F328653

General Info

Members Datasets Scaffolds Average Seq Length
217 112 434 259

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100308955|Ga0075430_1003089552
Length 282
Sequence MTPPDELSTISPGEPEKEHDMLRSLFTAATGMTAQQQHIDVISNNLANVNTTGFKRARADFQDLLYQTLREPGAASSNQTEIPTGIQVGLGVRTAAVQRLFLEGDFQQTQNHLDIAIDGAGFFQIQRPDGEIAYSRAGSFKLDSQGRVVNSDGFPVEPEITIPNDAVSITVGTDGTVSVLQAGNTTPQQVGQIQLANFPNPAGLSGQERSLFQRTTASGDPITGAPSQGGLGGLSQGVLEISNVSVVEEMVNLISGQRAYEINSKAIQASDEMLQTAANLRR

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
52 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
55 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
56 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
59 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
60 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
77 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
78 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
79 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
80 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
101 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 5.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 0
Rhizosphere 91.71
Stem 0
Stem Tuber 0
Unclassified 9.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100308955 3300006846 Bacteria 1308
2 rootH2_10047803 3300003320 Bacteria 8806
3 JGI25405J52794_10000479 3300003911 Bacteria 5732
4 Ga0065704_10141718 3300005289 Bacteria 1511
5 Ga0070658_10001095 3300005327 Bacteria 23111
6 Ga0070658_10313542 3300005327 Bacteria 1338
7 Ga0070666_10110794 3300005335 Unclassified 1898
8 Ga0070680_100548136 3300005336 Bacteria 991
9 Ga0068868_100078733 3300005338 Bacteria 2639
10 Ga0070660_100007233 3300005339 Bacteria 7725
11 Ga0070706_100000627 3300005467 Bacteria 40631
12 Ga0070699_100072592 3300005518 Unclassified 2994
13 Ga0070697_100001527 3300005536 Bacteria 17609
14 Ga0068856_100085560 3300005614 Eukaryota 3132
15 Ga0081455_10003218 3300005937 Bacteria 18907
16 Ga0081538_10000485 3300005981 Bacteria 44591
17 Ga0081538_10005437 3300005981 Bacteria 11438
18 Ga0081539_10013237 3300005985 Bacteria 6239
19 Ga0070717_10181932 3300006028 Unclassified 1833
20 Ga0075364_10040416 3300006051 Bacteria 3025
21 Ga0075427_10000362 3300006194 Bacteria 5011
22 Ga0075428_100011257 3300006844 Bacteria 9950
23 Ga0075428_100176815 3300006844 Bacteria 2311
24 Ga0075428_100521841 3300006844 Unclassified 1270
25 Ga0075430_100112591 3300006846 Unclassified 2269
26 Ga0075430_100216535 3300006846 Bacteria 1589
27 Ga0075429_100026349 3300006880 Bacteria 5047
28 Ga0105240_10396546 3300009093 Bacteria 1555
29 Ga0114129_10082017 3300009147 Bacteria 4482
30 Ga0114129_10122957 3300009147 Bacteria 3570
31 Ga0114129_10599317 3300009147 Bacteria 1427
32 Ga0105238_10028010 3300009551 Bacteria 5741
33 Ga0105238_10185511 3300009551 Eukaryota 2056
34 Ga0157374_10071330 3300013296 Bacteria 3275
35 Ga0163162_10072068 3300013306 Bacteria 3509
36 Ga0157379_10069618 3300014968 Bacteria 3147
37 Ga0163161_10334500 3300017792 Unclassified 1200
38 Ga0213876_10002459 3300021384 Bacteria 10878
39 Ga0207680_10122678 3300025903 Bacteria 1701
40 Ga0207705_10002584 3300025909 Bacteria 13907
41 Ga0207684_10000467 3300025910 Bacteria 52492
42 Ga0207695_10318314 3300025913 Bacteria 1445
43 Ga0207657_10011491 3300025919 Bacteria 8791
44 Ga0207681_10269680 3300025923 Bacteria 1336
45 Ga0207694_10118381 3300025924 Eukaryota 2113
46 Ga0207712_10009582 3300025961 Bacteria 6133
47 Ga0207677_10311373 3300026023 Bacteria 1305
48 Ga0207702_10069779 3300026078 Unclassified 3022
49 Ga0265319_1016654 3300028563 Bacteria 2816
50 Ga0265323_10051781 3300028653 Bacteria 1455
51 Ga0265336_10061311 3300028666 Bacteria 1128
52 Ga0265338_10106910 3300028800 Bacteria 2264
53 Ga0265324_10002183 3300029957 Bacteria 10246
54 Ga0265324_10014875 3300029957 Bacteria 2867
55 Ga0265324_10021309 3300029957 Bacteria 2325
56 Ga0265330_10000390 3300031235 Bacteria 30198
57 Ga0265320_10019227 3300031240 Bacteria 3740
58 Ga0265325_10067568 3300031241 Bacteria 1801
59 Ga0265331_10030999 3300031250 Bacteria 2660
60 Ga0265327_10001275 3300031251 Bacteria 33175
61 Ga0265316_10001247 3300031344 Bacteria 27368
62 Ga0265316_10321985 3300031344 Bacteria 1123
63 Ga0316575_10005710 3300031665 Bacteria 4444
64 Ga0316575_10030410 3300031665 Bacteria 2111
65 Ga0316579_10011372 3300031691 Bacteria 3782
66 Ga0316579_10016536 3300031691 Bacteria 3224
67 Ga0316579_10026806 3300031691 Bacteria 2612
68 Ga0316579_10079074 3300031691 Bacteria 1564
69 Ga0265314_10002704 3300031711 Bacteria 17748
70 Ga0316576_10002218 3300031727 Bacteria 10975
71 Ga0316576_10005946 3300031727 Bacteria 7535
72 Ga0316576_10027157 3300031727 Bacteria 4022
73 Ga0316576_10268991 3300031727 Bacteria 1278
74 Ga0316576_10282336 3300031727 Bacteria 1243
75 Ga0316576_10327628 3300031727 Unclassified 1142
76 Ga0316578_10001445 3300031728 Bacteria 9647
77 Ga0316578_10255923 3300031728 Bacteria 1050
78 Ga0316577_10008850 3300031733 Bacteria 5401
79 Ga0316577_10064158 3300031733 Bacteria 2050
80 Ga0316577_10066301 3300031733 Bacteria 2016
81 Ga0316577_10095903 3300031733 Bacteria 1661
82 Ga0316577_10124533 3300031733 Bacteria 1449
83 Ga0307416_100379650 3300032002 Bacteria 1443
84 Ga0307416_100524605 3300032002 Bacteria 1253
85 Ga0316583_10011350 3300032133 Unclassified 3211
86 Ga0316583_10013116 3300032133 Bacteria 2991
87 Ga0316583_10027212 3300032133 Bacteria 2041
88 Ga0316583_10060100 3300032133 Bacteria 1332
89 Ga0316585_10004473 3300032137 Bacteria 3895
90 Ga0316585_10005002 3300032137 Bacteria 3728
91 Ga0316585_10028855 3300032137 Bacteria 1736
92 Ga0316580_10002628 3300032139 Bacteria 4987
93 Ga0316580_10002806 3300032139 Bacteria 4854
94 Ga0316580_10018745 3300032139 Bacteria 2130
95 Ga0316580_10032279 3300032139 Unclassified 1621
96 Ga0316593_10002291 3300032168 Bacteria 4490
97 Ga0316593_10003745 3300032168 Bacteria 3819
98 Ga0316593_10006171 3300032168 Bacteria 3220
99 Ga0316593_10006447 3300032168 Bacteria 3167
100 Ga0316593_10007656 3300032168 Bacteria 2973
101 Ga0316593_10072712 3300032168 Bacteria 1191
102 Ga0316592_1000399 3300033524 Bacteria 5806
103 Ga0316592_1008038 3300033524 Bacteria 2073
104 Ga0316592_1009031 3300033524 Bacteria 1988
105 Ga0316588_1002611 3300033528 Bacteria 3159
106 Ga0316596_1001668 3300033541 Bacteria 4577
107 Ga0316596_1012957 3300033541 Bacteria 2056
108 Ga0316574_0046648 3300035398 Bacteria 2687
109 Ga0316574_0051492 3300035398 Bacteria 2566
110 Ga0316574_0077138 3300035398 Unclassified 2111
111 Ga0316574_0130254 3300035398 Bacteria 1618
112 Ga0373927_0003806 3300035695 Bacteria 10706
113 Ga0316582_0001486 3300036647 Bacteria 10342
114 Ga0316582_0003341 3300036647 Bacteria 7845
115 Ga0316582_0003379 3300036647 Bacteria 7817
116 Ga0316582_0041021 3300036647 Unclassified 2891
117 Ga0316582_0102599 3300036647 Bacteria 1896
118 Ga0316582_0169258 3300036647 Bacteria 1483
119 Ga0316582_0181755 3300036647 Bacteria 1431
120 Ga0316582_0193341 3300036647 Bacteria 1386
121 Ga0316582_0300783 3300036647 Bacteria 1102
122 Ga0316582_0301159 3300036647 Unclassified 1102
123 Ga0316584_0004683 3300036712 Bacteria 9066
124 Ga0316584_0012741 3300036712 Bacteria 5935
125 Ga0316584_0015209 3300036712 Bacteria 5499
126 Ga0316584_0047142 3300036712 Unclassified 3219
127 Ga0316584_0062861 3300036712 Bacteria 2780
128 Ga0316584_0133767 3300036712 Unclassified 1851
129 Ga0316584_0193401 3300036712 Bacteria 1503
130 Ga0373925_0100224 3300037068 Bacteria 2225
131 Ga0395899_0030222 3300037312 Bacteria 4075
132 Ga0395900_0578250 3300037418 Bacteria 1065
133 Ga0395898_0456062 3300037466 Bacteria 1217
134 Ga0395905_0058931 3300037471 Bacteria 3590
135 Ga0395905_0487566 3300037471 Bacteria 1132
136 Ga0395905_0503999 3300037471 Bacteria 1111
137 Ga0316581_0009499 3300037588 Bacteria 2674
138 Ga0316581_0082427 3300037588 Bacteria 990
139 Ga0316581_0107880 3300037588 Unclassified 857
140 Ga0395901_0015519 3300038443 Bacteria 7757
141 Ga0400484_31866 3300038725 Bacteria 8931
142 Ga0400488_16182 3300038741 Bacteria 6830
143 Ga0400488_31123 3300038741 Bacteria 14048
144 Ga0400483_010601 3300039062 Bacteria 1479
145 Ga0400483_073539 3300039062 Bacteria 12084
146 Ga0400483_162830 3300039062 Bacteria 4694
147 Ga0400489_68375 3300039093 Bacteria 25878
148 Ga0400489_71700 3300039093 Bacteria 1032
149 Ga0400487_39064 3300039110 Bacteria 1380
150 Ga0436365_0959540 3300039437 Bacteria 1428
151 Ga0436365_1850017 3300039437 Bacteria 18349
152 Ga0451837_1640356 3300041494 Bacteria 1915
153 Ga0451577_0003031 3300042876 Bacteria 19102
154 Ga0451577_0003077 3300042876 Bacteria 18865
155 Ga0451577_0017181 3300042876 Bacteria 6687
156 Ga0451577_0046461 3300042876 Bacteria 3885
157 Ga0451577_0072505 3300042876 Bacteria 3072
158 Ga0451577_0088147 3300042876 Unclassified 2769
159 Ga0451577_0146318 3300042876 Bacteria 2125
160 Ga0453683_0000165 3300044673 Bacteria 94483
161 Ga0453683_0087300 3300044673 Bacteria 1955
162 Ga0453683_0168873 3300044673 Bacteria 1385
163 Ga0453684_0000123 3300044712 Bacteria 339304
164 Ga0453684_0000737 3300044712 Bacteria 114674
165 Ga0453684_0000903 3300044712 Bacteria 99008
166 Ga0453684_0001709 3300044712 Bacteria 59094
167 Ga0453684_0002620 3300044712 Bacteria 42992
168 Ga0453684_0008846 3300044712 Bacteria 17848
169 Ga0453684_0015970 3300044712 Bacteria 11801
170 Ga0453684_0016638 3300044712 Bacteria 11477
171 Ga0453684_0020150 3300044712 Bacteria 10089
172 Ga0453684_0021975 3300044712 Bacteria 9495
173 Ga0453684_0033922 3300044712 Bacteria 7101
174 Ga0453684_0191629 3300044712 Bacteria 2391
175 Ga0453684_0249175 3300044712 Bacteria 2040
176 Ga0453684_0764987 3300044712 Bacteria 1044
177 Ga0453684_0967909 3300044712 Unclassified 907
178 Ga0453684_1055151 3300044712 Bacteria 861
179 Ga0466957_0235506 3300044842 Bacteria 1213
180 Ga0466957_0450649 3300044842 Bacteria 887
181 Ga0451576_0000260 3300045051 Bacteria 129222
182 Ga0451576_0034036 3300045051 Bacteria 5413
183 Ga0451576_0129981 3300045051 Bacteria 2625
184 Ga0451576_0255828 3300045051 Bacteria 1830
185 Ga0451576_0260664 3300045051 Bacteria 1812
186 Ga0451576_0629560 3300045051 Bacteria 1127
187 Ga0466958_0251699 3300045836 Bacteria 1130
188 Ga0496125_0006239 3300048928 Bacteria 12963
189 Ga0496125_0124303 3300048928 Bacteria 1832
190 Ga0501032_0037867 3300049569 Bacteria 3287
191 Ga0501033_0259010 3300049570 Bacteria 1231
192 Ga0501034_0025710 3300049571 Bacteria 5996
193 Ga0501036_0379410 3300049572 Bacteria 1180
194 Ga0501037_0085554 3300049573 Bacteria 2283
195 Ga0501037_0214642 3300049573 Bacteria 1356
196 Ga0501039_0443255 3300049575 Bacteria 1020
197 Ga0501040_0277634 3300049576 Bacteria 1197
198 Ga0501043_0074731 3300049579 Bacteria 2662
199 Ga0501047_0052881 3300049581 Bacteria 3926
200 Ga0501071_0284797 3300049587 Bacteria 1251
201 Ga0501074_0238797 3300049590 Bacteria 1293
202 Ga0501075_0192021 3300049591 Bacteria 1558
203 Ga0501077_0126357 3300049593 Bacteria 1621
204 Ga0501080_0056445 3300049742 Bacteria 3657
205 Ga0501035_0012545 3300049822 Bacteria 7828
206 Ga0501035_0332807 3300049822 Bacteria 1274
207 Ga0501044_0014462 3300049823 Bacteria 8518
208 nmdc:mga00v17_19822_c1 3300050491 Bacteria 3846
209 nmdc:mga05p37_102264_c1 3300050507 Bacteria 3529
210 nmdc:mga05p37_323675_c1 3300050507 Unclassified 1824
211 nmdc:mga05p37_38322_c1 3300050507 Bacteria 5880
212 nmdc:mga09592_133093_c1 3300050508 Bacteria 2141
213 nmdc:mga09592_248181_c1 3300050508 Unclassified 1543
214 nmdc:mga0qj67_132465_c1 3300050509 Unclassified 2019
215 nmdc:mga06r32_302293_c1 3300050510 Bacteria 1586
216 nmdc:mga08y16_16130_c1 3300050511 Bacteria 7854
217 Ga0530510_0055104 3300061734 Bacteria 2873
218 Ga0075430_100308955
219 rootH2_10047803
220 JGI25405J52794_10000479
221 Ga0065704_10141718
222 Ga0070658_10001095
223 Ga0070658_10313542
224 Ga0070666_10110794
225 Ga0070680_100548136
226 Ga0068868_100078733
227 Ga0070660_100007233
228 Ga0070706_100000627
229 Ga0070699_100072592
230 Ga0070697_100001527
231 Ga0068856_100085560
232 Ga0081455_10003218
233 Ga0081538_10000485
234 Ga0081538_10005437
235 Ga0081539_10013237
236 Ga0070717_10181932
237 Ga0075364_10040416
238 Ga0075427_10000362
239 Ga0075428_100011257
240 Ga0075428_100176815
241 Ga0075428_100521841
242 Ga0075430_100112591
243 Ga0075430_100216535
244 Ga0075429_100026349
245 Ga0105240_10396546
246 Ga0114129_10082017
247 Ga0114129_10122957
248 Ga0114129_10599317
249 Ga0105238_10028010
250 Ga0105238_10185511
251 Ga0157374_10071330
252 Ga0163162_10072068
253 Ga0157379_10069618
254 Ga0163161_10334500
255 Ga0213876_10002459
256 Ga0207680_10122678
257 Ga0207705_10002584
258 Ga0207684_10000467
259 Ga0207695_10318314
260 Ga0207657_10011491
261 Ga0207681_10269680
262 Ga0207694_10118381
263 Ga0207712_10009582
264 Ga0207677_10311373
265 Ga0207702_10069779
266 Ga0265319_1016654
267 Ga0265323_10051781
268 Ga0265336_10061311
269 Ga0265338_10106910
270 Ga0265324_10002183
271 Ga0265324_10014875
272 Ga0265324_10021309
273 Ga0265330_10000390
274 Ga0265320_10019227
275 Ga0265325_10067568
276 Ga0265331_10030999
277 Ga0265327_10001275
278 Ga0265316_10001247
279 Ga0265316_10321985
280 Ga0316575_10005710
281 Ga0316575_10030410
282 Ga0316579_10011372
283 Ga0316579_10016536
284 Ga0316579_10026806
285 Ga0316579_10079074
286 Ga0265314_10002704
287 Ga0316576_10002218
288 Ga0316576_10005946
289 Ga0316576_10027157
290 Ga0316576_10268991
291 Ga0316576_10282336
292 Ga0316576_10327628
293 Ga0316578_10001445
294 Ga0316578_10255923
295 Ga0316577_10008850
296 Ga0316577_10064158
297 Ga0316577_10066301
298 Ga0316577_10095903
299 Ga0316577_10124533
300 Ga0307416_100379650
301 Ga0307416_100524605
302 Ga0316583_10011350
303 Ga0316583_10013116
304 Ga0316583_10027212
305 Ga0316583_10060100
306 Ga0316585_10004473
307 Ga0316585_10005002
308 Ga0316585_10028855
309 Ga0316580_10002628
310 Ga0316580_10002806
311 Ga0316580_10018745
312 Ga0316580_10032279
313 Ga0316593_10002291
314 Ga0316593_10003745
315 Ga0316593_10006171
316 Ga0316593_10006447
317 Ga0316593_10007656
318 Ga0316593_10072712
319 Ga0316592_1000399
320 Ga0316592_1008038
321 Ga0316592_1009031
322 Ga0316588_1002611
323 Ga0316596_1001668
324 Ga0316596_1012957
325 Ga0316574_0046648
326 Ga0316574_0051492
327 Ga0316574_0077138
328 Ga0316574_0130254
329 Ga0373927_0003806
330 Ga0316582_0001486
331 Ga0316582_0003341
332 Ga0316582_0003379
333 Ga0316582_0041021
334 Ga0316582_0102599
335 Ga0316582_0169258
336 Ga0316582_0181755
337 Ga0316582_0193341
338 Ga0316582_0300783
339 Ga0316582_0301159
340 Ga0316584_0004683
341 Ga0316584_0012741
342 Ga0316584_0015209
343 Ga0316584_0047142
344 Ga0316584_0062861
345 Ga0316584_0133767
346 Ga0316584_0193401
347 Ga0373925_0100224
348 Ga0395899_0030222
349 Ga0395900_0578250
350 Ga0395898_0456062
351 Ga0395905_0058931
352 Ga0395905_0487566
353 Ga0395905_0503999
354 Ga0316581_0009499
355 Ga0316581_0082427
356 Ga0316581_0107880
357 Ga0395901_0015519
358 Ga0400484_31866
359 Ga0400488_16182
360 Ga0400488_31123
361 Ga0400483_010601
362 Ga0400483_073539
363 Ga0400483_162830
364 Ga0400489_68375
365 Ga0400489_71700
366 Ga0400487_39064
367 Ga0436365_0959540
368 Ga0436365_1850017
369 Ga0451837_1640356
370 Ga0451577_0003031
371 Ga0451577_0003077
372 Ga0451577_0017181
373 Ga0451577_0046461
374 Ga0451577_0072505
375 Ga0451577_0088147
376 Ga0451577_0146318
377 Ga0453683_0000165
378 Ga0453683_0087300
379 Ga0453683_0168873
380 Ga0453684_0000123
381 Ga0453684_0000737
382 Ga0453684_0000903
383 Ga0453684_0001709
384 Ga0453684_0002620
385 Ga0453684_0008846
386 Ga0453684_0015970
387 Ga0453684_0016638
388 Ga0453684_0020150
389 Ga0453684_0021975
390 Ga0453684_0033922
391 Ga0453684_0191629
392 Ga0453684_0249175
393 Ga0453684_0764987
394 Ga0453684_0967909
395 Ga0453684_1055151
396 Ga0466957_0235506
397 Ga0466957_0450649
398 Ga0451576_0000260
399 Ga0451576_0034036
400 Ga0451576_0129981
401 Ga0451576_0255828
402 Ga0451576_0260664
403 Ga0451576_0629560
404 Ga0466958_0251699
405 Ga0496125_0006239
406 Ga0496125_0124303
407 Ga0501032_0037867
408 Ga0501033_0259010
409 Ga0501034_0025710
410 Ga0501036_0379410
411 Ga0501037_0085554
412 Ga0501037_0214642
413 Ga0501039_0443255
414 Ga0501040_0277634
415 Ga0501043_0074731
416 Ga0501047_0052881
417 Ga0501071_0284797
418 Ga0501074_0238797
419 Ga0501075_0192021
420 Ga0501077_0126357
421 Ga0501080_0056445
422 Ga0501035_0012545
423 Ga0501035_0332807
424 Ga0501044_0014462
425 nmdc:mga00v17_19822_c1
426 nmdc:mga05p37_102264_c1
427 nmdc:mga05p37_323675_c1
428 nmdc:mga05p37_38322_c1
429 nmdc:mga09592_133093_c1
430 nmdc:mga09592_248181_c1
431 nmdc:mga0qj67_132465_c1
432 nmdc:mga06r32_302293_c1
433 nmdc:mga08y16_16130_c1
434 Ga0530510_0055104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22692

LlgE_F_G_D1

Flagellar hook protein FlgE/F/G D1 domain

116

179

0.99

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

235

280

0.98

PF00460

Flg_bb_rod

Flagella basal body rod protein

25

55

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jf2-assembly1.cif.gz_A crystal structure of a 20kda fragment of flgg 0.9122 72 214
6jf2-assembly1.cif.gz_A crystal structure of a 20kda fragment of flgg 0.8943 72 214
5npy-assembly1.cif.gz_A crystal structure of helicobacter pylori flagellar hook protein flge2 0.8929 79 130
7nvg-assembly1.cif.gz_q2 salmonella flagellar basal body refined in c1 map 0.877 3 249
7cgo-assembly1.cif.gz_Q cryo-em structure of the flagellar motor-hook complex from salmonella 0.877 5 249
ID Description Score Start End Superfamily
af_Q9HAD4_3_206_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6096 119 163 2.130.10.10
af_P9WMT3_2_115_3.30.450.370 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.5943 135 170 3.30.450.370
af_A0A0P0XM22_1_129_2.30.30.490 Mainly Beta;Roll;SH3 type barrels.;Bromo adjacent homology (BAH) domain 0.4602 92 120 2.30.30.490
af_Q18968_861_1082_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.435 91 163 2.130.10.10
af_Q8IPH8_1456_1548_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.4179 94 163 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A7V7DUK7-F1-model_v4 Flagellar hook-basal body complex protein 0.9163 7 237 GO:0016020
GO:0030694
GO:0071978
AF-A0A383B2A2-F1-model_v4 Uncharacterized protein 0.9055 52 252 GO:0009288
GO:0071978
AF-A0A6M5YWU6-F1-model_v4 Flagellar basal-body rod protein FlgG 0.8999 2 250 GO:0009425
GO:0071978
AF-A0A359BNF8-F1-model_v4 Flagellar hook protein FlgE/F/G-like D1 domain-containing protein 0.8954 8 252 GO:0009425
GO:0071978
AF-A0A2E0FQU4-F1-model_v4 deleted 0.8947 1 252

Map