F325492

General Info

Members Datasets Scaffolds Average Seq Length
214 167 206 159

Family's Representative Sequence

Representative Sequence 3300041492|Ga0451835_1266354|Ga0451835_1266354_688_1170
Length 160
Sequence MTSFILNGQPVELKVAEDMPLLWALRDTLGLTGTKFGCGVAQCGACTVHVDGQSRRSCVTPVSILEGKTVTTIEGLAATHGKAGELHPIQAAWIEAQAPQCGYCQSGQIMQAAALLNESPDPTDEEITASMVGNLCRCMAYIRIRKAIKLAAQANKEATR

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
5 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
6 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
7 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
8 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
110 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
111 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
112 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
113 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
143 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.39
Metatranscriptomes 1.87
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.35
Nodule 0
Rhizoplane 6.54
Rhizosphere 70.09
Stem 0
Stem Tuber 0
Unclassified 14.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1015105 3300002741 Bacteria 952
2 JGI25150J39212_1000032 3300002774 Bacteria 99615
3 JGI25151J46595_10000010 3300003187 Bacteria 277507
4 JGI25153J46596_10000013 3300003215 Bacteria 303690
5 Ga0055530_10007653 3300003791 Bacteria 4502
6 Ga0055531_10013195 3300003794 Bacteria 3829
7 Ga0065165_1000331 3300005262 Bacteria 77276
8 Ga0065165_1018423 3300005262 Bacteria 2527
9 Ga0065704_10102045 3300005289 Bacteria 2217
10 Ga0065707_10082886 3300005295 Bacteria 11577
11 Ga0070658_10147336 3300005327 Bacteria 1969
12 Ga0070658_10229951 3300005327 Bacteria 1570
13 Ga0070680_100167483 3300005336 Bacteria 1848
14 Ga0070674_101049955 3300005356 Bacteria 717
15 Ga0070713_100030192 3300005436 Bacteria 4302
16 Ga0070681_10043694 3300005458 Bacteria 4487
17 Ga0070698_100006630 3300005471 Bacteria 12552
18 Ga0070698_100140531 3300005471 Bacteria 2366
19 Ga0070699_100034152 3300005518 Bacteria 4395
20 Ga0070679_100111944 3300005530 Bacteria 2716
21 Ga0070697_100331978 3300005536 Bacteria 1311
22 Ga0068855_100008443 3300005563 Bacteria 12454
23 Ga0070664_100237574 3300005564 Bacteria 1635
24 Ga0068852_100057150 3300005616 Bacteria 3375
25 Ga0068864_100631553 3300005618 Bacteria 1041
26 Ga0068861_100008912 3300005719 Bacteria 6915
27 Ga0081538_10018506 3300005981 Bacteria 5228
28 Ga0081538_10075844 3300005981 Bacteria 1822
29 Ga0081538_10174398 3300005981 Bacteria 932
30 Ga0070717_10312187 3300006028 Bacteria 1399
31 Ga0075365_10058584 3300006038 Bacteria 2565
32 Ga0075428_100025834 3300006844 Bacteria 6503
33 Ga0075430_100007520 3300006846 Bacteria 9197
34 Ga0075430_100051973 3300006846 Bacteria 3451
35 Ga0075431_100006681 3300006847 Bacteria 11457
36 Ga0075431_100077638 3300006847 Bacteria 3427
37 Ga0075431_100388125 3300006847 Bacteria 1399
38 Ga0075433_10019658 3300006852 Bacteria 5632
39 Ga0075434_100007698 3300006871 Bacteria 9972
40 Ga0075429_100004977 3300006880 Bacteria 11447
41 Ga0068865_100004148 3300006881 Bacteria 8714
42 Ga0075436_100073432 3300006914 Bacteria 2368
43 Ga0075435_100187639 3300007076 Bacteria 1749
44 Ga0099794_10053572 3300007265 Bacteria 1945
45 Ga0099795_10079152 3300007788 Bacteria 1254
46 Ga0105240_10005884 3300009093 Bacteria 18159
47 Ga0105240_10008955 3300009093 Bacteria 14231
48 Ga0105240_10171801 3300009093 Bacteria 2566
49 Ga0111539_10009589 3300009094 Bacteria 12220
50 Ga0105247_10020989 3300009101 Bacteria 3930
51 Ga0114129_10005198 3300009147 Bacteria 18338
52 Ga0114129_10051045 3300009147 Bacteria 5808
53 Ga0114129_10344092 3300009147 Bacteria 1977
54 Ga0105241_10185626 3300009174 Bacteria 1728
55 Ga0105242_10066049 3300009176 Bacteria 2986
56 Ga0105238_10013410 3300009551 Bacteria 8274
57 Ga0105238_10057770 3300009551 Bacteria 3889
58 Ga0105238_11209739 3300009551 Bacteria 780
59 Ga0157370_10015396 3300013104 Bacteria 7773
60 Ga0157369_10111663 3300013105 Bacteria 2905
61 Ga0157369_12192127 3300013105 Bacteria 560
62 Ga0157378_10598142 3300013297 Bacteria 1114
63 Ga0157372_10117289 3300013307 Bacteria 3053
64 Ga0163163_10052093 3300014325 Bacteria 4036
65 Ga0157380_10008717 3300014326 Bacteria 7246
66 Ga0157380_12554093 3300014326 Bacteria 577
67 Ga0182008_10003318 3300014497 Bacteria 9782
68 Ga0157379_10439291 3300014968 Bacteria 1203
69 Ga0182006_1000035 3300015261 Bacteria 232349
70 Ga0182007_10000040 3300015262 Bacteria 120364
71 Ga0182005_1000025 3300015265 Bacteria 235532
72 Ga0163161_10078954 3300017792 Bacteria 2419
73 Ga0163161_10140874 3300017792 Bacteria 1826
74 Ga0206352_11355642 3300020078 Bacteria 596
75 Ga0206350_10050909 3300020080 Bacteria 655
76 Ga0213872_10003935 3300021361 Bacteria 8042
77 Ga0213876_10043158 3300021384 Bacteria 2383
78 Ga0213876_10069399 3300021384 Bacteria 1861
79 Ga0213871_10000806 3300021441 Bacteria 4681
80 Ga0213871_10024249 3300021441 Bacteria 1534
81 Ga0224712_10216709 3300022467 Bacteria 875
82 Ga0207425_1000015 3300025245 Bacteria 466368
83 Ga0209026_1001873 3300025250 Bacteria 8574
84 Ga0209129_1000126 3300025258 Bacteria 133335
85 Ga0209025_1000002 3300025294 Bacteria 1393142
86 Ga0209758_1000003 3300025297 Bacteria 1398533
87 Ga0209758_1000334 3300025297 Bacteria 88149
88 Ga0209050_1000130 3300025298 Bacteria 186070
89 Ga0209257_1000059 3300025304 Bacteria 378097
90 Ga0209257_1000406 3300025304 Bacteria 83846
91 Ga0207710_10037393 3300025900 Bacteria 2144
92 Ga0207705_10116279 3300025909 Bacteria 1980
93 Ga0207654_10484011 3300025911 Bacteria 872
94 Ga0207707_10047471 3300025912 Bacteria 3739
95 Ga0207695_10001195 3300025913 Bacteria 44633
96 Ga0207695_10003106 3300025913 Bacteria 23762
97 Ga0207695_10021281 3300025913 Bacteria 7405
98 Ga0207695_10065396 3300025913 Bacteria 3739
99 Ga0207660_10159904 3300025917 Bacteria 1737
100 Ga0207652_10090369 3300025921 Bacteria 2690
101 Ga0207694_10009591 3300025924 Bacteria 7303
102 Ga0207694_10038936 3300025924 Bacteria 3657
103 Ga0207669_11101751 3300025937 Bacteria 670
104 Ga0207669_11780740 3300025937 Bacteria 526
105 Ga0207704_10002126 3300025938 Bacteria 8882
106 Ga0207665_10162130 3300025939 Bacteria 1609
107 Ga0207679_10183742 3300025945 Bacteria 1732
108 Ga0207667_10000163 3300025949 Bacteria 98321
109 Ga0207641_11049802 3300026088 Bacteria 813
110 Ga0207675_100016316 3300026118 Bacteria 6933
111 Ga0207698_10117463 3300026142 Bacteria 2244
112 Ga0207428_10005114 3300027907 Bacteria 12304
113 Ga0268266_10232290 3300028379 Bacteria 1699
114 Ga0268266_11111321 3300028379 Bacteria 765
115 Ga0307515_10043062 3300028794 Bacteria 7034
116 Ga0265762_1036874 3300030760 Bacteria 945
117 Ga0265327_10002776 3300031251 Bacteria 17700
118 Ga0265342_10253227 3300031712 Bacteria 939
119 Ga0307409_101125245 3300031995 Bacteria 807
120 Ga0307416_100696023 3300032002 Bacteria 1105
121 Ga0307510_10281055 3300033180 Bacteria 1135
122 Ga0373936_0022995 3300035113 Bacteria 2427
123 Ga0395905_1283314 3300037471 Bacteria 636
124 Ga0436365_0305785 3300039437 Bacteria 2876
125 Ga0436365_0842516 3300039437 Bacteria 726
126 Ga0436365_1307957 3300039437 Bacteria 6598
127 Ga0436360_0931190 3300039438 Bacteria 11567
128 Ga0436360_1011789 3300039438 Bacteria 6088
129 Ga0436361_0041313 3300039447 Bacteria 925
130 Ga0436361_1215649 3300039447 Bacteria 13895
131 Ga0436362_0032680 3300039453 Bacteria 815
132 Ga0436362_1269588 3300039453 Bacteria 2649
133 Ga0451791_0093572 3300041451 Bacteria 2405
134 Ga0451797_1087766 3300041453 Bacteria 1309
135 Ga0451833_0192702 3300041491 Bacteria 23445
136 Ga0451833_0616736 3300041491 Bacteria 1713
137 Ga0451835_1266354 3300041492 Bacteria 1196
138 Ga0451841_1409097 3300041498 Bacteria 751
139 Ga0439446_0305598 3300042156 Bacteria 559
140 Ga0453683_0679032 3300044673 Bacteria 674
141 Ga0453684_0026874 3300044712 Bacteria 8292
142 Ga0451576_0088340 3300045051 Bacteria 3224
143 Ga0495638_0001258 3300046460 Bacteria 23722
144 Ga0495622_0133365 3300046557 Bacteria 1130
145 Ga0495633_0000180 3300046558 Bacteria 82176
146 Ga0495668_0121780 3300046616 Bacteria 1427
147 Ga0495625_0020425 3300046660 Bacteria 5113
148 Ga0495625_0133531 3300046660 Bacteria 1680
149 Ga0495604_0733965 3300047317 Bacteria 625
150 Ga0495686_0024178 3300047472 Bacteria 3995
151 Ga0495686_0025998 3300047472 Bacteria 3832
152 Ga0496100_0867632 3300048903 Bacteria 708
153 Ga0496101_0203266 3300048904 Bacteria 1532
154 Ga0496102_0673209 3300048905 Bacteria 958
155 Ga0496104_0308169 3300048907 Bacteria 1496
156 Ga0496106_1194012 3300048909 Bacteria 594
157 Ga0496109_1053026 3300048912 Bacteria 751
158 Ga0496110_0422129 3300048913 Bacteria 1216
159 Ga0496110_0618081 3300048913 Bacteria 982
160 Ga0496111_0063053 3300048914 Bacteria 2688
161 Ga0496115_0003341 3300048918 Bacteria 11514
162 Ga0496115_0161926 3300048918 Bacteria 1849
163 Ga0496116_0019148 3300048919 Bacteria 5249
164 Ga0496117_0000045 3300048920 Bacteria 301047
165 Ga0496118_0000041 3300048921 Bacteria 301047
166 Ga0496118_0108944 3300048921 Bacteria 1845
167 Ga0496121_0002653 3300048924 Bacteria 26844
168 Ga0496121_0230813 3300048924 Bacteria 1296
169 Ga0496121_0302139 3300048924 Bacteria 1085
170 Ga0496122_0000818 3300048925 Bacteria 59567
171 Ga0496123_0001406 3300048926 Bacteria 33656
172 Ga0496125_0054705 3300048928 Bacteria 3259
173 Ga0496125_0086438 3300048928 Bacteria 2371
174 Ga0496126_0710267 3300048929 Bacteria 780
175 Ga0495682_0003049 3300049460 Bacteria 7611
176 Ga0501298_045700 3300049521 Unclassified 897
177 Ga0501031_0496567 3300049568 Bacteria 787
178 Ga0501034_0617000 3300049571 Bacteria 989
179 Ga0501043_0403307 3300049579 Bacteria 1033
180 Ga0501043_0593579 3300049579 Bacteria 819
181 Ga0501047_0000771 3300049581 Bacteria 33529
182 Ga0501047_0596258 3300049581 Bacteria 927
183 Ga0501048_0177364 3300049582 Bacteria 1510
184 Ga0501069_0125806 3300049585 Bacteria 1466
185 Ga0501070_0704796 3300049586 Bacteria 798
186 Ga0501075_0300559 3300049591 Bacteria 1223
187 Ga0501076_0144934 3300049592 Bacteria 1931
188 Ga0501080_0389480 3300049742 Bacteria 1255
189 Ga0501044_1141751 3300049823 Bacteria 648
190 nmdc:mga0yw44_52308_c1 3300050492 Bacteria 2475
191 nmdc:mga05p37_29375_c1 3300050507 Bacteria 6710
192 nmdc:mga05p37_3927_c1 3300050507 Bacteria 17414
193 nmdc:mga09592_22024_c1 3300050508 Bacteria 5258
194 nmdc:mga0qj67_3544_c1 3300050509 Bacteria 11277
195 nmdc:mga0qj67_5781_c1 3300050509 Bacteria 9054
196 nmdc:mga06r32_19334_c1 3300050510 Bacteria 6251
197 nmdc:mga06r32_8560_c1 3300050510 Bacteria 9223
198 nmdc:mga08y16_19407_c1 3300050511 Bacteria 7168
199 nmdc:mga0n895_3572_c1 3300050512 Bacteria 10290
200 nmdc:mga08x19_52995_c1 3300050514 Bacteria 2610
201 nmdc:mga0a205_5477_c1 3300050515 Bacteria 4995
202 Ga0500651_0002746 3300053093 Bacteria 9407
203 Ga0500559_0068865 3300053136 Bacteria 1591
204 Ga0500645_056173 3300053730 Bacteria 1142
205 Ga0501082_0005924 3300060353 Bacteria 10603
206 Ga0501082_1209702 3300060353 Bacteria 660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_1141751 Ga0501044_1141751_58_546 140
2 3300039447 Ga0436361_0041313 Ga0436361_0041313_69_506 141
3 3300025937 Ga0207669_11780740 Ga0207669_117807401 143
4 3300033180 Ga0307510_10281055 Ga0307510_102810552 147
5 3300050514 nmdc:mga08x19_52995_c1 nmdc:mga08x19_52995_c1_1980_2432 147
6 3300049579 Ga0501043_0403307 Ga0501043_0403307_307_753 148
7 3300005518 Ga0070699_100034152 Ga0070699_1000341525 149
8 3300006038 Ga0075365_10058584 Ga0075365_100585842 149
9 3300006914 Ga0075436_100073432 Ga0075436_1000734322 149
10 3300025939 Ga0207665_10162130 Ga0207665_101621302 149
11 3300049521 Ga0501298_045700 Ga0501298_045700_17_484 149
12 3300049585 Ga0501069_0125806 Ga0501069_0125806_221_685 149
13 3300049591 Ga0501075_0300559 Ga0501075_0300559_270_800 149
14 3300050492 nmdc:mga0yw44_52308_c1 nmdc:mga0yw44_52308_c1_1390_1875 149
15 iso_pu_bacteria 2600255292 2601669933 149
16 iso_pu_bacteria 2857547612 2857551000 149
17 iso_pu_bacteria 2932410948 2932413422 149
18 iso_pu_bacteria 2932416698 2932417482 149
19 3300049568 Ga0501031_0496567 Ga0501031_0496567_195_743 150
20 3300060353 Ga0501082_1209702 Ga0501082_1209702_91_639 150
21 iso_pu_bacteria 2643221598 2643999871 150
22 iso_pu_bacteria 2643221614 2644088301 150
23 iso_pu_bacteria 2643221661 2644343539 150
24 iso_pu_bacteria 2643221666 2644368984 150
25 3300005618 Ga0068864_100631553 Ga0068864_1006315532 151
26 3300006881 Ga0068865_100004148 Ga0068865_1000041486 151
27 3300021384 Ga0213876_10043158 Ga0213876_100431582 151
28 3300021384 Ga0213876_10069399 Ga0213876_100693992 151
29 3300025938 Ga0207704_10002126 Ga0207704_1000212611 151
30 3300031712 Ga0265342_10253227 Ga0265342_102532271 151
31 3300032002 Ga0307416_100696023 Ga0307416_1006960231 151
32 3300039437 Ga0436365_0305785 Ga0436365_0305785_1124_1615 151
33 3300039437 Ga0436365_1307957 Ga0436365_1307957_4216_4707 151
34 3300039453 Ga0436362_0032680 Ga0436362_0032680_10_501 151
35 3300049571 Ga0501034_0617000 Ga0501034_0617000_351_881 151
36 3300049592 Ga0501076_0144934 Ga0501076_0144934_586_1083 151
37 3300053136 Ga0500559_0068865 Ga0500559_0068865_668_1129 151
38 3300006847 Ga0075431_100388125 Ga0075431_1003881251 152
39 3300020078 Ga0206352_11355642 Ga0206352_113556421 152
40 3300020080 Ga0206350_10050909 Ga0206350_100509091 152
41 3300022467 Ga0224712_10216709 Ga0224712_102167092 152
42 3300028379 Ga0268266_11111321 Ga0268266_111113212 152
43 3300028794 Ga0307515_10043062 Ga0307515_100430622 152
44 3300031995 Ga0307409_101125245 Ga0307409_1011252452 152
45 3300002741 JGI25157J39369_1015105 JGI25157J39369_10151052 153
46 3300002774 JGI25150J39212_1000032 JGI25150J39212_100003212 153
47 3300003187 JGI25151J46595_10000010 JGI25151J46595_10000010184 153
48 3300003215 JGI25153J46596_10000013 JGI25153J46596_10000013184 153
49 3300003791 Ga0055530_10007653 Ga0055530_100076532 153
50 3300003794 Ga0055531_10013195 Ga0055531_100131952 153
51 3300005262 Ga0065165_1000331 Ga0065165_10003316 153
52 3300005262 Ga0065165_1018423 Ga0065165_10184232 153
53 3300005289 Ga0065704_10102045 Ga0065704_101020452 153
54 3300005295 Ga0065707_10082886 Ga0065707_1008288611 153
55 3300005327 Ga0070658_10147336 Ga0070658_101473362 153
56 3300005327 Ga0070658_10229951 Ga0070658_102299512 153
57 3300005336 Ga0070680_100167483 Ga0070680_1001674832 153
58 3300005356 Ga0070674_101049955 Ga0070674_1010499552 153
59 3300005436 Ga0070713_100030192 Ga0070713_1000301923 153
60 3300005458 Ga0070681_10043694 Ga0070681_100436941 153
61 3300005471 Ga0070698_100006630 Ga0070698_1000066303 153
62 3300005471 Ga0070698_100140531 Ga0070698_1001405311 153
63 3300005530 Ga0070679_100111944 Ga0070679_1001119442 153
64 3300005536 Ga0070697_100331978 Ga0070697_1003319782 153
65 3300005563 Ga0068855_100008443 Ga0068855_10000844313 153
66 3300005564 Ga0070664_100237574 Ga0070664_1002375741 153
67 3300005616 Ga0068852_100057150 Ga0068852_1000571504 153
68 3300005719 Ga0068861_100008912 Ga0068861_1000089122 153
69 3300005981 Ga0081538_10018506 Ga0081538_100185062 153
70 3300005981 Ga0081538_10075844 Ga0081538_100758443 153
71 3300005981 Ga0081538_10174398 Ga0081538_101743982 153
72 3300006028 Ga0070717_10312187 Ga0070717_103121872 153
73 3300006844 Ga0075428_100025834 Ga0075428_1000258346 153
74 3300006846 Ga0075430_100007520 Ga0075430_1000075206 153
75 3300006846 Ga0075430_100051973 Ga0075430_1000519732 153
76 3300006847 Ga0075431_100006681 Ga0075431_1000066816 153
77 3300006847 Ga0075431_100077638 Ga0075431_1000776382 153
78 3300006852 Ga0075433_10019658 Ga0075433_100196583 153
79 3300006871 Ga0075434_100007698 Ga0075434_1000076986 153
80 3300006880 Ga0075429_100004977 Ga0075429_1000049776 153
81 3300007076 Ga0075435_100187639 Ga0075435_1001876392 153
82 3300007265 Ga0099794_10053572 Ga0099794_100535722 153
83 3300007788 Ga0099795_10079152 Ga0099795_100791522 153
84 3300009093 Ga0105240_10005884 Ga0105240_100058846 153
85 3300009093 Ga0105240_10008955 Ga0105240_100089553 153
86 3300009093 Ga0105240_10171801 Ga0105240_101718013 153
87 3300009094 Ga0111539_10009589 Ga0111539_100095895 153
88 3300009101 Ga0105247_10020989 Ga0105247_100209892 153
89 3300009147 Ga0114129_10005198 Ga0114129_1000519814 153
90 3300009147 Ga0114129_10051045 Ga0114129_100510455 153
91 3300009147 Ga0114129_10344092 Ga0114129_103440922 153
92 3300009174 Ga0105241_10185626 Ga0105241_101856261 153
93 3300009176 Ga0105242_10066049 Ga0105242_100660492 153
94 3300009551 Ga0105238_10013410 Ga0105238_100134107 153
95 3300009551 Ga0105238_10057770 Ga0105238_100577702 153
96 3300009551 Ga0105238_11209739 Ga0105238_112097391 153
97 3300013104 Ga0157370_10015396 Ga0157370_100153966 153
98 3300013105 Ga0157369_10111663 Ga0157369_101116632 153
99 3300013105 Ga0157369_12192127 Ga0157369_121921271 153
100 3300013297 Ga0157378_10598142 Ga0157378_105981421 153
101 3300013307 Ga0157372_10117289 Ga0157372_101172892 153
102 3300014325 Ga0163163_10052093 Ga0163163_100520932 153
103 3300014326 Ga0157380_10008717 Ga0157380_100087178 153
104 3300014326 Ga0157380_12554093 Ga0157380_125540931 153
105 3300014497 Ga0182008_10003318 Ga0182008_100033185 153
106 3300014968 Ga0157379_10439291 Ga0157379_104392912 153
107 3300015261 Ga0182006_1000035 Ga0182006_100003594 153
108 3300015262 Ga0182007_10000040 Ga0182007_10000040106 153
109 3300015265 Ga0182005_1000025 Ga0182005_100002595 153
110 3300017792 Ga0163161_10078954 Ga0163161_100789543 153
111 3300017792 Ga0163161_10140874 Ga0163161_101408742 153
112 3300021361 Ga0213872_10003935 Ga0213872_100039356 153
113 3300021441 Ga0213871_10000806 Ga0213871_100008063 153
114 3300021441 Ga0213871_10024249 Ga0213871_100242492 153
115 3300025245 Ga0207425_1000015 Ga0207425_1000015108 153
116 3300025250 Ga0209026_1001873 Ga0209026_10018737 153
117 3300025258 Ga0209129_1000126 Ga0209129_100012612 153
118 3300025294 Ga0209025_1000002 Ga0209025_10000021006 153
119 3300025297 Ga0209758_1000003 Ga0209758_10000031013 153
120 3300025297 Ga0209758_1000334 Ga0209758_100033426 153
121 3300025298 Ga0209050_1000130 Ga0209050_100013095 153
122 3300025304 Ga0209257_1000059 Ga0209257_1000059290 153
123 3300025304 Ga0209257_1000406 Ga0209257_100040659 153
124 3300025900 Ga0207710_10037393 Ga0207710_100373932 153
125 3300025909 Ga0207705_10116279 Ga0207705_101162792 153
126 3300025911 Ga0207654_10484011 Ga0207654_104840111 153
127 3300025912 Ga0207707_10047471 Ga0207707_100474715 153
128 3300025913 Ga0207695_10001195 Ga0207695_1000119532 153
129 3300025913 Ga0207695_10003106 Ga0207695_100031065 153
130 3300025913 Ga0207695_10021281 Ga0207695_100212815 153
131 3300025913 Ga0207695_10065396 Ga0207695_100653962 153
132 3300025917 Ga0207660_10159904 Ga0207660_101599042 153
133 3300025921 Ga0207652_10090369 Ga0207652_100903692 153
134 3300025924 Ga0207694_10009591 Ga0207694_100095912 153
135 3300025924 Ga0207694_10038936 Ga0207694_100389362 153
136 3300025937 Ga0207669_11101751 Ga0207669_111017511 153
137 3300025945 Ga0207679_10183742 Ga0207679_101837422 153
138 3300025949 Ga0207667_10000163 Ga0207667_1000016311 153
139 3300026088 Ga0207641_11049802 Ga0207641_110498022 153
140 3300026118 Ga0207675_100016316 Ga0207675_1000163165 153
141 3300026142 Ga0207698_10117463 Ga0207698_101174632 153
142 3300027907 Ga0207428_10005114 Ga0207428_100051147 153
143 3300028379 Ga0268266_10232290 Ga0268266_102322902 153
144 3300030760 Ga0265762_1036874 Ga0265762_10368742 153
145 3300031251 Ga0265327_10002776 Ga0265327_100027765 153
146 3300035113 Ga0373936_0022995 Ga0373936_0022995_67_534 153
147 3300037471 Ga0395905_1283314 Ga0395905_1283314_119_580 153
148 3300039437 Ga0436365_0842516 Ga0436365_0842516_27_536 153
149 3300039438 Ga0436360_0931190 Ga0436360_0931190_3385_3855 153
150 3300039438 Ga0436360_1011789 Ga0436360_1011789_4835_5305 153
151 3300039447 Ga0436361_1215649 Ga0436361_1215649_8911_9381 153
152 3300039453 Ga0436362_1269588 Ga0436362_1269588_18_488 153
153 3300041451 Ga0451791_0093572 Ga0451791_0093572_1682_2200 153
154 3300041453 Ga0451797_1087766 Ga0451797_1087766_486_1004 153
155 3300041491 Ga0451833_0192702 Ga0451833_0192702_17049_17531 153
156 3300041491 Ga0451833_0616736 Ga0451833_0616736_502_1020 153
157 3300041492 Ga0451835_1266354 Ga0451835_1266354_688_1170 153
158 3300041498 Ga0451841_1409097 Ga0451841_1409097_181_681 153
159 3300042156 Ga0439446_0305598 Ga0439446_0305598_67_528 153
160 3300044673 Ga0453683_0679032 Ga0453683_0679032_145_618 153
161 3300044712 Ga0453684_0026874 Ga0453684_0026874_4201_4674 153
162 3300045051 Ga0451576_0088340 Ga0451576_0088340_2676_3149 153
163 3300046460 Ga0495638_0001258 Ga0495638_0001258_19319_19786 153
164 3300046557 Ga0495622_0133365 Ga0495622_0133365_121_588 153
165 3300046558 Ga0495633_0000180 Ga0495633_0000180_23121_23588 153
166 3300046616 Ga0495668_0121780 Ga0495668_0121780_613_1074 153
167 3300046660 Ga0495625_0020425 Ga0495625_0020425_3666_4133 153
168 3300046660 Ga0495625_0133531 Ga0495625_0133531_883_1344 153
169 3300047317 Ga0495604_0733965 Ga0495604_0733965_75_548 153
170 3300047472 Ga0495686_0024178 Ga0495686_0024178_388_849 153
171 3300047472 Ga0495686_0025998 Ga0495686_0025998_3189_3650 153
172 3300048903 Ga0496100_0867632 Ga0496100_0867632_20_493 153
173 3300048904 Ga0496101_0203266 Ga0496101_0203266_429_896 153
174 3300048905 Ga0496102_0673209 Ga0496102_0673209_276_749 153
175 3300048907 Ga0496104_0308169 Ga0496104_0308169_576_1049 153
176 3300048909 Ga0496106_1194012 Ga0496106_1194012_93_560 153
177 3300048912 Ga0496109_1053026 Ga0496109_1053026_68_541 153
178 3300048913 Ga0496110_0422129 Ga0496110_0422129_102_575 153
179 3300048913 Ga0496110_0618081 Ga0496110_0618081_470_943 153
180 3300048914 Ga0496111_0063053 Ga0496111_0063053_141_608 153
181 3300048918 Ga0496115_0003341 Ga0496115_0003341_10814_11293 153
182 3300048918 Ga0496115_0161926 Ga0496115_0161926_1353_1823 153
183 3300048919 Ga0496116_0019148 Ga0496116_0019148_974_1441 153
184 3300048920 Ga0496117_0000045 Ga0496117_0000045_134755_135222 153
185 3300048921 Ga0496118_0000041 Ga0496118_0000041_134755_135222 153
186 3300048921 Ga0496118_0108944 Ga0496118_0108944_938_1405 153
187 3300048924 Ga0496121_0002653 Ga0496121_0002653_4290_4757 153
188 3300048924 Ga0496121_0230813 Ga0496121_0230813_94_561 153
189 3300048924 Ga0496121_0302139 Ga0496121_0302139_607_1074 153
190 3300048925 Ga0496122_0000818 Ga0496122_0000818_15109_15576 153
191 3300048926 Ga0496123_0001406 Ga0496123_0001406_22481_22948 153
192 3300048928 Ga0496125_0054705 Ga0496125_0054705_860_1324 153
193 3300048928 Ga0496125_0086438 Ga0496125_0086438_1161_1628 153
194 3300048929 Ga0496126_0710267 Ga0496126_0710267_141_614 153
195 3300049460 Ga0495682_0003049 Ga0495682_0003049_3427_3894 153
196 3300049579 Ga0501043_0593579 Ga0501043_0593579_13_555 153
197 3300049581 Ga0501047_0000771 Ga0501047_0000771_7936_8400 153
198 3300049581 Ga0501047_0596258 Ga0501047_0596258_291_833 153
199 3300049582 Ga0501048_0177364 Ga0501048_0177364_461_925 153
200 3300049586 Ga0501070_0704796 Ga0501070_0704796_68_610 153
201 3300049742 Ga0501080_0389480 Ga0501080_0389480_592_1122 153
202 3300050507 nmdc:mga05p37_29375_c1 nmdc:mga05p37_29375_c1_3720_4193 153
203 3300050507 nmdc:mga05p37_3927_c1 nmdc:mga05p37_3927_c1_16626_17168 153
204 3300050508 nmdc:mga09592_22024_c1 nmdc:mga09592_22024_c1_2902_3375 153
205 3300050509 nmdc:mga0qj67_3544_c1 nmdc:mga0qj67_3544_c1_1255_1797 153
206 3300050509 nmdc:mga0qj67_5781_c1 nmdc:mga0qj67_5781_c1_5018_5491 153
207 3300050510 nmdc:mga06r32_19334_c1 nmdc:mga06r32_19334_c1_1754_2227 153
208 3300050510 nmdc:mga06r32_8560_c1 nmdc:mga06r32_8560_c1_7503_8045 153
209 3300050511 nmdc:mga08y16_19407_c1 nmdc:mga08y16_19407_c1_2758_3231 153
210 3300050512 nmdc:mga0n895_3572_c1 nmdc:mga0n895_3572_c1_3840_4313 153
211 3300050515 nmdc:mga0a205_5477_c1 nmdc:mga0a205_5477_c1_2796_3269 153
212 3300053093 Ga0500651_0002746 Ga0500651_0002746_8284_8757 153
213 3300053730 Ga0500645_056173 Ga0500645_056173_189_650 153
214 3300060353 Ga0501082_0005924 Ga0501082_0005924_1568_2032 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

72

149

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

4

72

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9846 2 149
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9602 2 149
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9574 2 149
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9566 2 148
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9557 2 149
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9761 82 149 1.10.150.120
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9758 2 72 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9733 82 149 1.10.150.120
1n60A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9684 83 149 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9641 2 74 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A522CLD9-F1-model_v4 (2Fe-2S)-binding protein 0.9979 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A840A321-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.9963 2 149 GO:0016491
GO:0046872
GO:0051537
AF-Q089K2-F1-model_v4 (2Fe-2S)-binding domain protein 0.9961 1 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A7V9BKS3-F1-model_v4 (2Fe-2S)-binding protein 0.9959 2 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A257J208-F1-model_v4 (2Fe-2S)-binding protein 0.9955 1 150 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
94.34 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map