F323959
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 213 | 162 | 209 | 346 |
Family's Representative Sequence
| Representative Sequence | 3300007788|Ga0099795_10000011|Ga0099795_1000001111 |
| Length | 400 |
| Sequence | MSLEAWLQRIWYGGRTAPWWLRALSPVFGLIVRARRALYARGWCRTVRLAVPVIVVGNINVGGTGKTPLVIWLAGRLAALGLPVAVVSRGYGRRGRRDVVRLLAGSSADEVGDEPLVIARRAQCPVYVGSDRVRAAQAAIAGGAAVVIADDGLQHLRLARDAEVALADTQRGFGNGALLPAGPLRELPTRLDTVSALVWSVESFGPAAGERWEQLERPGFRMLLAGSELRAVGASGRSCELASLAGERVHAVAGIGNPRRLFAALRAAGLQPIEHPFPDHHRYRAADLQFADHLPVIMTEKDAVKCQSFAPANGWYLPVTAHFAPADESALLGRILMDARLLDILVCPVCKGPLRMASEAAGKLLVCRADRLAYPIRDGIPVMLEEEARLLETTDPLLER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 2 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 3 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 4 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 37 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 38 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 39 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 40 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 52 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 105 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 106 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 107 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 108 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 109 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 110 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 113 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 114 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 115 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 116 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 119 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 122 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 123 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 124 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 125 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 126 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 127 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 128 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 129 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 147 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 148 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 149 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 155 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 156 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 157 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 158 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 159 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 160 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 161 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.12 |
| Metatranscriptomes | 0 |
| Isolates | 1.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.27 |
| Nodule | 0 |
| Rhizoplane | 1.88 |
| Rhizosphere | 78.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10027073 | 3300003323 | Bacteria | 1301 |
| 2 | Ga0055529_1001134 | 3300003763 | Bacteria | 11334 |
| 3 | Ga0070658_10001308 | 3300005327 | Bacteria | 21276 |
| 4 | Ga0070676_10003770 | 3300005328 | Bacteria | 7946 |
| 5 | Ga0070676_10152179 | 3300005328 | Bacteria | 1482 |
| 6 | Ga0070683_100041605 | 3300005329 | Bacteria | 4228 |
| 7 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 8 | Ga0070666_10003818 | 3300005335 | Bacteria | 9142 |
| 9 | Ga0070666_10015077 | 3300005335 | Bacteria | 4926 |
| 10 | Ga0070680_100016666 | 3300005336 | Bacteria | 5786 |
| 11 | Ga0070680_100066633 | 3300005336 | Bacteria | 2953 |
| 12 | Ga0070680_100348428 | 3300005336 | Bacteria | 1259 |
| 13 | Ga0070668_100021201 | 3300005347 | Bacteria | 4912 |
| 14 | Ga0070675_100025239 | 3300005354 | Bacteria | 4764 |
| 15 | Ga0070671_100015116 | 3300005355 | Bacteria | 6234 |
| 16 | Ga0070671_100216203 | 3300005355 | Bacteria | 1626 |
| 17 | Ga0070667_100000225 | 3300005367 | Bacteria | 65088 |
| 18 | Ga0070667_100017086 | 3300005367 | Bacteria | 6010 |
| 19 | Ga0070667_100314103 | 3300005367 | Bacteria | 1413 |
| 20 | Ga0070713_100023726 | 3300005436 | Bacteria | 4767 |
| 21 | Ga0070700_100007840 | 3300005441 | Bacteria | 5790 |
| 22 | Ga0070678_100090992 | 3300005456 | Bacteria | 2340 |
| 23 | Ga0070678_100136107 | 3300005456 | Bacteria | 1959 |
| 24 | Ga0070662_100024974 | 3300005457 | Bacteria | 4123 |
| 25 | Ga0070681_10002603 | 3300005458 | Bacteria | 16557 |
| 26 | Ga0070681_10006270 | 3300005458 | Bacteria | 11566 |
| 27 | Ga0070681_10052643 | 3300005458 | Bacteria | 4061 |
| 28 | Ga0068867_100011231 | 3300005459 | Bacteria | 6317 |
| 29 | Ga0068867_100162253 | 3300005459 | Bacteria | 1763 |
| 30 | Ga0068867_100325344 | 3300005459 | Bacteria | 1275 |
| 31 | Ga0070679_100019979 | 3300005530 | Bacteria | 6525 |
| 32 | Ga0070679_100077227 | 3300005530 | Bacteria | 3319 |
| 33 | Ga0070679_100102733 | 3300005530 | Bacteria | 2845 |
| 34 | Ga0068853_100119057 | 3300005539 | Bacteria | 2353 |
| 35 | Ga0070672_100013464 | 3300005543 | Bacteria | 5778 |
| 36 | Ga0070665_100003700 | 3300005548 | Bacteria | 16196 |
| 37 | Ga0070665_100273590 | 3300005548 | Bacteria | 1691 |
| 38 | Ga0068855_100001761 | 3300005563 | Bacteria | 27049 |
| 39 | Ga0068857_100025225 | 3300005577 | Bacteria | 5235 |
| 40 | Ga0068856_100095125 | 3300005614 | Bacteria | 2967 |
| 41 | Ga0068859_100040948 | 3300005617 | Bacteria | 4654 |
| 42 | Ga0068864_100031276 | 3300005618 | Bacteria | 4516 |
| 43 | Ga0068861_100006662 | 3300005719 | Bacteria | 7887 |
| 44 | Ga0068863_100002615 | 3300005841 | Bacteria | 17844 |
| 45 | Ga0068858_100007361 | 3300005842 | Bacteria | 10652 |
| 46 | Ga0068860_100003601 | 3300005843 | Bacteria | 15912 |
| 47 | Ga0068860_100047552 | 3300005843 | Bacteria | 4089 |
| 48 | Ga0068862_100060242 | 3300005844 | Bacteria | 3260 |
| 49 | Ga0075365_10001639 | 3300006038 | Bacteria | 10321 |
| 50 | Ga0075368_10015544 | 3300006042 | Bacteria | 2826 |
| 51 | Ga0075363_100014716 | 3300006048 | Bacteria | 3831 |
| 52 | Ga0075364_10027578 | 3300006051 | Eukaryota | 3629 |
| 53 | Ga0070715_10021714 | 3300006163 | Bacteria | 2493 |
| 54 | Ga0070716_100013841 | 3300006173 | Bacteria | 4121 |
| 55 | Ga0070716_100062014 | 3300006173 | Bacteria | 2166 |
| 56 | Ga0075367_10020818 | 3300006178 | Bacteria | 3658 |
| 57 | Ga0075367_10052314 | 3300006178 | Bacteria | 2417 |
| 58 | Ga0075369_10000016 | 3300006186 | Bacteria | 52351 |
| 59 | Ga0097621_100064906 | 3300006237 | Bacteria | 3003 |
| 60 | Ga0075370_10000902 | 3300006353 | Bacteria | 12172 |
| 61 | Ga0068871_100009478 | 3300006358 | Bacteria | 7058 |
| 62 | Ga0068871_100014932 | 3300006358 | Bacteria | 5806 |
| 63 | Ga0075428_100039878 | 3300006844 | Bacteria | 5168 |
| 64 | Ga0075430_100007295 | 3300006846 | Bacteria | 9335 |
| 65 | Ga0075430_100103956 | 3300006846 | Bacteria | 2371 |
| 66 | Ga0068865_100039001 | 3300006881 | Bacteria | 3219 |
| 67 | Ga0097620_100040947 | 3300006931 | Bacteria | 4654 |
| 68 | Ga0099795_10000011 | 3300007788 | Bacteria | 78558 |
| 69 | Ga0105250_10079885 | 3300009092 | Bacteria | 1325 |
| 70 | Ga0105240_10010501 | 3300009093 | Bacteria | 13015 |
| 71 | Ga0105240_10011424 | 3300009093 | Bacteria | 12368 |
| 72 | Ga0111539_10032739 | 3300009094 | Bacteria | 6313 |
| 73 | Ga0105245_10040468 | 3300009098 | Bacteria | 4153 |
| 74 | Ga0105247_10042572 | 3300009101 | Bacteria | 2782 |
| 75 | Ga0105248_10085322 | 3300009177 | Bacteria | 3553 |
| 76 | Ga0105237_10212870 | 3300009545 | Bacteria | 1932 |
| 77 | Ga0105238_10003211 | 3300009551 | Bacteria | 16322 |
| 78 | Ga0105238_10495822 | 3300009551 | Unclassified | 1222 |
| 79 | Ga0105249_10059854 | 3300009553 | Bacteria | 3494 |
| 80 | Ga0099796_10000024 | 3300010159 | Bacteria | 38665 |
| 81 | Ga0105239_10206728 | 3300010375 | Bacteria | 2200 |
| 82 | Ga0157370_10003246 | 3300013104 | Bacteria | 19167 |
| 83 | Ga0157370_10171006 | 3300013104 | Bacteria | 2020 |
| 84 | Ga0157369_10002299 | 3300013105 | Bacteria | 22992 |
| 85 | Ga0157369_10041055 | 3300013105 | Bacteria | 5050 |
| 86 | Ga0157374_10006280 | 3300013296 | Bacteria | 10075 |
| 87 | Ga0157378_10019344 | 3300013297 | Bacteria | 5988 |
| 88 | Ga0163162_10000294 | 3300013306 | Bacteria | 45823 |
| 89 | Ga0163162_10001907 | 3300013306 | Bacteria | 19653 |
| 90 | Ga0163163_10037590 | 3300014325 | Bacteria | 4711 |
| 91 | Ga0157380_10045893 | 3300014326 | Bacteria | 3431 |
| 92 | Ga0157380_10070753 | 3300014326 | Bacteria | 2820 |
| 93 | Ga0157379_10000187 | 3300014968 | Bacteria | 47593 |
| 94 | Ga0182005_1020226 | 3300015265 | Bacteria | 1833 |
| 95 | Ga0209455_1001352 | 3300025272 | Bacteria | 11264 |
| 96 | Ga0209676_1032620 | 3300025292 | Bacteria | 1564 |
| 97 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 98 | Ga0207680_10003207 | 3300025903 | Bacteria | 7693 |
| 99 | Ga0207645_10001254 | 3300025907 | Bacteria | 20898 |
| 100 | Ga0207705_10001674 | 3300025909 | Bacteria | 17644 |
| 101 | Ga0207707_10000279 | 3300025912 | Bacteria | 54572 |
| 102 | Ga0207707_10011614 | 3300025912 | Bacteria | 7666 |
| 103 | Ga0207707_10069195 | 3300025912 | Bacteria | 3076 |
| 104 | Ga0207707_10151829 | 3300025912 | Bacteria | 2025 |
| 105 | Ga0207707_10216214 | 3300025912 | Bacteria | 1669 |
| 106 | Ga0207695_10009197 | 3300025913 | Bacteria | 12252 |
| 107 | Ga0207695_10029270 | 3300025913 | Bacteria | 6091 |
| 108 | Ga0207660_10002539 | 3300025917 | Bacteria | 11980 |
| 109 | Ga0207660_10262069 | 3300025917 | Bacteria | 1367 |
| 110 | Ga0207681_10011101 | 3300025923 | Bacteria | 5531 |
| 111 | Ga0207681_10058912 | 3300025923 | Bacteria | 2631 |
| 112 | Ga0207681_10060492 | 3300025923 | Bacteria | 2600 |
| 113 | Ga0207694_10000332 | 3300025924 | Bacteria | 44554 |
| 114 | Ga0207694_10381647 | 3300025924 | Unclassified | 1170 |
| 115 | Ga0207659_10072597 | 3300025926 | Bacteria | 2517 |
| 116 | Ga0207700_10108909 | 3300025928 | Bacteria | 2225 |
| 117 | Ga0207706_10000228 | 3300025933 | Bacteria | 61381 |
| 118 | Ga0207704_10017425 | 3300025938 | Bacteria | 3723 |
| 119 | Ga0207691_10007519 | 3300025940 | Bacteria | 10485 |
| 120 | Ga0207691_10141186 | 3300025940 | Bacteria | 2123 |
| 121 | Ga0207661_10437813 | 3300025944 | Bacteria | 1189 |
| 122 | Ga0207667_10016557 | 3300025949 | Bacteria | 8326 |
| 123 | Ga0207668_10038646 | 3300025972 | Bacteria | 3206 |
| 124 | Ga0207703_10002540 | 3300026035 | Bacteria | 15767 |
| 125 | Ga0207639_10033887 | 3300026041 | Bacteria | 3770 |
| 126 | Ga0207708_10010373 | 3300026075 | Bacteria | 6916 |
| 127 | Ga0207708_10024603 | 3300026075 | Bacteria | 4554 |
| 128 | Ga0207702_10189623 | 3300026078 | Bacteria | 1899 |
| 129 | Ga0207648_10010393 | 3300026089 | Bacteria | 8823 |
| 130 | Ga0207648_10014774 | 3300026089 | Bacteria | 7203 |
| 131 | Ga0207648_10100897 | 3300026089 | Bacteria | 2529 |
| 132 | Ga0207676_10078273 | 3300026095 | Bacteria | 2678 |
| 133 | Ga0207675_100001467 | 3300026118 | Bacteria | 23651 |
| 134 | Ga0207675_100060827 | 3300026118 | Bacteria | 3526 |
| 135 | Ga0209179_1000033 | 3300027512 | Bacteria | 33935 |
| 136 | Ga0209971_1006543 | 3300027682 | Bacteria | 2756 |
| 137 | Ga0209813_10034733 | 3300027866 | Bacteria | 1506 |
| 138 | Ga0209974_10002897 | 3300027876 | Bacteria | 6225 |
| 139 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 140 | Ga0268266_10207130 | 3300028379 | Bacteria | 1797 |
| 141 | Ga0268265_10048023 | 3300028380 | Bacteria | 3202 |
| 142 | Ga0268265_10203753 | 3300028380 | Bacteria | 1718 |
| 143 | Ga0268265_10267134 | 3300028380 | Bacteria | 1524 |
| 144 | Ga0268264_10038178 | 3300028381 | Bacteria | 3962 |
| 145 | Ga0307515_10001344 | 3300028794 | Bacteria | 55675 |
| 146 | Ga0307511_10002306 | 3300030521 | Bacteria | 19914 |
| 147 | Ga0307511_10041820 | 3300030521 | Bacteria | 3862 |
| 148 | Ga0265340_10062514 | 3300031247 | Bacteria | 1778 |
| 149 | Ga0307513_10029073 | 3300031456 | Bacteria | 6308 |
| 150 | Ga0307509_10000013 | 3300031507 | Bacteria | 283027 |
| 151 | Ga0307516_10000991 | 3300031730 | Bacteria | 39211 |
| 152 | Ga0307410_10003267 | 3300031852 | Bacteria | 8092 |
| 153 | Ga0307414_10057732 | 3300032004 | Unclassified | 2730 |
| 154 | Ga0307510_10003555 | 3300033180 | Bacteria | 18190 |
| 155 | Ga0316574_0005141 | 3300035398 | Bacteria | 6956 |
| 156 | Ga0436360_0567246 | 3300039438 | Bacteria | 4094 |
| 157 | Ga0439435_0005016 | 3300042436 | Bacteria | 2887 |
| 158 | Ga0495592_0000346 | 3300046454 | Bacteria | 37799 |
| 159 | Ga0495650_0001070 | 3300046471 | Bacteria | 30292 |
| 160 | Ga0496104_0000548 | 3300048907 | Bacteria | 32116 |
| 161 | Ga0496108_0036053 | 3300048911 | Bacteria | 4113 |
| 162 | Ga0496109_0041796 | 3300048912 | Bacteria | 4152 |
| 163 | Ga0496110_0035030 | 3300048913 | Bacteria | 4352 |
| 164 | Ga0496117_0028486 | 3300048920 | Bacteria | 4324 |
| 165 | Ga0496121_0119494 | 3300048924 | Bacteria | 1993 |
| 166 | Ga0496122_0002359 | 3300048925 | Bacteria | 27157 |
| 167 | Ga0496123_0000108 | 3300048926 | Bacteria | 166102 |
| 168 | Ga0496124_0198995 | 3300048927 | Bacteria | 1525 |
| 169 | Ga0496125_0047676 | 3300048928 | Bacteria | 3580 |
| 170 | Ga0496125_0108137 | 3300048928 | Bacteria | 2024 |
| 171 | Ga0496126_0038936 | 3300048929 | Bacteria | 4418 |
| 172 | Ga0501036_0217351 | 3300049572 | Bacteria | 1605 |
| 173 | Ga0501041_0146355 | 3300049577 | Bacteria | 1474 |
| 174 | Ga0501067_0007527 | 3300049583 | Bacteria | 6052 |
| 175 | Ga0501068_0002265 | 3300049584 | Bacteria | 10250 |
| 176 | Ga0501069_0015593 | 3300049585 | Bacteria | 4074 |
| 177 | Ga0501070_0009589 | 3300049586 | Bacteria | 8178 |
| 178 | Ga0501070_0224345 | 3300049586 | Bacteria | 1540 |
| 179 | Ga0501071_0003341 | 3300049587 | Bacteria | 10027 |
| 180 | Ga0501071_0050433 | 3300049587 | Bacteria | 2998 |
| 181 | Ga0501073_0000314 | 3300049589 | Bacteria | 32139 |
| 182 | Ga0501074_0007153 | 3300049590 | Bacteria | 8061 |
| 183 | Ga0501076_0039539 | 3300049592 | Bacteria | 3703 |
| 184 | Ga0501077_0005391 | 3300049593 | Bacteria | 7774 |
| 185 | Ga0501079_0004649 | 3300049741 | Bacteria | 10169 |
| 186 | Ga0501080_0001135 | 3300049742 | Bacteria | 21930 |
| 187 | Ga0501081_0073019 | 3300049743 | Bacteria | 2393 |
| 188 | Ga0501035_0050977 | 3300049822 | Bacteria | 3707 |
| 189 | Ga0501044_0000062 | 3300049823 | Bacteria | 131395 |
| 190 | Ga0501045_0005784 | 3300049824 | Bacteria | 8555 |
| 191 | nmdc:mga03n38_32749_c1 | 3300050490 | Bacteria | 2205 |
| 192 | nmdc:mga0yw44_52680_c1 | 3300050492 | Eukaryota | 2468 |
| 193 | nmdc:mga07m45_115_c1 | 3300050496 | Bacteria | 32090 |
| 194 | nmdc:mga07m45_20413_c1 | 3300050496 | Bacteria | 3598 |
| 195 | nmdc:mga05p37_378053_c1 | 3300050507 | Bacteria | 1660 |
| 196 | nmdc:mga09592_7835_c1 | 3300050508 | Bacteria | 8682 |
| 197 | nmdc:mga0qj67_3433_c1 | 3300050509 | Bacteria | 11419 |
| 198 | nmdc:mga06r32_320024_c1 | 3300050510 | Bacteria | 1537 |
| 199 | nmdc:mga08y16_187859_c1 | 3300050511 | Bacteria | 2144 |
| 200 | nmdc:mga0sz30_22_c3 | 3300050516 | Bacteria | 64467 |
| 201 | Ga0500644_0026309 | 3300053088 | Bacteria | 1799 |
| 202 | Ga0500646_0020901 | 3300053090 | Bacteria | 1741 |
| 203 | Ga0500641_0025866 | 3300053096 | Bacteria | 2274 |
| 204 | Ga0500559_0001129 | 3300053136 | Bacteria | 16078 |
| 205 | Ga0500559_0008319 | 3300053136 | Bacteria | 4557 |
| 206 | Ga0500616_0008038 | 3300053153 | Bacteria | 6607 |
| 207 | Ga0500637_0011052 | 3300053178 | Bacteria | 4648 |
| 208 | Ga0501082_0080455 | 3300060353 | Bacteria | 2812 |
| 209 | Ga0530510_0072160 | 3300061734 | Bacteria | 2506 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2842747753 | 2842751506 | 285 |
| 2 | iso_pu_bacteria | 2842733646 | 2842734839 | 301 |
| 3 | 3300005539 | Ga0068853_100119057 | Ga0068853_1001190572 | 302 |
| 4 | 3300026041 | Ga0207639_10033887 | Ga0207639_100338873 | 302 |
| 5 | 3300048920 | Ga0496117_0028486 | Ga0496117_0028486_502_1539 | 302 |
| 6 | 3300005548 | Ga0070665_100273590 | Ga0070665_1002735903 | 303 |
| 7 | 3300005577 | Ga0068857_100025225 | Ga0068857_1000252255 | 303 |
| 8 | 3300006178 | Ga0075367_10052314 | Ga0075367_100523143 | 303 |
| 9 | 3300025923 | Ga0207681_10060492 | Ga0207681_100604924 | 303 |
| 10 | 3300048925 | Ga0496122_0002359 | Ga0496122_0002359_19790_20770 | 303 |
| 11 | 3300048926 | Ga0496123_0000108 | Ga0496123_0000108_38981_39961 | 303 |
| 12 | 3300048927 | Ga0496124_0198995 | Ga0496124_0198995_528_1508 | 303 |
| 13 | 3300050496 | nmdc:mga07m45_20413_c1 | nmdc:mga07m45_20413_c1_1130_2110 | 303 |
| 14 | 3300053136 | Ga0500559_0001129 | Ga0500559_0001129_6261_7241 | 303 |
| 15 | 3300053136 | Ga0500559_0008319 | Ga0500559_0008319_1135_2115 | 303 |
| 16 | 3300025292 | Ga0209676_1032620 | Ga0209676_10326201 | 308 |
| 17 | 3300006038 | Ga0075365_10001639 | Ga0075365_100016393 | 310 |
| 18 | 3300006042 | Ga0075368_10015544 | Ga0075368_100155443 | 310 |
| 19 | 3300006048 | Ga0075363_100014716 | Ga0075363_1000147164 | 310 |
| 20 | 3300006051 | Ga0075364_10027578 | Ga0075364_100275785 | 310 |
| 21 | 3300006173 | Ga0070716_100062014 | Ga0070716_1000620142 | 310 |
| 22 | 3300006178 | Ga0075367_10020818 | Ga0075367_100208185 | 310 |
| 23 | 3300006186 | Ga0075369_10000016 | Ga0075369_1000001625 | 310 |
| 24 | 3300006353 | Ga0075370_10000902 | Ga0075370_100009029 | 310 |
| 25 | 3300027866 | Ga0209813_10034733 | Ga0209813_100347332 | 310 |
| 26 | 3300050490 | nmdc:mga03n38_32749_c1 | nmdc:mga03n38_32749_c1_225_1217 | 310 |
| 27 | 3300050492 | nmdc:mga0yw44_52680_c1 | nmdc:mga0yw44_52680_c1_1169_2161 | 310 |
| 28 | 3300050496 | nmdc:mga07m45_115_c1 | nmdc:mga07m45_115_c1_22673_23665 | 310 |
| 29 | 3300050508 | nmdc:mga09592_7835_c1 | nmdc:mga09592_7835_c1_5595_6587 | 310 |
| 30 | 3300050516 | nmdc:mga0sz30_22_c3 | nmdc:mga0sz30_22_c3_22233_23225 | 310 |
| 31 | 3300053088 | Ga0500644_0026309 | Ga0500644_0026309_365_1378 | 312 |
| 32 | 3300005327 | Ga0070658_10001308 | Ga0070658_1000130812 | 313 |
| 33 | 3300009551 | Ga0105238_10003211 | Ga0105238_100032119 | 313 |
| 34 | 3300025909 | Ga0207705_10001674 | Ga0207705_100016747 | 313 |
| 35 | 3300025924 | Ga0207694_10000332 | Ga0207694_1000033215 | 313 |
| 36 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004972 | 313 |
| 37 | 3300003763 | Ga0055529_1001134 | Ga0055529_100113413 | 314 |
| 38 | 3300005367 | Ga0070667_100000225 | Ga0070667_10000022547 | 314 |
| 39 | 3300014326 | Ga0157380_10045893 | Ga0157380_100458934 | 314 |
| 40 | 3300025272 | Ga0209455_1001352 | Ga0209455_10013527 | 314 |
| 41 | 3300025903 | Ga0207680_10003207 | Ga0207680_100032077 | 314 |
| 42 | 3300048928 | Ga0496125_0047676 | Ga0496125_0047676_1789_2808 | 314 |
| 43 | 3300033180 | Ga0307510_10003555 | Ga0307510_100035556 | 315 |
| 44 | 3300053090 | Ga0500646_0020901 | Ga0500646_0020901_566_1531 | 315 |
| 45 | 3300005335 | Ga0070666_10000005 | Ga0070666_10000005201 | 316 |
| 46 | 3300005367 | Ga0070667_100314103 | Ga0070667_1003141031 | 316 |
| 47 | 3300005456 | Ga0070678_100136107 | Ga0070678_1001361072 | 316 |
| 48 | 3300005843 | Ga0068860_100047552 | Ga0068860_1000475522 | 316 |
| 49 | 3300013306 | Ga0163162_10000294 | Ga0163162_1000029419 | 316 |
| 50 | 3300015265 | Ga0182005_1020226 | Ga0182005_10202262 | 316 |
| 51 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005559 | 316 |
| 52 | 3300028381 | Ga0268264_10038178 | Ga0268264_100381782 | 316 |
| 53 | 3300046471 | Ga0495650_0001070 | Ga0495650_0001070_17610_18584 | 316 |
| 54 | 3300048924 | Ga0496121_0119494 | Ga0496121_0119494_394_1368 | 316 |
| 55 | 3300048928 | Ga0496125_0108137 | Ga0496125_0108137_402_1376 | 316 |
| 56 | 3300048929 | Ga0496126_0038936 | Ga0496126_0038936_2731_3705 | 316 |
| 57 | 3300049823 | Ga0501044_0000062 | Ga0501044_0000062_93261_94346 | 317 |
| 58 | 3300006358 | Ga0068871_100014932 | Ga0068871_1000149327 | 318 |
| 59 | 3300009545 | Ga0105237_10212870 | Ga0105237_102128702 | 318 |
| 60 | 3300031730 | Ga0307516_10000991 | Ga0307516_100009914 | 318 |
| 61 | 3300046454 | Ga0495592_0000346 | Ga0495592_0000346_4964_6022 | 318 |
| 62 | 3300005335 | Ga0070666_10015077 | Ga0070666_100150777 | 319 |
| 63 | 3300009092 | Ga0105250_10079885 | Ga0105250_100798853 | 319 |
| 64 | 3300009101 | Ga0105247_10042572 | Ga0105247_100425722 | 319 |
| 65 | 3300035398 | Ga0316574_0005141 | Ga0316574_0005141_3944_4939 | 320 |
| 66 | 3300030521 | Ga0307511_10041820 | Ga0307511_100418202 | 321 |
| 67 | 3300049586 | Ga0501070_0224345 | Ga0501070_0224345_323_1333 | 322 |
| 68 | 3300005328 | Ga0070676_10003770 | Ga0070676_100037706 | 323 |
| 69 | 3300005329 | Ga0070683_100041605 | Ga0070683_1000416054 | 323 |
| 70 | 3300005336 | Ga0070680_100066633 | Ga0070680_1000666332 | 323 |
| 71 | 3300005355 | Ga0070671_100015116 | Ga0070671_1000151164 | 323 |
| 72 | 3300005459 | Ga0068867_100011231 | Ga0068867_1000112316 | 323 |
| 73 | 3300005530 | Ga0070679_100102733 | Ga0070679_1001027334 | 323 |
| 74 | 3300025912 | Ga0207707_10151829 | Ga0207707_101518293 | 323 |
| 75 | 3300025917 | Ga0207660_10262069 | Ga0207660_102620692 | 323 |
| 76 | 3300026089 | Ga0207648_10010393 | Ga0207648_100103938 | 323 |
| 77 | 3300039438 | Ga0436360_0567246 | Ga0436360_0567246_2071_3096 | 324 |
| 78 | 3300049583 | Ga0501067_0007527 | Ga0501067_0007527_1967_2968 | 324 |
| 79 | 3300049584 | Ga0501068_0002265 | Ga0501068_0002265_1892_2893 | 324 |
| 80 | 3300049585 | Ga0501069_0015593 | Ga0501069_0015593_1659_2660 | 324 |
| 81 | 3300049586 | Ga0501070_0009589 | Ga0501070_0009589_5250_6251 | 324 |
| 82 | 3300049587 | Ga0501071_0003341 | Ga0501071_0003341_6968_7969 | 324 |
| 83 | 3300049589 | Ga0501073_0000314 | Ga0501073_0000314_28858_29859 | 324 |
| 84 | 3300049590 | Ga0501074_0007153 | Ga0501074_0007153_5174_6175 | 324 |
| 85 | 3300049592 | Ga0501076_0039539 | Ga0501076_0039539_2058_3059 | 324 |
| 86 | 3300049593 | Ga0501077_0005391 | Ga0501077_0005391_1516_2517 | 324 |
| 87 | 3300049741 | Ga0501079_0004649 | Ga0501079_0004649_1966_2967 | 324 |
| 88 | 3300049742 | Ga0501080_0001135 | Ga0501080_0001135_1953_2954 | 324 |
| 89 | 3300049743 | Ga0501081_0073019 | Ga0501081_0073019_127_1128 | 324 |
| 90 | 3300049822 | Ga0501035_0050977 | Ga0501035_0050977_1083_2171 | 324 |
| 91 | 3300061734 | Ga0530510_0072160 | Ga0530510_0072160_18_1019 | 324 |
| 92 | 3300031247 | Ga0265340_10062514 | Ga0265340_100625142 | 326 |
| 93 | 3300005336 | Ga0070680_100348428 | Ga0070680_1003484281 | 327 |
| 94 | 3300005458 | Ga0070681_10002603 | Ga0070681_100026039 | 327 |
| 95 | 3300005530 | Ga0070679_100077227 | Ga0070679_1000772273 | 327 |
| 96 | 3300025912 | Ga0207707_10011614 | Ga0207707_100116147 | 327 |
| 97 | 3300005347 | Ga0070668_100021201 | Ga0070668_1000212013 | 328 |
| 98 | 3300005457 | Ga0070662_100024974 | Ga0070662_1000249743 | 328 |
| 99 | 3300005459 | Ga0068867_100162253 | Ga0068867_1001622532 | 328 |
| 100 | 3300005543 | Ga0070672_100013464 | Ga0070672_1000134643 | 328 |
| 101 | 3300005719 | Ga0068861_100006662 | Ga0068861_1000066621 | 328 |
| 102 | 3300006846 | Ga0075430_100007295 | Ga0075430_1000072953 | 328 |
| 103 | 3300006881 | Ga0068865_100039001 | Ga0068865_1000390012 | 328 |
| 104 | 3300009094 | Ga0111539_10032739 | Ga0111539_100327395 | 328 |
| 105 | 3300009553 | Ga0105249_10059854 | Ga0105249_100598543 | 328 |
| 106 | 3300014326 | Ga0157380_10070753 | Ga0157380_100707533 | 328 |
| 107 | 3300025907 | Ga0207645_10001254 | Ga0207645_1000125410 | 328 |
| 108 | 3300025923 | Ga0207681_10011101 | Ga0207681_100111014 | 328 |
| 109 | 3300025933 | Ga0207706_10000228 | Ga0207706_1000022828 | 328 |
| 110 | 3300025938 | Ga0207704_10017425 | Ga0207704_100174253 | 328 |
| 111 | 3300025940 | Ga0207691_10007519 | Ga0207691_100075197 | 328 |
| 112 | 3300025972 | Ga0207668_10038646 | Ga0207668_100386464 | 328 |
| 113 | 3300026075 | Ga0207708_10024603 | Ga0207708_100246033 | 328 |
| 114 | 3300026089 | Ga0207648_10014774 | Ga0207648_100147743 | 328 |
| 115 | 3300026118 | Ga0207675_100001467 | Ga0207675_10000146714 | 328 |
| 116 | 3300027682 | Ga0209971_1006543 | Ga0209971_10065432 | 328 |
| 117 | 3300027876 | Ga0209974_10002897 | Ga0209974_100028973 | 328 |
| 118 | 3300028380 | Ga0268265_10203753 | Ga0268265_102037533 | 328 |
| 119 | 3300032004 | Ga0307414_10057732 | Ga0307414_100577324 | 328 |
| 120 | 3300050507 | nmdc:mga05p37_378053_c1 | nmdc:mga05p37_378053_c1_50_1096 | 328 |
| 121 | 3300050509 | nmdc:mga0qj67_3433_c1 | nmdc:mga0qj67_3433_c1_4935_5981 | 328 |
| 122 | 3300050511 | nmdc:mga08y16_187859_c1 | nmdc:mga08y16_187859_c1_1073_2119 | 328 |
| 123 | iso_pu_bacteria | 2881927736 | 2881928088 | 328 |
| 124 | 3300005456 | Ga0070678_100090992 | Ga0070678_1000909923 | 329 |
| 125 | 3300006844 | Ga0075428_100039878 | Ga0075428_1000398783 | 329 |
| 126 | 3300006846 | Ga0075430_100103956 | Ga0075430_1001039562 | 329 |
| 127 | 3300042436 | Ga0439435_0005016 | Ga0439435_0005016_1623_2669 | 329 |
| 128 | 3300050510 | nmdc:mga06r32_320024_c1 | nmdc:mga06r32_320024_c1_61_1107 | 329 |
| 129 | iso_pu_bacteria | 2895511927 | 2895518510 | 329 |
| 130 | 3300006163 | Ga0070715_10021714 | Ga0070715_100217143 | 330 |
| 131 | 3300006173 | Ga0070716_100013841 | Ga0070716_1000138412 | 330 |
| 132 | 3300025928 | Ga0207700_10108909 | Ga0207700_101089092 | 330 |
| 133 | 3300049572 | Ga0501036_0217351 | Ga0501036_0217351_49_1098 | 330 |
| 134 | 3300049577 | Ga0501041_0146355 | Ga0501041_0146355_335_1384 | 330 |
| 135 | 3300049587 | Ga0501071_0050433 | Ga0501071_0050433_352_1401 | 330 |
| 136 | 3300049824 | Ga0501045_0005784 | Ga0501045_0005784_2116_3165 | 330 |
| 137 | 3300060353 | Ga0501082_0080455 | Ga0501082_0080455_1212_2261 | 330 |
| 138 | 3300005328 | Ga0070676_10152179 | Ga0070676_101521792 | 331 |
| 139 | 3300005354 | Ga0070675_100025239 | Ga0070675_1000252395 | 331 |
| 140 | 3300005436 | Ga0070713_100023726 | Ga0070713_1000237262 | 331 |
| 141 | 3300005441 | Ga0070700_100007840 | Ga0070700_1000078405 | 331 |
| 142 | 3300005459 | Ga0068867_100325344 | Ga0068867_1003253442 | 331 |
| 143 | 3300005844 | Ga0068862_100060242 | Ga0068862_1000602424 | 331 |
| 144 | 3300014325 | Ga0163163_10037590 | Ga0163163_100375902 | 331 |
| 145 | 3300025923 | Ga0207681_10058912 | Ga0207681_100589122 | 331 |
| 146 | 3300025926 | Ga0207659_10072597 | Ga0207659_100725972 | 331 |
| 147 | 3300025940 | Ga0207691_10141186 | Ga0207691_101411863 | 331 |
| 148 | 3300025944 | Ga0207661_10437813 | Ga0207661_104378131 | 331 |
| 149 | 3300026075 | Ga0207708_10010373 | Ga0207708_100103734 | 331 |
| 150 | 3300026089 | Ga0207648_10100897 | Ga0207648_101008972 | 331 |
| 151 | 3300026118 | Ga0207675_100060827 | Ga0207675_1000608274 | 331 |
| 152 | 3300028380 | Ga0268265_10048023 | Ga0268265_100480232 | 331 |
| 153 | 3300031507 | Ga0307509_10000013 | Ga0307509_10000013141 | 331 |
| 154 | 3300031852 | Ga0307410_10003267 | Ga0307410_100032677 | 331 |
| 155 | 3300030521 | Ga0307511_10002306 | Ga0307511_1000230614 | 332 |
| 156 | 3300053178 | Ga0500637_0011052 | Ga0500637_0011052_3382_4398 | 332 |
| 157 | 3300005336 | Ga0070680_100016666 | Ga0070680_1000166663 | 333 |
| 158 | 3300005458 | Ga0070681_10006270 | Ga0070681_100062707 | 333 |
| 159 | 3300005530 | Ga0070679_100019979 | Ga0070679_1000199793 | 333 |
| 160 | 3300005563 | Ga0068855_100001761 | Ga0068855_1000017617 | 333 |
| 161 | 3300005614 | Ga0068856_100095125 | Ga0068856_1000951254 | 333 |
| 162 | 3300009093 | Ga0105240_10010501 | Ga0105240_100105018 | 333 |
| 163 | 3300009093 | Ga0105240_10011424 | Ga0105240_100114247 | 333 |
| 164 | 3300010375 | Ga0105239_10206728 | Ga0105239_102067282 | 333 |
| 165 | 3300013104 | Ga0157370_10003246 | Ga0157370_1000324612 | 333 |
| 166 | 3300013104 | Ga0157370_10171006 | Ga0157370_101710063 | 333 |
| 167 | 3300013105 | Ga0157369_10002299 | Ga0157369_100022997 | 333 |
| 168 | 3300013105 | Ga0157369_10041055 | Ga0157369_100410552 | 333 |
| 169 | 3300025912 | Ga0207707_10000279 | Ga0207707_1000027937 | 333 |
| 170 | 3300025912 | Ga0207707_10069195 | Ga0207707_100691952 | 333 |
| 171 | 3300025913 | Ga0207695_10009197 | Ga0207695_100091977 | 333 |
| 172 | 3300025913 | Ga0207695_10029270 | Ga0207695_100292702 | 333 |
| 173 | 3300025917 | Ga0207660_10002539 | Ga0207660_100025397 | 333 |
| 174 | 3300025949 | Ga0207667_10016557 | Ga0207667_100165578 | 333 |
| 175 | 3300026078 | Ga0207702_10189623 | Ga0207702_101896232 | 333 |
| 176 | 3300028794 | Ga0307515_10001344 | Ga0307515_1000134451 | 333 |
| 177 | 3300031456 | Ga0307513_10029073 | Ga0307513_100290732 | 333 |
| 178 | 3300005458 | Ga0070681_10052643 | Ga0070681_100526435 | 336 |
| 179 | 3300009551 | Ga0105238_10495822 | Ga0105238_104958221 | 336 |
| 180 | 3300025912 | Ga0207707_10216214 | Ga0207707_102162142 | 336 |
| 181 | 3300025924 | Ga0207694_10381647 | Ga0207694_103816471 | 336 |
| 182 | 3300005335 | Ga0070666_10003818 | Ga0070666_100038182 | 338 |
| 183 | 3300005355 | Ga0070671_100216203 | Ga0070671_1002162031 | 338 |
| 184 | 3300005367 | Ga0070667_100017086 | Ga0070667_1000170863 | 338 |
| 185 | 3300005617 | Ga0068859_100040948 | Ga0068859_1000409483 | 338 |
| 186 | 3300005618 | Ga0068864_100031276 | Ga0068864_1000312762 | 338 |
| 187 | 3300005841 | Ga0068863_100002615 | Ga0068863_1000026154 | 338 |
| 188 | 3300005842 | Ga0068858_100007361 | Ga0068858_10000736110 | 338 |
| 189 | 3300005843 | Ga0068860_100003601 | Ga0068860_1000036012 | 338 |
| 190 | 3300006237 | Ga0097621_100064906 | Ga0097621_1000649062 | 338 |
| 191 | 3300006358 | Ga0068871_100009478 | Ga0068871_1000094784 | 338 |
| 192 | 3300006931 | Ga0097620_100040947 | Ga0097620_1000409473 | 338 |
| 193 | 3300009098 | Ga0105245_10040468 | Ga0105245_100404682 | 338 |
| 194 | 3300009177 | Ga0105248_10085322 | Ga0105248_100853222 | 338 |
| 195 | 3300013296 | Ga0157374_10006280 | Ga0157374_100062802 | 338 |
| 196 | 3300013297 | Ga0157378_10019344 | Ga0157378_100193445 | 338 |
| 197 | 3300013306 | Ga0163162_10001907 | Ga0163162_100019073 | 338 |
| 198 | 3300014968 | Ga0157379_10000187 | Ga0157379_1000018721 | 338 |
| 199 | 3300026035 | Ga0207703_10002540 | Ga0207703_100025405 | 338 |
| 200 | 3300026095 | Ga0207676_10078273 | Ga0207676_100782732 | 338 |
| 201 | 3300028379 | Ga0268266_10207130 | Ga0268266_102071302 | 338 |
| 202 | 3300048907 | Ga0496104_0000548 | Ga0496104_0000548_1409_2608 | 338 |
| 203 | 3300048911 | Ga0496108_0036053 | Ga0496108_0036053_2835_4034 | 338 |
| 204 | 3300048912 | Ga0496109_0041796 | Ga0496109_0041796_2783_3982 | 338 |
| 205 | 3300048913 | Ga0496110_0035030 | Ga0496110_0035030_375_1574 | 338 |
| 206 | 3300007788 | Ga0099795_10000011 | Ga0099795_1000001111 | 341 |
| 207 | 3300010159 | Ga0099796_10000024 | Ga0099796_1000002425 | 341 |
| 208 | 3300027512 | Ga0209179_1000033 | Ga0209179_100003311 | 341 |
| 209 | 3300003323 | rootH1_10027073 | rootH1_100270731 | 343 |
| 210 | 3300005548 | Ga0070665_100003700 | Ga0070665_1000037003 | 343 |
| 211 | 3300028380 | Ga0268265_10267134 | Ga0268265_102671342 | 343 |
| 212 | 3300053096 | Ga0500641_0025866 | Ga0500641_0025866_380_1417 | 343 |
| 213 | 3300053153 | Ga0500616_0008038 | Ga0500616_0008038_3858_4895 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4itm-assembly1.cif.gz_A | "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" | 0.8112 | 20 | 334 |
| 4itm-assembly1.cif.gz_A | "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" | 0.7926 | 20 | 334 |
| 2ch2-assembly2.cif.gz_C | structure of the anopheles gambiae 3-hydroxykynurenine transaminase in complex with inhibitor | 0.6586 | 236 | 294 |
| 8oru-assembly1.cif.gz_BBB | cyclic 2,3-diphosphoglycerate synthetase from the hyperthermophilic archaeon methanothermus fervidus bound to 2,3-diphosphoglycerate and adp. | 0.6523 | 42 | 339 |
| 4e03-assembly3.cif.gz_A | structure of parf-adp form 2 | 0.6506 | 52 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P27300_12_322_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9339 | 18 | 330 | 3.40.50.300 |
| af_P27300_12_322_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9194 | 18 | 330 | 3.40.50.300 |
| af_I1KYA1_28_391_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8686 | 18 | 334 | 3.40.50.300 |
| af_A0A1D6KF80_27_384_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8318 | 18 | 333 | 3.40.50.300 |
| af_I1KYA1_28_391_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8032 | 18 | 334 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382QB50-F1-model_v4 | tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) | 0.9636 | 18 | 184 |
GO:0005524
GO:0005886 GO:0009029 GO:0009244 GO:0009245 |
| AF-A0A3N9V4C7-F1-model_v4 | Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) | 0.9607 | 3 | 329 |
GO:0005524
GO:0005886 GO:0009029 GO:0009244 GO:0009245 |
| AF-A0A7C8DTK6-F1-model_v4 | Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) | 0.9592 | 18 | 171 |
GO:0005524
GO:0005886 GO:0009029 GO:0009244 GO:0009245 |
| AF-A0P7P9-F1-model_v4 | Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) | 0.9588 | 1 | 335 |
GO:0005524
GO:0005886 GO:0009029 GO:0009244 GO:0009245 |
| AF-A0A7V5R0F8-F1-model_v4 | Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) | 0.9576 | 5 | 334 |
GO:0005524
GO:0005886 GO:0009029 GO:0009244 GO:0009245 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar