F324802

General Info

Members Datasets Scaffolds Average Seq Length
214 167 428 246

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100294883|Ga0070683_1002948832
Length 279
Sequence MPESDVCSRRRLGVHHMSHAALNPLVRRFETIISLSEDEKKAILNLPVRVADLRADADIVREGDRPSQCCLLVEGFLCRYKYLSDGKRQIMAFYVPGDIPDLLSLHIDVMDHSLATIIPSKVAFIPHDALGNLIDQNPRIGNAFWRDTLIDASTFREWIVSLGSRDAYSRIGHLICEMFLKLKAVGLTNGNSFNFPITQGEIGDATGLSTVHVNRSIMELRKEGLIILEKGRCTIPDLRRLEEAAKFDPTYLHLTGARRAGMGDSPGTDRALRLDANCA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
37 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
77 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
78 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
82 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
100 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
101 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
102 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
103 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
104 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
105 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
106 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
107 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
108 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
153 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
157 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
158 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
159 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
160 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
161 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
162 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
163 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
164 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
165 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
166 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
167 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.39
Metatranscriptomes 0
Isolates 5.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.88
Nodule 3.27
Rhizoplane 12.15
Rhizosphere 72.43
Stem 0
Stem Tuber 0
Unclassified 10.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100294883 3300005329 Unclassified 1542
2 ARcpr5yngRDRAFT_c000651 3300000043 Bacteria 4344
3 ARCol0yngRDRAFT_1001700 3300000652 Bacteria 1742
4 JGI24736J21556_1029220 3300001904 Bacteria 853
5 JGI24739J22299_10000359 3300001989 Bacteria 15623
6 JGI24737J22298_10002112 3300001990 Bacteria 7089
7 JGI24735J21928_10001523 3300002067 Bacteria 8209
8 JGI24735J21928_10004362 3300002067 Bacteria 4764
9 JGI24735J21928_10027279 3300002067 Unclassified 1712
10 JGI24738J21930_10001382 3300002075 Bacteria 6741
11 Ga0055537_1000772 3300003773 Bacteria 16172
12 Ga0055524_1000169 3300003775 Bacteria 74567
13 Ga0055531_10008941 3300003794 Bacteria 5190
14 Ga0055543_1016892 3300004625 Bacteria 1380
15 Ga0065165_1010982 3300005262 Bacteria 3839
16 Ga0070658_10002814 3300005327 Bacteria 14454
17 Ga0070666_10081986 3300005335 Bacteria 2205
18 Ga0070660_100005751 3300005339 Bacteria 8592
19 Ga0070660_100006553 3300005339 Bacteria 8077
20 Ga0070660_100186392 3300005339 Unclassified 1680
21 Ga0070661_100000064 3300005344 Bacteria 84753
22 Ga0070671_100006024 3300005355 Bacteria 9664
23 Ga0070674_100022769 3300005356 Bacteria 4043
24 Ga0070667_100997728 3300005367 Bacteria 781
25 Ga0070662_100006552 3300005457 Bacteria 7512
26 Ga0070662_100034351 3300005457 Bacteria 3575
27 Ga0070681_10051337 3300005458 Bacteria 4113
28 Ga0070679_100000015 3300005530 Bacteria 142672
29 Ga0070684_100376527 3300005535 Unclassified 1307
30 Ga0068853_100032859 3300005539 Bacteria 4398
31 Ga0070696_100243172 3300005546 Bacteria 1358
32 Ga0070665_100464633 3300005548 Bacteria 1276
33 Ga0068852_100499307 3300005616 Bacteria 1211
34 Ga0068859_100005269 3300005617 Bacteria 13145
35 Ga0068859_100023167 3300005617 Bacteria 6229
36 Ga0068859_100119670 3300005617 Bacteria 2700
37 Ga0068863_100009885 3300005841 Bacteria 9291
38 Ga0068860_100001110 3300005843 Bacteria 29623
39 Ga0068860_100878157 3300005843 Bacteria 912
40 Ga0068862_100000125 3300005844 Bacteria 89536
41 Ga0081539_10179595 3300005985 Bacteria 994
42 Ga0070717_10393605 3300006028 Unclassified 1244
43 Ga0097620_100005269 3300006931 Bacteria 13145
44 Ga0097620_100023167 3300006931 Bacteria 6229
45 Ga0097620_100119664 3300006931 Bacteria 2700
46 Ga0099825_1035046 3300006941 Bacteria 1822
47 Ga0099824_1017829 3300006942 Bacteria 6019
48 Ga0075435_100158587 3300007076 Bacteria 1905
49 Ga0105247_10015703 3300009101 Bacteria 4534
50 Ga0105247_10028120 3300009101 Bacteria 3402
51 Ga0105248_10498308 3300009177 Bacteria 1373
52 Ga0105238_10217246 3300009551 Bacteria 1888
53 Ga0105249_10000015 3300009553 Bacteria 282138
54 Ga0105249_10928943 3300009553 Unclassified 937
55 Ga0105246_10511318 3300011119 Bacteria 1022
56 Ga0157373_10025931 3300013100 Bacteria 4236
57 Ga0157373_10071814 3300013100 Bacteria 2444
58 Ga0157371_10050582 3300013102 Plasmid 2953
59 Ga0157369_10153451 3300013105 Bacteria 2434
60 Ga0157378_10036866 3300013297 Bacteria 4328
61 Ga0157372_10043644 3300013307 Bacteria 4965
62 Ga0157372_10069842 3300013307 Bacteria 3951
63 Ga0163163_10024685 3300014325 Bacteria 5724
64 Ga0163163_10169826 3300014325 Unclassified 2228
65 Ga0163161_10208602 3300017792 Bacteria 1508
66 Ga0209565_1000012 3300025263 Bacteria 606500
67 Ga0209673_1003664 3300025273 Bacteria 8868
68 Ga0209675_1009477 3300025291 Bacteria 3436
69 Ga0209758_1003596 3300025297 Bacteria 13867
70 Ga0209758_1046096 3300025297 Bacteria 1575
71 Ga0209256_1000012 3300025299 Bacteria 790371
72 Ga0209257_1000934 3300025304 Bacteria 40351
73 Ga0207710_10005417 3300025900 Bacteria 5498
74 Ga0207647_10001800 3300025904 Bacteria 16421
75 Ga0207647_10001873 3300025904 Bacteria 16110
76 Ga0207705_10000497 3300025909 Bacteria 33597
77 Ga0207707_10004392 3300025912 Bacteria 12452
78 Ga0207660_10000224 3300025917 Bacteria 36460
79 Ga0207657_10002954 3300025919 Bacteria 18245
80 Ga0207657_10049261 3300025919 Bacteria 3673
81 Ga0207649_10000102 3300025920 Bacteria 70205
82 Ga0207652_10000021 3300025921 Bacteria 159712
83 Ga0207694_10197447 3300025924 Bacteria 1636
84 Ga0207650_10735505 3300025925 Bacteria 834
85 Ga0207644_10004407 3300025931 Bacteria 9135
86 Ga0207690_10124064 3300025932 Bacteria 1880
87 Ga0207690_10200262 3300025932 Bacteria 1516
88 Ga0207706_10013217 3300025933 Bacteria 7510
89 Ga0207706_10024846 3300025933 Bacteria 5370
90 Ga0207706_10051331 3300025933 Bacteria 3642
91 Ga0207669_10021847 3300025937 Bacteria 3387
92 Ga0207679_10102631 3300025945 Bacteria 2240
93 Ga0207712_10000023 3300025961 Bacteria 282081
94 Ga0207641_10007310 3300026088 Bacteria 9204
95 Ga0207674_10553949 3300026116 Bacteria 1111
96 Ga0207698_10061975 3300026142 Bacteria 2918
97 Ga0209589_1000015 3300027357 Bacteria 225913
98 Ga0209489_100015 3300027361 Bacteria 225913
99 Ga0209700_100025 3300027363 Bacteria 225913
100 Ga0268265_10000049 3300028380 Bacteria 177242
101 Ga0268264_10000682 3300028381 Bacteria 39550
102 Ga0268264_10835453 3300028381 Bacteria 922
103 Ga0265326_10018233 3300028558 Bacteria 2021
104 Ga0265323_10000963 3300028653 Bacteria 15024
105 Ga0265336_10002620 3300028666 Bacteria 7323
106 Ga0265338_10000086 3300028800 Bacteria 175026
107 Ga0265324_10004325 3300029957 Bacteria 6470
108 Ga0307513_10054613 3300031456 Bacteria 4281
109 Ga0307508_10070952 3300031616 Bacteria 3057
110 Ga0326468_10009896 3300031889 Bacteria 954
111 Ga0307412_10000362 3300031911 Bacteria 28168
112 Ga0307409_100703468 3300031995 Unclassified 1010
113 Ga0307411_10621342 3300032005 Bacteria 932
114 Ga0373945_0040629 3300035116 Bacteria 1680
115 Ga0373931_0014509 3300035691 Bacteria 3853
116 Ga0373927_0121701 3300035695 Unclassified 1703
117 Ga0373947_0251434 3300035725 Bacteria 1169
118 Ga0373925_0107659 3300037068 Bacteria 2150
119 Ga0395898_0949582 3300037466 Bacteria 797
120 Ga0395901_0026438 3300038443 Bacteria 5959
121 Ga0395901_0115090 3300038443 Bacteria 2825
122 Ga0237819_01183 3300038705 Bacteria 7350
123 Ga0439436_0115042 3300041404 Bacteria 751
124 Ga0439439_0017756 3300041406 Bacteria 1753
125 Ga0439465_0033708 3300041413 Bacteria 1637
126 Ga0439431_0074677 3300041997 Bacteria 907
127 Ga0439448_0001711 3300042005 Bacteria 5783
128 Ga0439448_0008294 3300042005 Bacteria 3037
129 Ga0439448_0010661 3300042005 Bacteria 2729
130 Ga0439448_0013703 3300042005 Bacteria 2439
131 Ga0439448_0035767 3300042005 Bacteria 1591
132 Ga0439452_007194 3300042010 Bacteria 3425
133 Ga0439455_0001069 3300042012 Bacteria 4352
134 Ga0439455_0003642 3300042012 Bacteria 2971
135 Ga0439455_0015655 3300042012 Bacteria 1745
136 Ga0439457_010816 3300042014 Bacteria 2088
137 Ga0439462_0005200 3300042015 Bacteria 3199
138 Ga0439446_0155271 3300042156 Bacteria 754
139 Ga0439458_0000290 3300042157 Bacteria 12475
140 Ga0439458_0000681 3300042157 Bacteria 8773
141 Ga0466965_0143655 3300044683 Bacteria 1244
142 Ga0466968_0001554 3300044735 Bacteria 8262
143 Ga0466957_0188063 3300044842 Unclassified 1351
144 Ga0466960_0385633 3300044901 Bacteria 805
145 Ga0466967_0295683 3300045976 Bacteria 1557
146 Ga0495627_048405 3300046453 Bacteria 1286
147 Ga0495603_0134409 3300046455 Bacteria 1440
148 Ga0495641_0079175 3300046461 Unclassified 1472
149 Ga0495585_0194600 3300046492 Bacteria 1036
150 Ga0495630_0391198 3300046517 Unclassified 1065
151 Ga0495648_0000088 3300046524 Bacteria 115109
152 Ga0495666_0214764 3300046526 Unclassified 882
153 Ga0495665_0097801 3300046531 Unclassified 1541
154 Ga0495656_0268692 3300046615 Bacteria 866
155 Ga0495668_0099962 3300046616 Bacteria 1587
156 Ga0495625_0029550 3300046660 Bacteria 4097
157 Ga0495624_0059558 3300046690 Bacteria 2396
158 Ga0495676_0094664 3300047321 Bacteria 2224
159 Ga0495686_0005914 3300047472 Bacteria 9525
160 Ga0496100_0288866 3300048903 Unclassified 1225
161 Ga0496104_0002817 3300048907 Bacteria 14993
162 Ga0496104_0013396 3300048907 Bacteria 7389
163 Ga0496104_0071796 3300048907 Bacteria 3291
164 Ga0496104_0595112 3300048907 Unclassified 1016
165 Ga0496105_0185587 3300048908 Unclassified 1702
166 Ga0496105_0214453 3300048908 Bacteria 1568
167 Ga0496108_0000514 3300048911 Bacteria 30292
168 Ga0496108_0006697 3300048911 Bacteria 9330
169 Ga0496108_0500195 3300048911 Unclassified 1061
170 Ga0496109_0038773 3300048912 Plasmid 4309
171 Ga0496109_0089847 3300048912 Bacteria 2841
172 Ga0496110_0006055 3300048913 Bacteria 9535
173 Ga0496110_0097154 3300048913 Bacteria 2639
174 Ga0496110_0579756 3300048913 Unclassified 1018
175 Ga0496111_0006583 3300048914 Bacteria 7557
176 Ga0496111_0109228 3300048914 Unclassified 2036
177 Ga0496112_0028262 3300048915 Bacteria 5412
178 Ga0496112_0041448 3300048915 Bacteria 4505
179 Ga0496112_0212890 3300048915 Unclassified 1889
180 Ga0496113_0015914 3300048916 Bacteria 5184
181 Ga0496113_0041145 3300048916 Bacteria 3408
182 Ga0496113_0147815 3300048916 Unclassified 1852
183 Ga0496115_0055304 3300048918 Bacteria 3188
184 Ga0501031_0045932 3300049568 Bacteria 2850
185 Ga0501036_0121178 3300049572 Bacteria 2209
186 Ga0501038_0131163 3300049574 Bacteria 2058
187 Ga0501039_0086884 3300049575 Bacteria 2436
188 Ga0501042_0057599 3300049578 Bacteria 2773
189 Ga0501048_0027645 3300049582 Bacteria 4120
190 Ga0501075_0053063 3300049591 Bacteria 3049
191 Ga0501076_0048994 3300049592 Bacteria 3340
192 Ga0501083_0252760 3300049744 Bacteria 1147
193 Ga0501035_0145986 3300049822 Bacteria 2055
194 Ga0501045_0035476 3300049824 Bacteria 3621
195 nmdc:mga0k408_162610_c1 3300050493 Bacteria 1330
196 Ga0495655_0043813 3300053083 Unclassified 1155
197 Ga0500643_003431 3300053087 Bacteria 7639
198 Ga0500643_005362 3300053087 Bacteria 5541
199 Ga0500658_0001022 3300053134 Bacteria 11421
200 Ga0500658_0024864 3300053134 Bacteria 2298
201 Ga0500568_0037973 3300053139 Bacteria 1951
202 Ga0500627_0000207 3300053158 Bacteria 16974
203 2600202075 2599185354 Bacteria 4398675
204 2600228304 2599185359 Bacteria 4772316
205 2644126829 2643221622 Bacteria 4212502
206 2819714918 2818991466 Bacteria 4748179
207 2829746215 2829745981 Bacteria 5406054
208 2835317263 2835312727 Bacteria 7413381
209 2861693276 2861691609 Bacteria 5628931
210 2885430967 2885429604 Bacteria 3642894
211 2919142387 2919138771 Bacteria 5281312
212 8045866667 8045864390 Bacteria 5043873
213 8045868178 8045864390 Bacteria 5043873
214 8056690840 8056689827 Bacteria 6712655
215 Ga0070683_100294883
216 ARcpr5yngRDRAFT_c000651
217 ARCol0yngRDRAFT_1001700
218 JGI24736J21556_1029220
219 JGI24739J22299_10000359
220 JGI24737J22298_10002112
221 JGI24735J21928_10001523
222 JGI24735J21928_10004362
223 JGI24735J21928_10027279
224 JGI24738J21930_10001382
225 Ga0055537_1000772
226 Ga0055524_1000169
227 Ga0055531_10008941
228 Ga0055543_1016892
229 Ga0065165_1010982
230 Ga0070658_10002814
231 Ga0070666_10081986
232 Ga0070660_100005751
233 Ga0070660_100006553
234 Ga0070660_100186392
235 Ga0070661_100000064
236 Ga0070671_100006024
237 Ga0070674_100022769
238 Ga0070667_100997728
239 Ga0070662_100006552
240 Ga0070662_100034351
241 Ga0070681_10051337
242 Ga0070679_100000015
243 Ga0070684_100376527
244 Ga0068853_100032859
245 Ga0070696_100243172
246 Ga0070665_100464633
247 Ga0068852_100499307
248 Ga0068859_100005269
249 Ga0068859_100023167
250 Ga0068859_100119670
251 Ga0068863_100009885
252 Ga0068860_100001110
253 Ga0068860_100878157
254 Ga0068862_100000125
255 Ga0081539_10179595
256 Ga0070717_10393605
257 Ga0097620_100005269
258 Ga0097620_100023167
259 Ga0097620_100119664
260 Ga0099825_1035046
261 Ga0099824_1017829
262 Ga0075435_100158587
263 Ga0105247_10015703
264 Ga0105247_10028120
265 Ga0105248_10498308
266 Ga0105238_10217246
267 Ga0105249_10000015
268 Ga0105249_10928943
269 Ga0105246_10511318
270 Ga0157373_10025931
271 Ga0157373_10071814
272 Ga0157371_10050582
273 Ga0157369_10153451
274 Ga0157378_10036866
275 Ga0157372_10043644
276 Ga0157372_10069842
277 Ga0163163_10024685
278 Ga0163163_10169826
279 Ga0163161_10208602
280 Ga0209565_1000012
281 Ga0209673_1003664
282 Ga0209675_1009477
283 Ga0209758_1003596
284 Ga0209758_1046096
285 Ga0209256_1000012
286 Ga0209257_1000934
287 Ga0207710_10005417
288 Ga0207647_10001800
289 Ga0207647_10001873
290 Ga0207705_10000497
291 Ga0207707_10004392
292 Ga0207660_10000224
293 Ga0207657_10002954
294 Ga0207657_10049261
295 Ga0207649_10000102
296 Ga0207652_10000021
297 Ga0207694_10197447
298 Ga0207650_10735505
299 Ga0207644_10004407
300 Ga0207690_10124064
301 Ga0207690_10200262
302 Ga0207706_10013217
303 Ga0207706_10024846
304 Ga0207706_10051331
305 Ga0207669_10021847
306 Ga0207679_10102631
307 Ga0207712_10000023
308 Ga0207641_10007310
309 Ga0207674_10553949
310 Ga0207698_10061975
311 Ga0209589_1000015
312 Ga0209489_100015
313 Ga0209700_100025
314 Ga0268265_10000049
315 Ga0268264_10000682
316 Ga0268264_10835453
317 Ga0265326_10018233
318 Ga0265323_10000963
319 Ga0265336_10002620
320 Ga0265338_10000086
321 Ga0265324_10004325
322 Ga0307513_10054613
323 Ga0307508_10070952
324 Ga0326468_10009896
325 Ga0307412_10000362
326 Ga0307409_100703468
327 Ga0307411_10621342
328 Ga0373945_0040629
329 Ga0373931_0014509
330 Ga0373927_0121701
331 Ga0373947_0251434
332 Ga0373925_0107659
333 Ga0395898_0949582
334 Ga0395901_0026438
335 Ga0395901_0115090
336 Ga0237819_01183
337 Ga0439436_0115042
338 Ga0439439_0017756
339 Ga0439465_0033708
340 Ga0439431_0074677
341 Ga0439448_0001711
342 Ga0439448_0008294
343 Ga0439448_0010661
344 Ga0439448_0013703
345 Ga0439448_0035767
346 Ga0439452_007194
347 Ga0439455_0001069
348 Ga0439455_0003642
349 Ga0439455_0015655
350 Ga0439457_010816
351 Ga0439462_0005200
352 Ga0439446_0155271
353 Ga0439458_0000290
354 Ga0439458_0000681
355 Ga0466965_0143655
356 Ga0466968_0001554
357 Ga0466957_0188063
358 Ga0466960_0385633
359 Ga0466967_0295683
360 Ga0495627_048405
361 Ga0495603_0134409
362 Ga0495641_0079175
363 Ga0495585_0194600
364 Ga0495630_0391198
365 Ga0495648_0000088
366 Ga0495666_0214764
367 Ga0495665_0097801
368 Ga0495656_0268692
369 Ga0495668_0099962
370 Ga0495625_0029550
371 Ga0495624_0059558
372 Ga0495676_0094664
373 Ga0495686_0005914
374 Ga0496100_0288866
375 Ga0496104_0002817
376 Ga0496104_0013396
377 Ga0496104_0071796
378 Ga0496104_0595112
379 Ga0496105_0185587
380 Ga0496105_0214453
381 Ga0496108_0000514
382 Ga0496108_0006697
383 Ga0496108_0500195
384 Ga0496109_0038773
385 Ga0496109_0089847
386 Ga0496110_0006055
387 Ga0496110_0097154
388 Ga0496110_0579756
389 Ga0496111_0006583
390 Ga0496111_0109228
391 Ga0496112_0028262
392 Ga0496112_0041448
393 Ga0496112_0212890
394 Ga0496113_0015914
395 Ga0496113_0041145
396 Ga0496113_0147815
397 Ga0496115_0055304
398 Ga0501031_0045932
399 Ga0501036_0121178
400 Ga0501038_0131163
401 Ga0501039_0086884
402 Ga0501042_0057599
403 Ga0501048_0027645
404 Ga0501075_0053063
405 Ga0501076_0048994
406 Ga0501083_0252760
407 Ga0501035_0145986
408 Ga0501045_0035476
409 nmdc:mga0k408_162610_c1
410 Ga0495655_0043813
411 Ga0500643_003431
412 Ga0500643_005362
413 Ga0500658_0001022
414 Ga0500658_0024864
415 Ga0500568_0037973
416 Ga0500627_0000207
417 2600202075
418 2600228304
419 2644126829
420 2819714918
421 2829746215
422 2835317263
423 2861693276
424 2885430967
425 2919142387
426 8045866667
427 8045868178
428 8056690840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

50

137

0.96

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

169

244

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.9473 36 234
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.9418 33 231
8qto-assembly1.cif.gz_A-2 crystal structure of holo-l28h-fnr of a. fischeri 0.9265 15 234
5e44-assembly1.cif.gz_A-2 crystal structure of holo-fnr of a. fischeri 0.9218 3 233
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.9145 33 231
ID Description Score Start End Superfamily
5e44A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9621 153 233 1.10.10.10
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9285 33 152 2.60.120.10
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9212 33 152 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9195 36 152 2.60.120.10
4i2oB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9154 153 231 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A430BDH5-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9705 22 239 GO:0003677
GO:0006355
AF-A0A239CUW6-F1-model_v4 Transcriptional regulator, Crp/Fnr family 0.9675 30 241 GO:0003677
GO:0006355
AF-A0A4R2SCG6-F1-model_v4 CRP-like cAMP-binding protein 0.967 2 239 GO:0003677
GO:0006355
AF-A0A4Q3LTC8-F1-model_v4 deleted 0.966 8 240
AF-A0A6A4UQM5-F1-model_v4 Putative signal transduction histidine kinase 0.9657 46 240 GO:0003677
GO:0006355
GO:0016301

Map