F329832

General Info

Members Datasets Scaffolds Average Seq Length
218 172 211 170

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100016359|Ga0075434_1000163596
Length 202
Sequence MASFIGQIELFAFDSVPPGWAKCDGSLVPINRNQALFALLGTSYGGDGRINFALPDLRGRVPIGLSQPFMLGQRSGEEAHTLSTAEMPAHAHMLMADAVSPGTGHVPAATAVLGRSSGMVAPSGPAFTANLYAAGSLGTSLNDGTVMPVGTGRPHENRMPSLALNFCICIDPHAPFPPRNRTVLGMVRSVLGSVSAPFRKRG

Samples

Sample ID Description Type Environment
1 2643221585 Pelomonas sp. Root662 Isolate Unclassified
2 2643221656 Pelomonas sp. Root405 Isolate Unclassified
3 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
4 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
5 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
6 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
135 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
136 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
137 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
138 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
139 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
140 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
141 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
142 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
150 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.82
Metatranscriptomes 16.97
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.63
Nodule 0.46
Rhizoplane 1.83
Rhizosphere 80.73
Stem 0
Stem Tuber 0
Unclassified 7.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1014280 3300002773 Bacteria 1618
2 JGI25150J39212_1000131 3300002774 Bacteria 41933
3 JGI25151J46595_10042062 3300003187 Bacteria 1651
4 JGI25406J46586_10059832 3300003203 Bacteria 1235
5 JGI25153J46596_10000036 3300003215 Bacteria 182205
6 Ga0055536_1020423 3300003781 Bacteria 2045
7 Ga0055530_10031889 3300003791 Bacteria 1378
8 Ga0055540_1004778 3300003792 Bacteria 5965
9 Ga0058859_11371178 3300004798 Bacteria 1963
10 Ga0070683_100100646 3300005329 Bacteria 2721
11 Ga0068869_100297471 3300005334 Bacteria 1302
12 Ga0070666_10180538 3300005335 Viruses 1480
13 Ga0070666_10699667 3300005335 Bacteria 743
14 Ga0070687_100011229 3300005343 Bacteria 3911
15 Ga0070687_100032632 3300005343 Unclassified 2563
16 Ga0070661_100076182 3300005344 Bacteria 2472
17 Ga0070671_100144075 3300005355 Bacteria 2011
18 Ga0070671_100719882 3300005355 Bacteria 866
19 Ga0070673_101032851 3300005364 Bacteria 766
20 Ga0070703_10000409 3300005406 Bacteria 17880
21 Ga0070700_100001738 3300005441 Bacteria 10951
22 Ga0070700_100215514 3300005441 Bacteria 1357
23 Ga0070694_100006503 3300005444 Bacteria 7098
24 Ga0070694_100111720 3300005444 Bacteria 1948
25 Ga0070694_100650325 3300005444 Bacteria 853
26 Ga0070681_10063962 3300005458 Bacteria 3651
27 Ga0068867_100078315 3300005459 Bacteria 2486
28 Ga0070706_100000415 3300005467 Bacteria 51304
29 Ga0070698_100232772 3300005471 Bacteria 1776
30 Ga0070699_100000061 3300005518 Bacteria 102321
31 Ga0070672_100299307 3300005543 Bacteria 1363
32 Ga0070686_100011635 3300005544 Bacteria 4997
33 Ga0070695_100018553 3300005545 Unclassified 4226
34 Ga0070696_100000418 3300005546 Bacteria 26530
35 Ga0070696_100303123 3300005546 Bacteria 1224
36 Ga0070693_100000842 3300005547 Bacteria 13656
37 Ga0070693_100027584 3300005547 Bacteria 3080
38 Ga0068855_100000288 3300005563 Bacteria 62320
39 Ga0068856_100341382 3300005614 Bacteria 1516
40 Ga0068852_100001804 3300005616 Bacteria 14535
41 Ga0068852_100005819 3300005616 Bacteria 8852
42 Ga0068852_100018577 3300005616 Bacteria 5480
43 Ga0068851_10305710 3300005834 Bacteria 915
44 Ga0068860_101672725 3300005843 Unclassified 658
45 Ga0068862_100004165 3300005844 Bacteria 12250
46 Ga0068862_100173907 3300005844 Bacteria 1929
47 Ga0081539_10002485 3300005985 Bacteria 25925
48 Ga0075362_10073615 3300006177 Bacteria 1564
49 Ga0097621_100195128 3300006237 Bacteria 1755
50 Ga0075370_10289898 3300006353 Bacteria 973
51 Ga0075430_100023918 3300006846 Bacteria 5202
52 Ga0075431_100024257 3300006847 Bacteria 6212
53 Ga0075434_100016359 3300006871 Bacteria 7130
54 Ga0068865_100083668 3300006881 Unclassified 2297
55 Ga0075436_100310109 3300006914 Bacteria 1132
56 Ga0075435_100221918 3300007076 Bacteria 1605
57 Ga0105240_10000091 3300009093 Bacteria 182507
58 Ga0105240_10444706 3300009093 Bacteria 1452
59 Ga0111539_10230793 3300009094 Bacteria 2155
60 Ga0111539_10347484 3300009094 Bacteria 1726
61 Ga0105247_10014746 3300009101 Bacteria 4684
62 Ga0114129_10253398 3300009147 Bacteria 2362
63 Ga0105241_11070501 3300009174 Bacteria 758
64 Ga0105248_10517216 3300009177 Bacteria 1346
65 Ga0105237_10165068 3300009545 Bacteria 2213
66 Ga0105238_10029341 3300009551 Bacteria 5603
67 Ga0105238_10036297 3300009551 Bacteria 5009
68 Ga0105238_10351576 3300009551 Bacteria 1463
69 Ga0105249_10808547 3300009553 Bacteria 1002
70 Ga0105239_10002938 3300010375 Bacteria 21270
71 Ga0105239_10059593 3300010375 Bacteria 4190
72 Ga0157369_10000428 3300013105 Bacteria 55858
73 Ga0157369_10073425 3300013105 Bacteria 3670
74 Ga0157374_10412147 3300013296 Bacteria 1349
75 Ga0157378_11409917 3300013297 Bacteria 740
76 Ga0163162_11608165 3300013306 Bacteria 741
77 Ga0163163_10128780 3300014325 Bacteria 2570
78 Ga0182008_10061116 3300014497 Bacteria 1857
79 Ga0157379_10550891 3300014968 Bacteria 1073
80 Ga0182007_10097355 3300015262 Bacteria 972
81 Ga0213876_10018098 3300021384 Bacteria 3717
82 Ga0207425_1000037 3300025245 Bacteria 224645
83 Ga0209129_1000520 3300025258 Bacteria 27282
84 Ga0209565_1015897 3300025263 Bacteria 1685
85 Ga0209676_1009744 3300025292 Bacteria 4103
86 Ga0209025_1000117 3300025294 Bacteria 215073
87 Ga0209758_1000103 3300025297 Bacteria 223968
88 Ga0209758_1003582 3300025297 Bacteria 13902
89 Ga0209050_1000001 3300025298 Bacteria 3563507
90 Ga0209257_1000949 3300025304 Bacteria 40020
91 Ga0209257_1001068 3300025304 Bacteria 36202
92 Ga0207653_10000012 3300025885 Bacteria 159557
93 Ga0207710_10292396 3300025900 Bacteria 822
94 Ga0207680_10155882 3300025903 Viruses 1527
95 Ga0207684_10000682 3300025910 Bacteria 40247
96 Ga0207695_10000018 3300025913 Bacteria 766611
97 Ga0207695_10045692 3300025913 Bacteria 4647
98 Ga0207663_10216606 3300025916 Bacteria 1391
99 Ga0207662_10005898 3300025918 Bacteria 6572
100 Ga0207694_10000010 3300025924 Bacteria 439722
101 Ga0207694_10017477 3300025924 Bacteria 5420
102 Ga0207700_10170984 3300025928 Bacteria 1813
103 Ga0207709_10229477 3300025935 Bacteria 1344
104 Ga0207670_10051505 3300025936 Bacteria 2765
105 Ga0207670_10341891 3300025936 Bacteria 1183
106 Ga0207704_10043031 3300025938 Unclassified 2663
107 Ga0207711_10782775 3300025941 Bacteria 889
108 Ga0207689_10436099 3300025942 Bacteria 1094
109 Ga0207679_10628152 3300025945 Bacteria 970
110 Ga0207667_10000234 3300025949 Bacteria 77157
111 Ga0207668_10513151 3300025972 Bacteria 1033
112 Ga0207639_10041118 3300026041 Bacteria 3456
113 Ga0207708_10005244 3300026075 Bacteria 9545
114 Ga0207708_10417121 3300026075 Bacteria 1113
115 Ga0207702_10190383 3300026078 Bacteria 1895
116 Ga0207648_10119810 3300026089 Bacteria 2313
117 Ga0207698_10000578 3300026142 Bacteria 21400
118 Ga0207698_10009409 3300026142 Bacteria 6231
119 Ga0207698_10084409 3300026142 Bacteria 2575
120 Ga0268265_10000134 3300028380 Bacteria 94630
121 Ga0268265_10385867 3300028380 Bacteria 1290
122 Ga0268264_11139152 3300028381 Viruses 789
123 Ga0265331_10065307 3300031250 Bacteria 1711
124 Ga0265327_10003748 3300031251 Bacteria 14132
125 Ga0307408_100031903 3300031548 Bacteria 3671
126 Ga0307516_10031968 3300031730 Bacteria 5303
127 Ga0307405_10195515 3300031731 Bacteria 1464
128 Ga0307413_10044507 3300031824 Unclassified 2624
129 Ga0307406_10090353 3300031901 Bacteria 2060
130 Ga0307407_10047543 3300031903 Bacteria 2436
131 Ga0307412_10052891 3300031911 Bacteria 2691
132 Ga0307416_100011202 3300032002 Bacteria 5961
133 Ga0307507_10066235 3300033179 Bacteria 3314
134 Ga0373929_0000008 3300035085 Bacteria 298561
135 Ga0395900_0278777 3300037418 Bacteria 1664
136 Ga0395898_1103243 3300037466 Bacteria 727
137 Ga0395901_0108121 3300038443 Bacteria 2919
138 Ga0395901_0629107 3300038443 Bacteria 1079
139 Ga0436365_1684465 3300039437 Bacteria 57800
140 Ga0439453_0027421 3300041408 Bacteria 1061
141 Ga0453684_0016168 3300044712 Bacteria 11700
142 Ga0453684_0202817 3300044712 Bacteria 2311
143 Ga0451576_0064132 3300045051 Bacteria 3827
144 Ga0495645_0009549 3300046543 Bacteria 6784
145 Ga0495599_0121353 3300046678 Bacteria 1624
146 Ga0495686_0028833 3300047472 Bacteria 3614
147 Ga0496102_0577082 3300048905 Bacteria 1047
148 Ga0496106_0413329 3300048909 Bacteria 1084
149 Ga0496110_0100848 3300048913 Bacteria 2588
150 Ga0496112_0018328 3300048915 Bacteria 6590
151 Ga0496118_0035318 3300048921 Bacteria 4061
152 Ga0496118_0127371 3300048921 Bacteria 1643
153 Ga0496119_0251496 3300048922 Bacteria 891
154 Ga0496121_0022486 3300048924 Bacteria 6118
155 Ga0496124_0379598 3300048927 Bacteria 989
156 Ga0496126_0184504 3300048929 Unclassified 1770
157 Ga0496126_0253115 3300048929 Bacteria 1467
158 Ga0495682_0016031 3300049460 Bacteria 2835
159 Ga0501292_010824 3300049515 Bacteria 1372
160 Ga0501202_001961 3300049652 Bacteria 3392
161 Ga0501217_005141 3300049661 Bacteria 2723
162 Ga0501223_045613 3300049663 Bacteria 851
163 Ga0501235_011393 3300049669 Bacteria 1951
164 Ga0501272_011864 3300049769 Bacteria 985
165 Ga0501274_007532 3300049771 Bacteria 960
166 Ga0501280_041181 3300049776 Bacteria 750
167 nmdc:mga07m45_354486_c1 3300050496 Bacteria 852
168 nmdc:mga05p37_70461_c1 3300050507 Bacteria 4300
169 nmdc:mga06r32_765_c1 3300050510 Bacteria 28335
170 nmdc:mga08y16_101691_c1 3300050511 Bacteria 2992
171 nmdc:mga08y16_966646_c1 3300050511 Bacteria 834
172 nmdc:mga0n895_9726_c1 3300050512 Bacteria 8432
173 nmdc:mga0rr50_48798_c1 3300050513 Bacteria 3131
174 Ga0500595_006443 3300053119 Unclassified 4978
175 Ga0587084_006125 3300059477 Bacteria 1448
176 Ga0587084_006179 3300059477 Bacteria 1443
177 Ga0587084_041542 3300059477 Bacteria 783
178 Ga0587084_091188 3300059477 Bacteria 605
179 Ga0587066_005194 3300059490 Bacteria 1653
180 Ga0587066_057518 3300059490 Bacteria 784
181 Ga0587070_023364 3300059491 Bacteria 1061
182 Ga0587070_064991 3300059491 Bacteria 764
183 Ga0587077_077805 3300059493 Bacteria 755
184 Ga0587080_090371 3300059503 Bacteria 641
185 Ga0587082_080496 3300059504 Bacteria 678
186 Ga0587082_099018 3300059504 Bacteria 633
187 Ga0587083_0013468 3300059505 Bacteria 1393
188 Ga0587083_0075729 3300059505 Bacteria 791
189 Ga0587085_002151 3300059506 Bacteria 1972
190 Ga0587085_019851 3300059506 Bacteria 1011
191 Ga0587092_046573 3300059512 Bacteria 772
192 Ga0587092_064172 3300059512 Bacteria 694
193 Ga0587106_028606 3300059605 Bacteria 880
194 Ga0587125_031706 3300059607 Bacteria 678
195 Ga0587101_107376 3300059623 Bacteria 562
196 Ga0587062_033330 3300059639 Bacteria 800
197 Ga0587062_065126 3300059639 Bacteria 648
198 Ga0587062_084921 3300059639 Bacteria 594
199 Ga0587067_077554 3300059640 Bacteria 729
200 Ga0587072_089707 3300059643 Bacteria 676
201 Ga0587076_008376 3300059645 Bacteria 1442
202 Ga0587076_043760 3300059645 Bacteria 847
203 Ga0587078_013118 3300059646 Bacteria 978
204 Ga0587079_012184 3300059647 Bacteria 1400
205 Ga0587079_063424 3300059647 Bacteria 807
206 Ga0587110_004874 3300059654 Bacteria 1186
207 Ga0587110_018756 3300059654 Bacteria 767
208 Ga0587071_023756 3300060344 Bacteria 1140
209 Ga0587111_0022816 3300060346 Bacteria 1219
210 Ga0587111_0026520 3300060346 Bacteria 1155
211 Ga0530510_0075764 3300061734 Bacteria 2443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0009549 Ga0495645_0009549_5630_6133 138
2 3300046678 Ga0495599_0121353 Ga0495599_0121353_750_1253 138
3 3300005546 Ga0070696_100303123 Ga0070696_1003031232 143
4 3300005547 Ga0070693_100027584 Ga0070693_1000275842 143
5 3300044712 Ga0453684_0202817 Ga0453684_0202817_604_1101 144
6 3300045051 Ga0451576_0064132 Ga0451576_0064132_2296_2793 144
7 3300049771 Ga0501274_007532 Ga0501274_007532_30_473 146
8 3300005335 Ga0070666_10180538 Ga0070666_101805382 148
9 3300005441 Ga0070700_100001738 Ga0070700_1000017384 148
10 3300025903 Ga0207680_10155882 Ga0207680_101558822 148
11 3300026075 Ga0207708_10005244 Ga0207708_100052444 148
12 3300059503 Ga0587080_090371 Ga0587080_090371_123_593 155
13 3300005343 Ga0070687_100011229 Ga0070687_1000112294 157
14 3300025918 Ga0207662_10005898 Ga0207662_100058984 157
15 3300031548 Ga0307408_100031903 Ga0307408_1000319033 157
16 3300031731 Ga0307405_10195515 Ga0307405_101955152 157
17 3300031824 Ga0307413_10044507 Ga0307413_100445072 157
18 3300031901 Ga0307406_10090353 Ga0307406_100903533 157
19 3300031903 Ga0307407_10047543 Ga0307407_100475432 157
20 3300031911 Ga0307412_10052891 Ga0307412_100528915 157
21 3300032002 Ga0307416_100011202 Ga0307416_1000112022 157
22 3300050511 nmdc:mga08y16_966646_c1 nmdc:mga08y16_966646_c1_326_805 158
23 3300005343 Ga0070687_100032632 Ga0070687_1000326323 159
24 3300005406 Ga0070703_10000409 Ga0070703_1000040911 159
25 3300005441 Ga0070700_100215514 Ga0070700_1002155142 159
26 3300005444 Ga0070694_100111720 Ga0070694_1001117203 159
27 3300005467 Ga0070706_100000415 Ga0070706_10000041541 159
28 3300005518 Ga0070699_100000061 Ga0070699_10000006154 159
29 3300005545 Ga0070695_100018553 Ga0070695_1000185535 159
30 3300005546 Ga0070696_100000418 Ga0070696_1000004187 159
31 3300005547 Ga0070693_100000842 Ga0070693_1000008423 159
32 3300009174 Ga0105241_11070501 Ga0105241_110705012 159
33 3300009551 Ga0105238_10351576 Ga0105238_103515762 159
34 3300013296 Ga0157374_10412147 Ga0157374_104121472 159
35 3300014497 Ga0182008_10061116 Ga0182008_100611163 159
36 3300014968 Ga0157379_10550891 Ga0157379_105508911 159
37 3300015262 Ga0182007_10097355 Ga0182007_100973551 159
38 3300025885 Ga0207653_10000012 Ga0207653_1000001299 159
39 3300025900 Ga0207710_10292396 Ga0207710_102923962 159
40 3300025910 Ga0207684_10000682 Ga0207684_1000068220 159
41 3300025913 Ga0207695_10045692 Ga0207695_100456922 159
42 3300026075 Ga0207708_10417121 Ga0207708_104171212 159
43 3300031250 Ga0265331_10065307 Ga0265331_100653073 159
44 3300031251 Ga0265327_10003748 Ga0265327_100037486 159
45 3300048913 Ga0496110_0100848 Ga0496110_0100848_415_921 159
46 3300048915 Ga0496112_0018328 Ga0496112_0018328_1601_2107 159
47 3300010375 Ga0105239_10002938 Ga0105239_100029384 160
48 3300013105 Ga0157369_10073425 Ga0157369_100734254 160
49 3300003791 Ga0055530_10031889 Ga0055530_100318892 161
50 3300005459 Ga0068867_100078315 Ga0068867_1000783153 161
51 3300006881 Ga0068865_100083668 Ga0068865_1000836681 161
52 3300013306 Ga0163162_11608165 Ga0163162_116081652 161
53 3300025938 Ga0207704_10043031 Ga0207704_100430311 161
54 3300026089 Ga0207648_10119810 Ga0207648_101198102 161
55 iso_pu_bacteria 2643221585 2643934120 162
56 iso_pu_bacteria 2643221656 2644315607 162
57 iso_pu_bacteria 3004334049 3004337010 162
58 3300005334 Ga0068869_100297471 Ga0068869_1002974712 163
59 3300025936 Ga0207670_10051505 Ga0207670_100515052 163
60 3300025942 Ga0207689_10436099 Ga0207689_104360992 163
61 3300005355 Ga0070671_100719882 Ga0070671_1007198822 164
62 3300005616 Ga0068852_100005819 Ga0068852_1000058197 164
63 3300005834 Ga0068851_10305710 Ga0068851_103057102 164
64 3300025297 Ga0209758_1003582 Ga0209758_10035823 164
65 3300026142 Ga0207698_10009409 Ga0207698_100094093 164
66 3300026142 Ga0207698_10084409 Ga0207698_100844094 164
67 3300048921 Ga0496118_0035318 Ga0496118_0035318_95_637 164
68 3300048922 Ga0496119_0251496 Ga0496119_0251496_134_676 164
69 3300048924 Ga0496121_0022486 Ga0496121_0022486_4887_5429 164
70 3300048927 Ga0496124_0379598 Ga0496124_0379598_182_724 164
71 3300048929 Ga0496126_0184504 Ga0496126_0184504_335_877 164
72 3300053119 Ga0500595_006443 Ga0500595_006443_216_758 164
73 3300004798 Ga0058859_11371178 Ga0058859_113711783 165
74 3300005329 Ga0070683_100100646 Ga0070683_1001006464 165
75 3300005335 Ga0070666_10699667 Ga0070666_106996672 165
76 3300005344 Ga0070661_100076182 Ga0070661_1000761823 165
77 3300005355 Ga0070671_100144075 Ga0070671_1001440752 165
78 3300005364 Ga0070673_101032851 Ga0070673_1010328511 165
79 3300005458 Ga0070681_10063962 Ga0070681_100639624 165
80 3300005543 Ga0070672_100299307 Ga0070672_1002993072 165
81 3300005563 Ga0068855_100000288 Ga0068855_10000028822 165
82 3300005614 Ga0068856_100341382 Ga0068856_1003413822 165
83 3300005616 Ga0068852_100001804 Ga0068852_10000180413 165
84 3300005616 Ga0068852_100018577 Ga0068852_1000185771 165
85 3300005844 Ga0068862_100004165 Ga0068862_1000041652 165
86 3300005844 Ga0068862_100173907 Ga0068862_1001739071 165
87 3300006237 Ga0097621_100195128 Ga0097621_1001951282 165
88 3300006846 Ga0075430_100023918 Ga0075430_1000239182 165
89 3300006847 Ga0075431_100024257 Ga0075431_1000242575 165
90 3300006871 Ga0075434_100016359 Ga0075434_1000163596 165
91 3300006914 Ga0075436_100310109 Ga0075436_1003101092 165
92 3300007076 Ga0075435_100221918 Ga0075435_1002219182 165
93 3300009093 Ga0105240_10000091 Ga0105240_1000009177 165
94 3300009093 Ga0105240_10444706 Ga0105240_104447061 165
95 3300009094 Ga0111539_10347484 Ga0111539_103474842 165
96 3300009101 Ga0105247_10014746 Ga0105247_100147464 165
97 3300009177 Ga0105248_10517216 Ga0105248_105172162 165
98 3300009545 Ga0105237_10165068 Ga0105237_101650684 165
99 3300009551 Ga0105238_10036297 Ga0105238_100362974 165
100 3300009553 Ga0105249_10808547 Ga0105249_108085472 165
101 3300010375 Ga0105239_10059593 Ga0105239_100595934 165
102 3300013105 Ga0157369_10000428 Ga0157369_1000042842 165
103 3300021384 Ga0213876_10018098 Ga0213876_100180982 165
104 3300025913 Ga0207695_10000018 Ga0207695_10000018179 165
105 3300025916 Ga0207663_10216606 Ga0207663_102166062 165
106 3300025924 Ga0207694_10000010 Ga0207694_10000010464 165
107 3300025928 Ga0207700_10170984 Ga0207700_101709842 165
108 3300025941 Ga0207711_10782775 Ga0207711_107827751 165
109 3300025949 Ga0207667_10000234 Ga0207667_1000023458 165
110 3300025972 Ga0207668_10513151 Ga0207668_105131511 165
111 3300026041 Ga0207639_10041118 Ga0207639_100411184 165
112 3300026078 Ga0207702_10190383 Ga0207702_101903832 165
113 3300026142 Ga0207698_10000578 Ga0207698_1000057813 165
114 3300028380 Ga0268265_10000134 Ga0268265_1000013425 165
115 3300028380 Ga0268265_10385867 Ga0268265_103858671 165
116 3300031730 Ga0307516_10031968 Ga0307516_100319687 165
117 3300037418 Ga0395900_0278777 Ga0395900_0278777_838_1407 165
118 3300038443 Ga0395901_0108121 Ga0395901_0108121_1538_2107 165
119 3300039437 Ga0436365_1684465 Ga0436365_1684465_21887_22420 165
120 3300049460 Ga0495682_0016031 Ga0495682_0016031_1420_1953 165
121 3300050510 nmdc:mga06r32_765_c1 nmdc:mga06r32_765_c1_12937_13437 165
122 3300050511 nmdc:mga08y16_101691_c1 nmdc:mga08y16_101691_c1_1063_1671 165
123 3300050512 nmdc:mga0n895_9726_c1 nmdc:mga0n895_9726_c1_6553_7161 165
124 3300050513 nmdc:mga0rr50_48798_c1 nmdc:mga0rr50_48798_c1_840_1448 165
125 iso_pu_bacteria 2929177148 2929180399 165
126 iso_pu_bacteria 2945977869 2945982792 165
127 iso_pu_bacteria 2946013367 2946017815 165
128 3300005444 Ga0070694_100006503 Ga0070694_1000065038 166
129 3300005843 Ga0068860_101672725 Ga0068860_1016727251 166
130 3300006177 Ga0075362_10073615 Ga0075362_100736152 166
131 3300006353 Ga0075370_10289898 Ga0075370_102898982 166
132 3300009147 Ga0114129_10253398 Ga0114129_102533984 166
133 3300013297 Ga0157378_11409917 Ga0157378_114099171 166
134 3300014325 Ga0163163_10128780 Ga0163163_101287802 166
135 3300025936 Ga0207670_10341891 Ga0207670_103418912 166
136 3300025945 Ga0207679_10628152 Ga0207679_106281522 166
137 3300028381 Ga0268264_11139152 Ga0268264_111391521 166
138 3300033179 Ga0307507_10066235 Ga0307507_100662352 166
139 3300035085 Ga0373929_0000008 Ga0373929_0000008_107684_108187 166
140 3300041408 Ga0439453_0027421 Ga0439453_0027421_153_653 166
141 3300048909 Ga0496106_0413329 Ga0496106_0413329_163_663 166
142 3300050496 nmdc:mga07m45_354486_c1 nmdc:mga07m45_354486_c1_221_763 166
143 3300050507 nmdc:mga05p37_70461_c1 nmdc:mga05p37_70461_c1_1610_2110 166
144 3300059477 Ga0587084_041542 Ga0587084_041542_209_712 166
145 3300059477 Ga0587084_091188 Ga0587084_091188_17_526 166
146 3300059490 Ga0587066_005194 Ga0587066_005194_75_584 166
147 3300059490 Ga0587066_057518 Ga0587066_057518_193_696 166
148 3300059491 Ga0587070_023364 Ga0587070_023364_484_993 166
149 3300059491 Ga0587070_064991 Ga0587070_064991_156_659 166
150 3300059504 Ga0587082_099018 Ga0587082_099018_101_604 166
151 3300059505 Ga0587083_0013468 Ga0587083_0013468_85_594 166
152 3300059505 Ga0587083_0075729 Ga0587083_0075729_80_583 166
153 3300059506 Ga0587085_002151 Ga0587085_002151_38_541 166
154 3300059506 Ga0587085_019851 Ga0587085_019851_415_924 166
155 3300059512 Ga0587092_046573 Ga0587092_046573_93_596 166
156 3300059605 Ga0587106_028606 Ga0587106_028606_25_534 166
157 3300059607 Ga0587125_031706 Ga0587125_031706_135_644 166
158 3300059623 Ga0587101_107376 Ga0587101_107376_19_528 166
159 3300059639 Ga0587062_033330 Ga0587062_033330_70_573 166
160 3300059639 Ga0587062_065126 Ga0587062_065126_91_600 166
161 3300059640 Ga0587067_077554 Ga0587067_077554_81_584 166
162 3300059645 Ga0587076_008376 Ga0587076_008376_825_1334 166
163 3300059647 Ga0587079_012184 Ga0587079_012184_811_1314 166
164 3300059647 Ga0587079_063424 Ga0587079_063424_222_725 166
165 3300059654 Ga0587110_004874 Ga0587110_004874_111_620 166
166 3300059654 Ga0587110_018756 Ga0587110_018756_93_596 166
167 3300060344 Ga0587071_023756 Ga0587071_023756_597_1106 166
168 3300060346 Ga0587111_0026520 Ga0587111_0026520_572_1075 166
169 iso_pu_bacteria 8056689827 8056693915 166
170 3300003792 Ga0055540_1004778 Ga0055540_10047785 167
171 3300005444 Ga0070694_100650325 Ga0070694_1006503252 167
172 3300005471 Ga0070698_100232772 Ga0070698_1002327721 167
173 3300009551 Ga0105238_10029341 Ga0105238_100293412 167
174 3300025292 Ga0209676_1009744 Ga0209676_10097448 167
175 3300025298 Ga0209050_1000001 Ga0209050_10000013423 167
176 3300025304 Ga0209257_1000949 Ga0209257_10009495 167
177 3300025304 Ga0209257_1001068 Ga0209257_10010685 167
178 3300025924 Ga0207694_10017477 Ga0207694_100174778 167
179 3300037466 Ga0395898_1103243 Ga0395898_1103243_22_525 167
180 3300038443 Ga0395901_0629107 Ga0395901_0629107_414_917 167
181 3300048905 Ga0496102_0577082 Ga0496102_0577082_83_586 167
182 3300048921 Ga0496118_0127371 Ga0496118_0127371_585_1088 167
183 3300059477 Ga0587084_006125 Ga0587084_006125_110_613 167
184 3300059477 Ga0587084_006179 Ga0587084_006179_105_608 167
185 3300059493 Ga0587077_077805 Ga0587077_077805_134_637 167
186 3300059504 Ga0587082_080496 Ga0587082_080496_128_631 167
187 3300059512 Ga0587092_064172 Ga0587092_064172_135_638 167
188 3300059639 Ga0587062_084921 Ga0587062_084921_15_518 167
189 3300059643 Ga0587072_089707 Ga0587072_089707_134_637 167
190 3300059645 Ga0587076_043760 Ga0587076_043760_50_553 167
191 3300059646 Ga0587078_013118 Ga0587078_013118_50_553 167
192 3300060346 Ga0587111_0022816 Ga0587111_0022816_659_1162 167
193 3300061734 Ga0530510_0075764 Ga0530510_0075764_380_889 167
194 3300003203 JGI25406J46586_10059832 JGI25406J46586_100598322 168
195 3300005544 Ga0070686_100011635 Ga0070686_1000116354 168
196 3300005985 Ga0081539_10002485 Ga0081539_100024858 168
197 3300025935 Ga0207709_10229477 Ga0207709_102294771 168
198 3300044712 Ga0453684_0016168 Ga0453684_0016168_2876_3430 168
199 3300047472 Ga0495686_0028833 Ga0495686_0028833_1275_1838 168
200 3300049515 Ga0501292_010824 Ga0501292_010824_579_1088 168
201 3300049652 Ga0501202_001961 Ga0501202_001961_876_1385 168
202 3300049661 Ga0501217_005141 Ga0501217_005141_2088_2597 168
203 3300049663 Ga0501223_045613 Ga0501223_045613_171_680 168
204 3300049669 Ga0501235_011393 Ga0501235_011393_1155_1664 168
205 3300049769 Ga0501272_011864 Ga0501272_011864_229_738 168
206 3300049776 Ga0501280_041181 Ga0501280_041181_148_657 168
207 3300009094 Ga0111539_10230793 Ga0111539_102307932 169
208 3300048929 Ga0496126_0253115 Ga0496126_0253115_77_589 170
209 3300002773 JGI25152J39213_1014280 JGI25152J39213_10142802 172
210 3300002774 JGI25150J39212_1000131 JGI25150J39212_100013125 172
211 3300003187 JGI25151J46595_10042062 JGI25151J46595_100420623 172
212 3300003215 JGI25153J46596_10000036 JGI25153J46596_10000036129 172
213 3300003781 Ga0055536_1020423 Ga0055536_10204232 172
214 3300025245 Ga0207425_1000037 Ga0207425_100003725 172
215 3300025258 Ga0209129_1000520 Ga0209129_10005209 172
216 3300025263 Ga0209565_1015897 Ga0209565_10158971 172
217 3300025294 Ga0209025_1000117 Ga0209025_1000117147 172
218 3300025297 Ga0209758_1000103 Ga0209758_100010325 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

6

62

0.99

Feature Viewer

pLDDT pTM Quality
63.84 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map