F328007

General Info

Members Datasets Scaffolds Average Seq Length
216 168 432 206

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0130928|Ga0496105_0130928_1073_1825
Length 239
Sequence VVRAIAHGASIAHARGPLNGRFIIRRDAWQGGGMAKYFDVHPVDPQPRAIGQAVEILRSGGLIAYPTDSCFALGCSLDNPEGKERILGIRHLDDKHHFTLVCADFAQLGQFVHLDNSVFRAIKAVTPGPYTFILPATKEVPRRLLHAKKKTVGVRIPEHPVVRELLRSLGEPILSSTLLLPDDDEPMTEGWEIKDRLDHLIDAVVDSGECGLEPTTVVDYSDGQPVVTRVGAGDPSPFE

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
65 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
66 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
67 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
68 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
69 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
78 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
79 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
135 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
136 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
137 2643221679 Angustibacter sp. Root456 Isolate Unclassified
138 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
139 2643221711 Terrabacter sp. Root85 Isolate Unclassified
140 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
141 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
142 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
143 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
144 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
145 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
146 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
147 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
148 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
149 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
150 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
151 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
152 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
153 2858882152 Micromonospora noduli MED15 Isolate Nodule
154 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
155 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
156 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
157 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
158 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
159 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
160 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
161 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
162 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
163 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
164 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
165 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
166 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
167 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
168 8054704163 Micromonospora trifolii NIE79 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.8
Metatranscriptomes 0.46
Isolates 15.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 1.39
Rhizoplane 16.67
Rhizosphere 64.81
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0130928 3300048908 Bacteria 2068
2 JGI24735J21928_10025254 3300002067 Bacteria 1794
3 JGI25406J46586_10061957 3300003203 Bacteria 1204
4 Ga0070670_100415266 3300005331 Bacteria 1189
5 Ga0070660_100358311 3300005339 Bacteria 1202
6 Ga0070668_100523640 3300005347 Bacteria 1029
7 Ga0070710_10002117 3300005437 Bacteria 9404
8 Ga0070678_100414582 3300005456 Bacteria 1173
9 Ga0070679_100100833 3300005530 Bacteria 2873
10 Ga0070684_100298730 3300005535 Bacteria 1477
11 Ga0070665_100128412 3300005548 Bacteria 2538
12 Ga0070664_100454516 3300005564 Bacteria 1176
13 Ga0068857_100017477 3300005577 Bacteria 6285
14 Ga0068864_100448188 3300005618 Bacteria 1234
15 Ga0068864_101437827 3300005618 Bacteria 692
16 Ga0068863_100396093 3300005841 Bacteria 1350
17 Ga0081455_10299260 3300005937 Bacteria 1155
18 Ga0081539_10011828 3300005985 Bacteria 6828
19 Ga0075364_10001223 3300006051 Bacteria 13814
20 Ga0097621_100395918 3300006237 Bacteria 1236
21 Ga0075428_100022965 3300006844 Bacteria 6903
22 Ga0075430_100040321 3300006846 Bacteria 3953
23 Ga0075431_100022045 3300006847 Bacteria 6513
24 Ga0075429_100012350 3300006880 Bacteria 7409
25 Ga0099794_10043686 3300007265 Bacteria 2140
26 Ga0114129_10024989 3300009147 Bacteria 8469
27 Ga0105243_10558988 3300009148 Bacteria 1095
28 Ga0105239_10168155 3300010375 Bacteria 2452
29 Ga0105246_10457719 3300011119 Bacteria 1074
30 Ga0157369_10174792 3300013105 Bacteria 2261
31 Ga0157369_10684326 3300013105 Bacteria 1057
32 Ga0157374_10566913 3300013296 Bacteria 1144
33 Ga0157375_10331514 3300013308 Bacteria 1687
34 Ga0157375_10469286 3300013308 Bacteria 1424
35 Ga0157375_11396692 3300013308 Bacteria 825
36 Ga0163163_11659425 3300014325 Bacteria 700
37 Ga0157376_10521433 3300014969 Bacteria 1171
38 Ga0157376_10960529 3300014969 Bacteria 875
39 Ga0163161_10172986 3300017792 Bacteria 1652
40 Ga0163161_10296168 3300017792 Bacteria 1273
41 Ga0163161_10364128 3300017792 Bacteria 1152
42 Ga0206353_11356457 3300020082 Bacteria 4320
43 Ga0207692_10000047 3300025898 Bacteria 36334
44 Ga0207693_10047770 3300025915 Bacteria 3362
45 Ga0207652_10515341 3300025921 Bacteria 1076
46 Ga0207650_10263599 3300025925 Bacteria 1398
47 Ga0207650_10689692 3300025925 Bacteria 862
48 Ga0207690_10803298 3300025932 Bacteria 777
49 Ga0207668_10004488 3300025972 Bacteria 8206
50 Ga0207668_10007882 3300025972 Bacteria 6331
51 Ga0207668_10277674 3300025972 Bacteria 1372
52 Ga0207668_10564323 3300025972 Bacteria 988
53 Ga0207658_10443377 3300025986 Bacteria 1148
54 Ga0207708_10961332 3300026075 Bacteria 741
55 Ga0207641_10672042 3300026088 Bacteria 1018
56 Ga0207676_10739573 3300026095 Bacteria 956
57 Ga0207674_10076483 3300026116 Bacteria 3355
58 Ga0207674_10293486 3300026116 Bacteria 1574
59 Ga0207675_100389151 3300026118 Bacteria 1372
60 Ga0207683_10056227 3300026121 Bacteria 3451
61 Ga0209588_1037546 3300027671 Bacteria 1559
62 Ga0268266_10491687 3300028379 Bacteria 1171
63 Ga0268264_11206143 3300028381 Bacteria 766
64 Ga0265334_10003294 3300028573 Bacteria 7365
65 Ga0265340_10010000 3300031247 Bacteria 5082
66 Ga0307513_10010061 3300031456 Bacteria 11913
67 Ga0307513_10321946 3300031456 Bacteria 1304
68 Ga0307509_10016610 3300031507 Bacteria 8510
69 Ga0307509_10087343 3300031507 Bacteria 3204
70 Ga0307408_100594082 3300031548 Bacteria 983
71 Ga0307508_10002349 3300031616 Bacteria 20029
72 Ga0307508_10129780 3300031616 Bacteria 2124
73 Ga0316576_10039099 3300031727 Bacteria 3405
74 Ga0316578_10300855 3300031728 Bacteria 959
75 Ga0307405_10399795 3300031731 Bacteria 1075
76 Ga0307410_10006875 3300031852 Bacteria 6180
77 Ga0307407_10741488 3300031903 Bacteria 743
78 Ga0307409_100001239 3300031995 Bacteria 12301
79 Ga0307409_100149100 3300031995 Bacteria 2028
80 Ga0316583_10136781 3300032133 Bacteria 854
81 Ga0373948_0005689 3300034817 Bacteria 2030
82 Ga0373938_0070056 3300034957 Bacteria 836
83 Ga0373939_0255417 3300035114 Bacteria 684
84 Ga0373942_0005991 3300035207 Bacteria 2808
85 Ga0373962_0004722 3300035242 Bacteria 3287
86 Ga0316574_0001255 3300035398 Bacteria 11831
87 Ga0395899_0014286 3300037312 Bacteria 6061
88 Ga0395900_0013650 3300037418 Bacteria 8294
89 Ga0395900_0027457 3300037418 Bacteria 5831
90 Ga0395900_0990151 3300037418 Bacteria 761
91 Ga0395898_0060503 3300037466 Bacteria 3680
92 Ga0395905_0039429 3300037471 Bacteria 4432
93 Ga0395905_0212273 3300037471 Bacteria 1813
94 Ga0395901_0028433 3300038443 Bacteria 5749
95 Ga0395901_0090845 3300038443 Bacteria 3196
96 Ga0395901_0115885 3300038443 Bacteria 2814
97 Ga0395901_0459517 3300038443 Bacteria 1301
98 Ga0436361_0326587 3300039447 Bacteria 1299
99 Ga0451789_1057467 3300041443 Bacteria 930
100 Ga0451791_0181160 3300041451 Bacteria 2235
101 Ga0451843_1284897 3300041509 Bacteria 778
102 Ga0466967_0002122 3300045976 Bacteria 12157
103 Ga0466967_0047086 3300045976 Bacteria 3758
104 Ga0495582_0301586 3300046473 Bacteria 921
105 Ga0495632_0157825 3300046519 Bacteria 1046
106 Ga0495667_0135761 3300046559 Bacteria 1586
107 Ga0495667_0505604 3300046559 Bacteria 757
108 Ga0495658_0063594 3300046683 Bacteria 2124
109 Ga0495613_0042939 3300046689 Bacteria 3345
110 Ga0495613_0232327 3300046689 Bacteria 1292
111 Ga0495680_0263942 3300047322 Bacteria 1217
112 Ga0496100_0008916 3300048903 Bacteria 5611
113 Ga0496100_0474925 3300048903 Bacteria 961
114 Ga0496101_0017828 3300048904 Bacteria 4819
115 Ga0496101_0189488 3300048904 Bacteria 1587
116 Ga0496102_0003438 3300048905 Bacteria 13424
117 Ga0496102_0159152 3300048905 Bacteria 2124
118 Ga0496102_0196121 3300048905 Bacteria 1903
119 Ga0496102_0247961 3300048905 Bacteria 1679
120 Ga0496103_0049882 3300048906 Bacteria 2588
121 Ga0496103_0062424 3300048906 Bacteria 2319
122 Ga0496103_0076319 3300048906 Bacteria 2103
123 Ga0496104_0005794 3300048907 Bacteria 10816
124 Ga0496104_0060967 3300048907 Bacteria 3574
125 Ga0496104_0092778 3300048907 Bacteria 2887
126 Ga0496105_0001817 3300048908 Bacteria 15279
127 Ga0496105_0005884 3300048908 Bacteria 9350
128 Ga0496105_0046171 3300048908 Bacteria 3595
129 Ga0496108_0568239 3300048911 Bacteria 989
130 Ga0496109_0054038 3300048912 Bacteria 3665
131 Ga0496109_0440379 3300048912 Bacteria 1231
132 Ga0496109_0882381 3300048912 Unclassified 832
133 Ga0496110_0054761 3300048913 Bacteria 3509
134 Ga0496110_0074185 3300048913 Bacteria 3021
135 Ga0496111_0077752 3300048914 Bacteria 2419
136 Ga0496111_0312419 3300048914 Bacteria 1164
137 Ga0496112_0053401 3300048915 Bacteria 3969
138 Ga0496112_0280155 3300048915 Bacteria 1615
139 Ga0496113_0078303 3300048916 Bacteria 2529
140 Ga0496113_0118765 3300048916 Bacteria 2065
141 Ga0496114_0003261 3300048917 Bacteria 12457
142 Ga0496114_0026296 3300048917 Bacteria 4763
143 Ga0496114_0344143 3300048917 Bacteria 1318
144 Ga0496114_0425371 3300048917 Bacteria 1176
145 Ga0496119_0000067 3300048922 Bacteria 162404
146 Ga0496120_0007267 3300048923 Bacteria 8278
147 Ga0496122_0000384 3300048925 Bacteria 94131
148 Ga0496123_0000074 3300048926 Bacteria 196689
149 Ga0496124_0000400 3300048927 Bacteria 79176
150 Ga0496124_0167746 3300048927 Bacteria 1704
151 Ga0496126_0571325 3300048929 Bacteria 894
152 Ga0501031_0047243 3300049568 Bacteria 2806
153 Ga0501032_0300662 3300049569 Bacteria 1037
154 Ga0501033_0027190 3300049570 Bacteria 4303
155 Ga0501034_0041331 3300049571 Bacteria 4665
156 Ga0501034_0245361 3300049571 Bacteria 1736
157 Ga0501036_0011498 3300049572 Bacteria 7329
158 Ga0501037_0205940 3300049573 Bacteria 1389
159 Ga0501038_0026422 3300049574 Bacteria 5171
160 Ga0501039_0003028 3300049575 Bacteria 12565
161 Ga0501040_0015850 3300049576 Bacteria 4980
162 Ga0501041_0017766 3300049577 Bacteria 4233
163 Ga0501042_0032884 3300049578 Bacteria 3674
164 Ga0501047_0695436 3300049581 Bacteria 834
165 Ga0501048_0001355 3300049582 Bacteria 18560
166 Ga0501068_0043461 3300049584 Bacteria 2704
167 Ga0501069_0227765 3300049585 Bacteria 1085
168 Ga0501071_0001162 3300049587 Bacteria 14756
169 Ga0501072_0049454 3300049588 Bacteria 3309
170 Ga0501074_0092729 3300049590 Bacteria 2163
171 Ga0501075_0015983 3300049591 Bacteria 5398
172 Ga0501081_0025142 3300049743 Bacteria 4004
173 Ga0501045_0030049 3300049824 Bacteria 3930
174 nmdc:mga00v17_648_c1 3300050491 Bacteria 19227
175 nmdc:mga05p37_85795_c1 3300050507 Bacteria 3880
176 nmdc:mga09592_11635_c1 3300050508 Bacteria 7157
177 nmdc:mga0qj67_82801_c1 3300050509 Bacteria 2573
178 nmdc:mga06r32_169821_c1 3300050510 Bacteria 2165
179 Ga0495619_0035220 3300053085 Bacteria 3256
180 Ga0501084_0001081 3300054114 Bacteria 21228
181 Ga0501082_0031095 3300060353 Bacteria 4601
182 Ga0530510_0020225 3300061734 Bacteria 4733
183 2643849920 2643221567 Bacteria 4163945
184 2644135922 2643221624 Bacteria 4384879
185 2644447043 2643221679 Bacteria 3839507
186 2644504518 2643221690 Bacteria 4654705
187 2644609752 2643221711 Bacteria 4865335
188 2753271389 2751185782 Bacteria 11227053
189 2808874225 2808606365 Bacteria 4301966
190 2812362948 2811994880 Bacteria 4147780
191 2812374912 2811994882 Bacteria 4688362
192 2819427654 2818991318 Bacteria 5266538
193 2819666511 2818991458 Bacteria 4794049
194 2819691669 2818991462 Bacteria 4320267
195 2819729551 2818991469 Bacteria 4644110
196 2839986839 2839986021 Bacteria 3685650
197 2855674800 2855670206 Bacteria 7120389
198 2855680497 2855676851 Bacteria 7063653
199 2857292684 2857288857 Bacteria 7189066
200 2858851251 2858848962 Bacteria 6963058
201 2858884209 2858882152 Bacteria 7230291
202 2858890854 2858888857 Bacteria 7060307
203 2858899472 2858895516 Bacteria 7378898
204 2866553918 2866552031 Bacteria 5824618
205 2869054836 2869048445 Bacteria 6875584
206 2869073323 2869068681 Bacteria 7205615
207 2880500123 2880495981 Bacteria 7340502
208 2891329900 2891326441 Bacteria 6439512
209 2917736993 2917736166 Bacteria 9690793
210 2919054583 2919051321 Bacteria 4210889
211 2919450339 2919446982 Bacteria 3994487
212 2932431859 2932431166 Bacteria 4215299
213 2945919006 2945916053 Bacteria 4555517
214 8001788127 8001781756 Bacteria 9586736
215 8003832379 8003830390 Bacteria 6541657
216 8054707643 8054704163 Bacteria 7247792
217 Ga0496105_0130928
218 JGI24735J21928_10025254
219 JGI25406J46586_10061957
220 Ga0070670_100415266
221 Ga0070660_100358311
222 Ga0070668_100523640
223 Ga0070710_10002117
224 Ga0070678_100414582
225 Ga0070679_100100833
226 Ga0070684_100298730
227 Ga0070665_100128412
228 Ga0070664_100454516
229 Ga0068857_100017477
230 Ga0068864_100448188
231 Ga0068864_101437827
232 Ga0068863_100396093
233 Ga0081455_10299260
234 Ga0081539_10011828
235 Ga0075364_10001223
236 Ga0097621_100395918
237 Ga0075428_100022965
238 Ga0075430_100040321
239 Ga0075431_100022045
240 Ga0075429_100012350
241 Ga0099794_10043686
242 Ga0114129_10024989
243 Ga0105243_10558988
244 Ga0105239_10168155
245 Ga0105246_10457719
246 Ga0157369_10174792
247 Ga0157369_10684326
248 Ga0157374_10566913
249 Ga0157375_10331514
250 Ga0157375_10469286
251 Ga0157375_11396692
252 Ga0163163_11659425
253 Ga0157376_10521433
254 Ga0157376_10960529
255 Ga0163161_10172986
256 Ga0163161_10296168
257 Ga0163161_10364128
258 Ga0206353_11356457
259 Ga0207692_10000047
260 Ga0207693_10047770
261 Ga0207652_10515341
262 Ga0207650_10263599
263 Ga0207650_10689692
264 Ga0207690_10803298
265 Ga0207668_10004488
266 Ga0207668_10007882
267 Ga0207668_10277674
268 Ga0207668_10564323
269 Ga0207658_10443377
270 Ga0207708_10961332
271 Ga0207641_10672042
272 Ga0207676_10739573
273 Ga0207674_10076483
274 Ga0207674_10293486
275 Ga0207675_100389151
276 Ga0207683_10056227
277 Ga0209588_1037546
278 Ga0268266_10491687
279 Ga0268264_11206143
280 Ga0265334_10003294
281 Ga0265340_10010000
282 Ga0307513_10010061
283 Ga0307513_10321946
284 Ga0307509_10016610
285 Ga0307509_10087343
286 Ga0307408_100594082
287 Ga0307508_10002349
288 Ga0307508_10129780
289 Ga0316576_10039099
290 Ga0316578_10300855
291 Ga0307405_10399795
292 Ga0307410_10006875
293 Ga0307407_10741488
294 Ga0307409_100001239
295 Ga0307409_100149100
296 Ga0316583_10136781
297 Ga0373948_0005689
298 Ga0373938_0070056
299 Ga0373939_0255417
300 Ga0373942_0005991
301 Ga0373962_0004722
302 Ga0316574_0001255
303 Ga0395899_0014286
304 Ga0395900_0013650
305 Ga0395900_0027457
306 Ga0395900_0990151
307 Ga0395898_0060503
308 Ga0395905_0039429
309 Ga0395905_0212273
310 Ga0395901_0028433
311 Ga0395901_0090845
312 Ga0395901_0115885
313 Ga0395901_0459517
314 Ga0436361_0326587
315 Ga0451789_1057467
316 Ga0451791_0181160
317 Ga0451843_1284897
318 Ga0466967_0002122
319 Ga0466967_0047086
320 Ga0495582_0301586
321 Ga0495632_0157825
322 Ga0495667_0135761
323 Ga0495667_0505604
324 Ga0495658_0063594
325 Ga0495613_0042939
326 Ga0495613_0232327
327 Ga0495680_0263942
328 Ga0496100_0008916
329 Ga0496100_0474925
330 Ga0496101_0017828
331 Ga0496101_0189488
332 Ga0496102_0003438
333 Ga0496102_0159152
334 Ga0496102_0196121
335 Ga0496102_0247961
336 Ga0496103_0049882
337 Ga0496103_0062424
338 Ga0496103_0076319
339 Ga0496104_0005794
340 Ga0496104_0060967
341 Ga0496104_0092778
342 Ga0496105_0001817
343 Ga0496105_0005884
344 Ga0496105_0046171
345 Ga0496108_0568239
346 Ga0496109_0054038
347 Ga0496109_0440379
348 Ga0496109_0882381
349 Ga0496110_0054761
350 Ga0496110_0074185
351 Ga0496111_0077752
352 Ga0496111_0312419
353 Ga0496112_0053401
354 Ga0496112_0280155
355 Ga0496113_0078303
356 Ga0496113_0118765
357 Ga0496114_0003261
358 Ga0496114_0026296
359 Ga0496114_0344143
360 Ga0496114_0425371
361 Ga0496119_0000067
362 Ga0496120_0007267
363 Ga0496122_0000384
364 Ga0496123_0000074
365 Ga0496124_0000400
366 Ga0496124_0167746
367 Ga0496126_0571325
368 Ga0501031_0047243
369 Ga0501032_0300662
370 Ga0501033_0027190
371 Ga0501034_0041331
372 Ga0501034_0245361
373 Ga0501036_0011498
374 Ga0501037_0205940
375 Ga0501038_0026422
376 Ga0501039_0003028
377 Ga0501040_0015850
378 Ga0501041_0017766
379 Ga0501042_0032884
380 Ga0501047_0695436
381 Ga0501048_0001355
382 Ga0501068_0043461
383 Ga0501069_0227765
384 Ga0501071_0001162
385 Ga0501072_0049454
386 Ga0501074_0092729
387 Ga0501075_0015983
388 Ga0501081_0025142
389 Ga0501045_0030049
390 nmdc:mga00v17_648_c1
391 nmdc:mga05p37_85795_c1
392 nmdc:mga09592_11635_c1
393 nmdc:mga0qj67_82801_c1
394 nmdc:mga06r32_169821_c1
395 Ga0495619_0035220
396 Ga0501084_0001081
397 Ga0501082_0031095
398 Ga0530510_0020225
399 2643849920
400 2644135922
401 2644447043
402 2644504518
403 2644609752
404 2753271389
405 2808874225
406 2812362948
407 2812374912
408 2819427654
409 2819666511
410 2819691669
411 2819729551
412 2839986839
413 2855674800
414 2855680497
415 2857292684
416 2858851251
417 2858884209
418 2858890854
419 2858899472
420 2866553918
421 2869054836
422 2869073323
423 2880500123
424 2891329900
425 2917736993
426 2919054583
427 2919450339
428 2932431859
429 2945919006
430 8001788127
431 8003832379
432 8054707643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

55

231

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kk9-assembly1.cif.gz_A crystal structure of e. coli ycio 0.9817 1 205
1kk9-assembly1.cif.gz_A crystal structure of e. coli ycio 0.977 1 205
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.9042 2 196
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.8926 2 196
6f89-assembly2.cif.gz_B structure of h234a/y235a p.abyssi sua5 0.8848 1 199
ID Description Score Start End Superfamily
1kk9A00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9777 2 205 3.90.870.10
1kk9A00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9681 2 205 3.90.870.10
af_Q6YZF2_76_294_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9285 4 201 3.90.870.10
af_Q60369_7_206_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9078 15 204 3.90.870.10
af_F1R994_49_249_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8952 13 199 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A098U5B4-F1-model_v4 deleted 1.001 1 178
AF-A0A1C6SAI6-F1-model_v4 tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family 0.9996 1 205 GO:0003725
AF-A0A511FJE5-F1-model_v4 Threonylcarbamoyl-AMP synthase (tRNA threonylcarbamoyl adenosine modification protein (Sua5/YciO/YrdC/YwlC family)) 0.999 1 205 GO:0003725
AF-A0A7C1TGX9-F1-model_v4 Threonylcarbamoyl-AMP synthase 0.9982 1 145 GO:0003725
AF-A0A163SWA8-F1-model_v4 Threonylcarbamoyl-AMP synthase (EC 2.7.7.87) 0.9981 1 205 GO:0003725
GO:0061710

Map