 Ga0207660_10072875 3300025917 Bacteria 2502
90 Ga0207662_10334212 3300025918 Bacteria 1014
91 Ga0207657_10041895 3300025919 Bacteria 4044
92 Ga0207652_11329776 3300025921 Unclassified 621
93 Ga0207690_10024941 3300025932 Bacteria 3749
94 Ga0207686_10174266 3300025934 Bacteria 1520
95 Ga0207670_10127287 3300025936 Bacteria 1860
96 Ga0207704_10266419 3300025938 Bacteria 1295
97 Ga0207704_10352206 3300025938 Bacteria 1147
98 Ga0207665_10186092 3300025939 Bacteria 1507
99 Ga0207679_10517565 3300025945 Bacteria 1067
100 Ga0207667_10031616 3300025949 Bacteria 5711
101 Ga0207667_10055522 3300025949 Bacteria 4163
102 Ga0207640_10009868 3300025981 Bacteria 5359
103 Ga0207639_11044899 3300026041 Bacteria 765
104 Ga0207678_10013646 3300026067 Bacteria 7135
105 Ga0207678_10520223 3300026067 Bacteria 1038
106 Ga0207702_10017523 3300026078 Bacteria 5925
107 Ga0207675_101145770 3300026118 Bacteria 798
108 Ga0207698_10003558 3300026142 Bacteria 9395
109 Ga0209371_1016920 3300027312 Bacteria 1907
110 Ga0209589_1000046 3300027357 Bacteria 118780
111 Ga0209489_100106 3300027361 Bacteria 118780
112 Ga0209700_100105 3300027363 Bacteria 118780
113 Ga0307515_10006164 3300028794 Bacteria 24103
114 Ga0307515_10382130 3300028794 Bacteria 1040
115 Ga0268256_1018834 3300030500 Bacteria 1907
116 Ga0307513_10133176 3300031456 Bacteria 2427
117 Ga0307509_10416680 3300031507 Bacteria 1045
118 Ga0307408_100032949 3300031548 Bacteria 3616
119 Ga0265313_10001237 3300031595 Bacteria 24347
120 Ga0316579_10175479 3300031691 Bacteria 1036
121 Ga0316578_10052050 3300031728 Bacteria 2399
122 Ga0316583_10071905 3300032133 Bacteria 1210
123 Ga0373923_0205185 3300035111 Bacteria 912
124 Ga0373939_0150930 3300035114 Unclassified 846
125 Ga0373960_0180314 3300035121 Bacteria 737
126 Ga0373935_0218313 3300035692 Bacteria 1323
127 Ga0373927_0007004 3300035695 Bacteria 7652
128 Ga0373937_0206277 3300036401 Unclassified 1848
129 Ga0316582_0191885 3300036647 Bacteria 1392
130 Ga0316584_0023303 3300036712 Bacteria 4523
131 Ga0373925_0742001 3300037068 Bacteria 809
132 Ga0395899_0002532 3300037312 Bacteria 14801
133 Ga0395899_0157237 3300037312 Bacteria 1608
134 Ga0395900_0037282 3300037418 Bacteria 5013
135 Ga0395898_0233128 3300037466 Bacteria 1755
136 Ga0395905_0084434 3300037471 Bacteria 2975
137 Ga0436364_0438111 3300037853 Bacteria 888
138 Ga0436364_0865186 3300037853 Bacteria 2226
139 Ga0395901_0021771 3300038443 Bacteria 6569
140 Ga0436361_0178808 3300039447 Unclassified 647
141 Ga0451806_058020 3300041462 Bacteria 838
142 Ga0439454_008321 3300042011 Bacteria 1323
143 Ga0450890_005274 3300042127 Bacteria 1664
144 Ga0439459_0002231 3300042438 Bacteria 2967
145 Ga0439459_0065268 3300042438 Bacteria 831
146 Ga0466969_0104446 3300044656 Bacteria 1331
147 Ga0466969_0159141 3300044656 Bacteria 1038
148 Ga0466969_0603545 3300044656 Unclassified 504
149 Ga0466965_0007376 3300044683 Bacteria 5047
150 Ga0466965_0025334 3300044683 Bacteria 2871
151 Ga0466966_0325642 3300044684 Bacteria 923
152 Ga0466961_0769868 3300044693 Bacteria 575
153 Ga0466963_0279960 3300044694 Bacteria 1172
154 Ga0466964_0055682 3300044706 Bacteria 1633
155 Ga0466968_0017068 3300044735 Bacteria 2896
156 Ga0466968_0041152 3300044735 Bacteria 1950
157 Ga0466968_0068327 3300044735 Bacteria 1543
158 Ga0466968_0157071 3300044735 Bacteria 1048
159 Ga0466957_0061873 3300044842 Bacteria 2299
160 Ga0466960_0017968 3300044901 Bacteria 3093
161 Ga0466960_0630354 3300044901 Bacteria 638
162 Ga0466959_0027434 3300045049 Bacteria 4225
163 Ga0466967_0578103 3300045976 Bacteria 1107
164 Ga0466967_0952100 3300045976 Bacteria 854
165 Ga0495638_0020110 3300046460 Bacteria 4412
166 Ga0495583_0272265 3300046506 Bacteria 676
167 Ga0495606_0103497 3300046507 Bacteria 1729
168 Ga0495606_0215085 3300046507 Bacteria 1086
169 Ga0495597_0077202 3300046542 Bacteria 1428
170 Ga0495597_0140499 3300046542 Bacteria 996
171 Ga0495668_0004254 3300046616 Bacteria 10283
172 Ga0495625_0029870 3300046660 Bacteria 4071
173 Ga0495673_0001955 3300047469 Bacteria 15295
174 Ga0495673_0004884 3300047469 Bacteria 8280
175 Ga0495686_0172436 3300047472 Bacteria 1257
176 Ga0496102_0332957 3300048905 Bacteria 1430
177 Ga0496106_0000005 3300048909 Bacteria 273394
178 Ga0496106_0000659 3300048909 Bacteria 24702
179 Ga0496117_0071392 3300048920 Unclassified 2327
180 Ga0496118_0107261 3300048921 Bacteria 1865
181 Ga0496121_0000083 3300048924 Bacteria 226816
182 Ga0496124_0110397 3300048927 Bacteria 2214
183 Ga0496124_0506749 3300048927 Bacteria 808
184 Ga0496125_0604783 3300048928 Bacteria 598
185 Ga0496126_0014705 3300048929 Bacteria 7897
186 Ga0501068_0371229 3300049584 Bacteria 921
187 Ga0501069_0697871 3300049585 Bacteria 612
188 Ga0501073_0091369 3300049589 Bacteria 2116
189 Ga0501230_091766 3300049667 Bacteria 646
190 Ga0501035_0066100 3300049822 Bacteria 3210
191 Ga0501044_0001496 3300049823 Bacteria 27380
192 nmdc:mga0yw44_604502_c1 3300050492 Bacteria 745
193 nmdc:mga0k408_446582_c1 3300050493 Unclassified 768
194 nmdc:mga0k408_49367_c1 3300050493 Bacteria 2435
195 nmdc:mga0k408_69115_c1 3300050493 Bacteria 2061
196 nmdc:mga07m45_412478_c1 3300050496 Bacteria 784
197 nmdc:mga05p37_964874_c1 3300050507 Bacteria 910
198 nmdc:mga0n895_19240_c1 3300050512 Bacteria 6341
199 nmdc:mga0rr50_137842_c1 3300050513 Bacteria 1960
200 nmdc:mga0rr50_331593_c1 3300050513 Bacteria 1277
201 nmdc:mga08x19_964196_c1 3300050514 Unclassified 606
202 nmdc:mga0a205_174467_c1 3300050515 Bacteria 2045
203 Ga0500578_0179820 3300053086 Bacteria 1304
204 Ga0500651_0533201 3300053093 Bacteria 644
205 Ga0500595_110282 3300053119 Bacteria 783
206 Ga0500614_208858 3300053123 Bacteria 603
207 Ga0500568_0000093 3300053139 Bacteria 83403
208 Ga0500622_0025261 3300053156 Bacteria 3139
209 Ga0500611_062113 3300053727 Unclassified 888
210 Ga0587090_037458 3300059510 Bacteria 839
211 Ga0587111_0112343 3300060346 Bacteria 692
212 Ga0466962_0218633 3300061719 Bacteria 933
213 2587917561 2585428106 Bacteria 5179711
214 2644226914 2643221640 Bacteria 5258820
215 2644233618 2643221642 Bacteria 5357871
216 2728754907 2728368998 Bacteria 8720350
217 2928536001 2928531327 Bacteria 5101314
218 8011351287 8011350971 Bacteria 6158957
219 Ga0495642_0183431
220 rootH2_10010672
221 rootH2_10088206
222 rootL2_10022117
223 rootL2_10155201
224 rootL2_10158166
225 rootH1_10012876
226 rootH1_10243540
227 Ga0055524_1000316
228 Ga0055540_1007955
229 Ga0055531_10006090
230 Ga0065165_1000001
231 Ga0070680_100232771
232 Ga0070682_100553065
233 Ga0070660_100032077
234 Ga0070687_100096384
235 Ga0070661_100399449
236 Ga0070709_10236710
237 Ga0070701_10269859
238 Ga0070705_100002189
239 Ga0070694_100047470
240 Ga0070694_100113524
241 Ga0070708_100843108
242 Ga0070707_100377213
243 Ga0070699_100023469
244 Ga0070679_100305499
245 Ga0070697_100034098
246 Ga0068853_100229256
247 Ga0070686_100063931
248 Ga0070695_100001685
249 Ga0070695_100016717
250 Ga0070695_100025412
251 Ga0070696_100052325
252 Ga0070696_100150383
253 Ga0070696_100323615
254 Ga0070696_100727282
255 Ga0070693_100958270
256 Ga0070704_100089650
257 Ga0070664_100875610
258 Ga0070702_100149365
259 Ga0068859_100226296
260 Ga0068859_100344736
261 Ga0075365_11001131
262 Ga0070716_100032862
263 Ga0075366_10236511
264 Ga0075366_10346081
265 Ga0075366_10429751
266 Ga0097621_100284095
267 Ga0075370_10028265
268 Ga0075370_10268507
269 Ga0068871_100092128
270 Ga0075434_100055068
271 Ga0075434_101826551
272 Ga0068865_100676130
273 Ga0075436_100251831
274 Ga0075436_101070690
275 Ga0097620_100226295
276 Ga0097620_100344776
277 Ga0099824_1003466
278 Ga0099822_1003106
279 Ga0105240_10034207
280 Ga0105240_10046521
281 Ga0105240_10274802
282 Ga0105242_10094116
283 Ga0105248_10674034
284 Ga0105239_10014843
285 Ga0105239_10232483
286 Ga0105239_10455278
287 Ga0157319_1000017
288 Ga0157370_10000347
289 Ga0157370_10094918
290 Ga0157370_10372311
291 Ga0157370_12127052
292 Ga0157369_10000553
293 Ga0157376_10488029
294 Ga0213872_10052645
295 Ga0213875_10249632
296 Ga0209676_1123254
297 Ga0209564_1025215
298 Ga0209256_1000249
299 Ga0207426_1044586
300 Ga0209051_1001995
301 Ga0209257_1003717
302 Ga0207647_10012276
303 Ga0207654_10402061
304 Ga0207695_10036842
305 Ga0207695_10043902
306 Ga0207695_11629022
307 Ga0207660_10072875
308 Ga0207662_10334212
309 Ga0207657_10041895
310 Ga0207652_11329776
311 Ga0207690_10024941
312 Ga0207686_10174266
313 Ga0207670_10127287
314 Ga0207704_10266419
315 Ga0207704_10352206
316 Ga0207665_10186092
317 Ga0207679_10517565
318 Ga0207667_10031616
319 Ga0207667_10055522
320 Ga0207640_10009868
321 Ga0207639_11044899
322 Ga0207678_10013646
323 Ga0207678_10520223
324 Ga0207702_10017523
325 Ga0207675_101145770
326 Ga0207698_10003558
327 Ga0209371_1016920
328 Ga0209589_1000046
329 Ga0209489_100106
330 Ga0209700_100105
331 Ga0307515_10006164
332 Ga0307515_10382130
333 Ga0268256_1018834
334 Ga0307513_10133176
335 Ga0307509_10416680
336 Ga0307408_100032949
337 Ga0265313_10001237
338 Ga0316579_10175479
339 Ga0316578_10052050
340 Ga0316583_10071905
341 Ga0373923_0205185
342 Ga0373939_0150930
343 Ga0373960_0180314
344 Ga0373935_0218313
345 Ga0373927_0007004
346 Ga0373937_0206277
347 Ga0316582_0191885
348 Ga0316584_0023303
349 Ga0373925_0742001
350 Ga0395899_0002532
351 Ga0395899_0157237
352 Ga0395900_0037282
353 Ga0395898_0233128
354 Ga0395905_0084434
355 Ga0436364_0438111
356 Ga0436364_0865186
357 Ga0395901_0021771
358 Ga0436361_0178808
359 Ga0451806_058020
360 Ga0439454_008321
361 Ga0450890_005274
362 Ga0439459_0002231
363 Ga0439459_0065268
364 Ga0466969_0104446
365 Ga0466969_0159141
366 Ga0466969_0603545
367 Ga0466965_0007376
368 Ga0466965_0025334
369 Ga0466966_0325642
370 Ga0466961_0769868
371 Ga0466963_0279960
372 Ga0466964_0055682
373 Ga0466968_0017068
374 Ga0466968_0041152
375 Ga0466968_0068327
376 Ga0466968_0157071
377 Ga0466957_0061873
378 Ga0466960_0017968
379 Ga0466960_0630354
380 Ga0466959_0027434
381 Ga0466967_0578103
382 Ga0466967_0952100
383 Ga0495638_0020110
384 Ga0495583_0272265
385 Ga0495606_0103497
386 Ga0495606_0215085
387 Ga0495597_0077202
388 Ga0495597_0140499
389 Ga0495668_0004254
390 Ga0495625_0029870
391 Ga0495673_0001955
392 Ga0495673_0004884
393 Ga0495686_0172436
394 Ga0496102_0332957
395 Ga0496106_0000005
396 Ga0496106_0000659
397 Ga0496117_0071392
398 Ga0496118_0107261
399 Ga0496121_0000083
400 Ga0496124_0110397
401 Ga0496124_0506749
402 Ga0496125_0604783
403 Ga0496126_0014705
404 Ga0501068_0371229
405 Ga0501069_0697871
406 Ga0501073_0091369
407 Ga0501230_091766
408 Ga0501035_0066100
409 Ga0501044_0001496
410 nmdc:mga0yw44_604502_c1
411 nmdc:mga0k408_446582_c1
412 nmdc:mga0k408_49367_c1
413 nmdc:mga0k408_69115_c1
414 nmdc:mga07m45_412478_c1
415 nmdc:mga05p37_964874_c1
416 nmdc:mga0n895_19240_c1
417 nmdc:mga0rr50_137842_c1
418 nmdc:mga0rr50_331593_c1
419 nmdc:mga08x19_964196_c1
420 nmdc:mga0a205_174467_c1
421 Ga0500578_0179820
422 Ga0500651_0533201
423 Ga0500595_110282
424 Ga0500614_208858
425 Ga0500568_0000093
426 Ga0500622_0025261
427 Ga0500611_062113
428 Ga0587090_037458
429 Ga0587111_0112343
430 Ga0466962_0218633
431 2587917561
432 2644226914
433 2644233618
434 2728754907
435 2928536001
436 8011351287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14552

Tautomerase_2

Tautomerase enzyme

60

141

0.99

PF01361

Tautomerase

Tautomerase enzyme

24

86

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lho-assembly1.cif.gz_A crystal structure of fg41malonate semialdehyde decarboxylase inhibited by 3-bromopropiolate 0.9501 3 126
2aag-assembly1.cif.gz_C crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities 0.9491 3 122
2aaj-assembly1.cif.gz_A crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities 0.9433 3 122
2x4k-assembly1.cif.gz_A crystal structure of sar1376, a putative 4-oxalocrotonate tautomerase from the methicillin-resistant staphylococcus aureus (mrsa) 0.9233 5 53
3mb2-assembly1.cif.gz_C kinetic and structural characterization of a heterohexamer 4-oxalocrotonate tautomerase from chloroflexus aurantiacus j-10-fl: implications for functional and structural diversity in the tautomerase superfamily 0.9154 5 51
ID Description Score Start End Superfamily
3mjzB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9523 3 126 3.30.429.10
2aagB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9484 3 122 3.30.429.10
3mb2I00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9323 5 48 3.30.429.10
4lkbC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9048 1 124 3.30.429.10
3mjzB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9027 3 126 3.30.429.10
ID Description Score Start End GO Terms
AF-A0A0B0HWR1-F1-model_v4 deleted 0.9918 1 122
AF-A0A7W6R9M0-F1-model_v4 Phenylpyruvate tautomerase PptA (4-oxalocrotonate tautomerase family) 0.9908 1 122
AF-A0A5D4N3A2-F1-model_v4 Tautomerase family protein 0.9889 1 122
AF-A0A6B8GTZ9-F1-model_v4 deleted 0.9882 1 122
AF-A0A1Q7P8V3-F1-model_v4 Tautomerase family protein 0.9881 20 122

Map