F323959

General Info

Members Datasets Scaffolds Average Seq Length
213 162 209 346

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10000011|Ga0099795_1000001111
Length 400
Sequence MSLEAWLQRIWYGGRTAPWWLRALSPVFGLIVRARRALYARGWCRTVRLAVPVIVVGNINVGGTGKTPLVIWLAGRLAALGLPVAVVSRGYGRRGRRDVVRLLAGSSADEVGDEPLVIARRAQCPVYVGSDRVRAAQAAIAGGAAVVIADDGLQHLRLARDAEVALADTQRGFGNGALLPAGPLRELPTRLDTVSALVWSVESFGPAAGERWEQLERPGFRMLLAGSELRAVGASGRSCELASLAGERVHAVAGIGNPRRLFAALRAAGLQPIEHPFPDHHRYRAADLQFADHLPVIMTEKDAVKCQSFAPANGWYLPVTAHFAPADESALLGRILMDARLLDILVCPVCKGPLRMASEAAGKLLVCRADRLAYPIRDGIPVMLEEEARLLETTDPLLER

Samples

Sample ID Description Type Environment
1 2842733646 Variovorax sp. R-72446 Isolate Unclassified
2 2842747753 Variovorax sp. R-72060 Isolate Unclassified
3 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
4 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
155 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 0
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.27
Nodule 0
Rhizoplane 1.88
Rhizosphere 78.4
Stem 0
Stem Tuber 0
Unclassified 8.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10027073 3300003323 Bacteria 1301
2 Ga0055529_1001134 3300003763 Bacteria 11334
3 Ga0070658_10001308 3300005327 Bacteria 21276
4 Ga0070676_10003770 3300005328 Bacteria 7946
5 Ga0070676_10152179 3300005328 Bacteria 1482
6 Ga0070683_100041605 3300005329 Bacteria 4228
7 Ga0070666_10000005 3300005335 Bacteria 343092
8 Ga0070666_10003818 3300005335 Bacteria 9142
9 Ga0070666_10015077 3300005335 Bacteria 4926
10 Ga0070680_100016666 3300005336 Bacteria 5786
11 Ga0070680_100066633 3300005336 Bacteria 2953
12 Ga0070680_100348428 3300005336 Bacteria 1259
13 Ga0070668_100021201 3300005347 Bacteria 4912
14 Ga0070675_100025239 3300005354 Bacteria 4764
15 Ga0070671_100015116 3300005355 Bacteria 6234
16 Ga0070671_100216203 3300005355 Bacteria 1626
17 Ga0070667_100000225 3300005367 Bacteria 65088
18 Ga0070667_100017086 3300005367 Bacteria 6010
19 Ga0070667_100314103 3300005367 Bacteria 1413
20 Ga0070713_100023726 3300005436 Bacteria 4767
21 Ga0070700_100007840 3300005441 Bacteria 5790
22 Ga0070678_100090992 3300005456 Bacteria 2340
23 Ga0070678_100136107 3300005456 Bacteria 1959
24 Ga0070662_100024974 3300005457 Bacteria 4123
25 Ga0070681_10002603 3300005458 Bacteria 16557
26 Ga0070681_10006270 3300005458 Bacteria 11566
27 Ga0070681_10052643 3300005458 Bacteria 4061
28 Ga0068867_100011231 3300005459 Bacteria 6317
29 Ga0068867_100162253 3300005459 Bacteria 1763
30 Ga0068867_100325344 3300005459 Bacteria 1275
31 Ga0070679_100019979 3300005530 Bacteria 6525
32 Ga0070679_100077227 3300005530 Bacteria 3319
33 Ga0070679_100102733 3300005530 Bacteria 2845
34 Ga0068853_100119057 3300005539 Bacteria 2353
35 Ga0070672_100013464 3300005543 Bacteria 5778
36 Ga0070665_100003700 3300005548 Bacteria 16196
37 Ga0070665_100273590 3300005548 Bacteria 1691
38 Ga0068855_100001761 3300005563 Bacteria 27049
39 Ga0068857_100025225 3300005577 Bacteria 5235
40 Ga0068856_100095125 3300005614 Bacteria 2967
41 Ga0068859_100040948 3300005617 Bacteria 4654
42 Ga0068864_100031276 3300005618 Bacteria 4516
43 Ga0068861_100006662 3300005719 Bacteria 7887
44 Ga0068863_100002615 3300005841 Bacteria 17844
45 Ga0068858_100007361 3300005842 Bacteria 10652
46 Ga0068860_100003601 3300005843 Bacteria 15912
47 Ga0068860_100047552 3300005843 Bacteria 4089
48 Ga0068862_100060242 3300005844 Bacteria 3260
49 Ga0075365_10001639 3300006038 Bacteria 10321
50 Ga0075368_10015544 3300006042 Bacteria 2826
51 Ga0075363_100014716 3300006048 Bacteria 3831
52 Ga0075364_10027578 3300006051 Eukaryota 3629
53 Ga0070715_10021714 3300006163 Bacteria 2493
54 Ga0070716_100013841 3300006173 Bacteria 4121
55 Ga0070716_100062014 3300006173 Bacteria 2166
56 Ga0075367_10020818 3300006178 Bacteria 3658
57 Ga0075367_10052314 3300006178 Bacteria 2417
58 Ga0075369_10000016 3300006186 Bacteria 52351
59 Ga0097621_100064906 3300006237 Bacteria 3003
60 Ga0075370_10000902 3300006353 Bacteria 12172
61 Ga0068871_100009478 3300006358 Bacteria 7058
62 Ga0068871_100014932 3300006358 Bacteria 5806
63 Ga0075428_100039878 3300006844 Bacteria 5168
64 Ga0075430_100007295 3300006846 Bacteria 9335
65 Ga0075430_100103956 3300006846 Bacteria 2371
66 Ga0068865_100039001 3300006881 Bacteria 3219
67 Ga0097620_100040947 3300006931 Bacteria 4654
68 Ga0099795_10000011 3300007788 Bacteria 78558
69 Ga0105250_10079885 3300009092 Bacteria 1325
70 Ga0105240_10010501 3300009093 Bacteria 13015
71 Ga0105240_10011424 3300009093 Bacteria 12368
72 Ga0111539_10032739 3300009094 Bacteria 6313
73 Ga0105245_10040468 3300009098 Bacteria 4153
74 Ga0105247_10042572 3300009101 Bacteria 2782
75 Ga0105248_10085322 3300009177 Bacteria 3553
76 Ga0105237_10212870 3300009545 Bacteria 1932
77 Ga0105238_10003211 3300009551 Bacteria 16322
78 Ga0105238_10495822 3300009551 Unclassified 1222
79 Ga0105249_10059854 3300009553 Bacteria 3494
80 Ga0099796_10000024 3300010159 Bacteria 38665
81 Ga0105239_10206728 3300010375 Bacteria 2200
82 Ga0157370_10003246 3300013104 Bacteria 19167
83 Ga0157370_10171006 3300013104 Bacteria 2020
84 Ga0157369_10002299 3300013105 Bacteria 22992
85 Ga0157369_10041055 3300013105 Bacteria 5050
86 Ga0157374_10006280 3300013296 Bacteria 10075
87 Ga0157378_10019344 3300013297 Bacteria 5988
88 Ga0163162_10000294 3300013306 Bacteria 45823
89 Ga0163162_10001907 3300013306 Bacteria 19653
90 Ga0163163_10037590 3300014325 Bacteria 4711
91 Ga0157380_10045893 3300014326 Bacteria 3431
92 Ga0157380_10070753 3300014326 Bacteria 2820
93 Ga0157379_10000187 3300014968 Bacteria 47593
94 Ga0182005_1020226 3300015265 Bacteria 1833
95 Ga0209455_1001352 3300025272 Bacteria 11264
96 Ga0209676_1032620 3300025292 Bacteria 1564
97 Ga0207680_10000005 3300025903 Bacteria 660983
98 Ga0207680_10003207 3300025903 Bacteria 7693
99 Ga0207645_10001254 3300025907 Bacteria 20898
100 Ga0207705_10001674 3300025909 Bacteria 17644
101 Ga0207707_10000279 3300025912 Bacteria 54572
102 Ga0207707_10011614 3300025912 Bacteria 7666
103 Ga0207707_10069195 3300025912 Bacteria 3076
104 Ga0207707_10151829 3300025912 Bacteria 2025
105 Ga0207707_10216214 3300025912 Bacteria 1669
106 Ga0207695_10009197 3300025913 Bacteria 12252
107 Ga0207695_10029270 3300025913 Bacteria 6091
108 Ga0207660_10002539 3300025917 Bacteria 11980
109 Ga0207660_10262069 3300025917 Bacteria 1367
110 Ga0207681_10011101 3300025923 Bacteria 5531
111 Ga0207681_10058912 3300025923 Bacteria 2631
112 Ga0207681_10060492 3300025923 Bacteria 2600
113 Ga0207694_10000332 3300025924 Bacteria 44554
114 Ga0207694_10381647 3300025924 Unclassified 1170
115 Ga0207659_10072597 3300025926 Bacteria 2517
116 Ga0207700_10108909 3300025928 Bacteria 2225
117 Ga0207706_10000228 3300025933 Bacteria 61381
118 Ga0207704_10017425 3300025938 Bacteria 3723
119 Ga0207691_10007519 3300025940 Bacteria 10485
120 Ga0207691_10141186 3300025940 Bacteria 2123
121 Ga0207661_10437813 3300025944 Bacteria 1189
122 Ga0207667_10016557 3300025949 Bacteria 8326
123 Ga0207668_10038646 3300025972 Bacteria 3206
124 Ga0207703_10002540 3300026035 Bacteria 15767
125 Ga0207639_10033887 3300026041 Bacteria 3770
126 Ga0207708_10010373 3300026075 Bacteria 6916
127 Ga0207708_10024603 3300026075 Bacteria 4554
128 Ga0207702_10189623 3300026078 Bacteria 1899
129 Ga0207648_10010393 3300026089 Bacteria 8823
130 Ga0207648_10014774 3300026089 Bacteria 7203
131 Ga0207648_10100897 3300026089 Bacteria 2529
132 Ga0207676_10078273 3300026095 Bacteria 2678
133 Ga0207675_100001467 3300026118 Bacteria 23651
134 Ga0207675_100060827 3300026118 Bacteria 3526
135 Ga0209179_1000033 3300027512 Bacteria 33935
136 Ga0209971_1006543 3300027682 Bacteria 2756
137 Ga0209813_10034733 3300027866 Bacteria 1506
138 Ga0209974_10002897 3300027876 Bacteria 6225
139 Ga0268266_10000004 3300028379 Bacteria 1495817
140 Ga0268266_10207130 3300028379 Bacteria 1797
141 Ga0268265_10048023 3300028380 Bacteria 3202
142 Ga0268265_10203753 3300028380 Bacteria 1718
143 Ga0268265_10267134 3300028380 Bacteria 1524
144 Ga0268264_10038178 3300028381 Bacteria 3962
145 Ga0307515_10001344 3300028794 Bacteria 55675
146 Ga0307511_10002306 3300030521 Bacteria 19914
147 Ga0307511_10041820 3300030521 Bacteria 3862
148 Ga0265340_10062514 3300031247 Bacteria 1778
149 Ga0307513_10029073 3300031456 Bacteria 6308
150 Ga0307509_10000013 3300031507 Bacteria 283027
151 Ga0307516_10000991 3300031730 Bacteria 39211
152 Ga0307410_10003267 3300031852 Bacteria 8092
153 Ga0307414_10057732 3300032004 Unclassified 2730
154 Ga0307510_10003555 3300033180 Bacteria 18190
155 Ga0316574_0005141 3300035398 Bacteria 6956
156 Ga0436360_0567246 3300039438 Bacteria 4094
157 Ga0439435_0005016 3300042436 Bacteria 2887
158 Ga0495592_0000346 3300046454 Bacteria 37799
159 Ga0495650_0001070 3300046471 Bacteria 30292
160 Ga0496104_0000548 3300048907 Bacteria 32116
161 Ga0496108_0036053 3300048911 Bacteria 4113
162 Ga0496109_0041796 3300048912 Bacteria 4152
163 Ga0496110_0035030 3300048913 Bacteria 4352
164 Ga0496117_0028486 3300048920 Bacteria 4324
165 Ga0496121_0119494 3300048924 Bacteria 1993
166 Ga0496122_0002359 3300048925 Bacteria 27157
167 Ga0496123_0000108 3300048926 Bacteria 166102
168 Ga0496124_0198995 3300048927 Bacteria 1525
169 Ga0496125_0047676 3300048928 Bacteria 3580
170 Ga0496125_0108137 3300048928 Bacteria 2024
171 Ga0496126_0038936 3300048929 Bacteria 4418
172 Ga0501036_0217351 3300049572 Bacteria 1605
173 Ga0501041_0146355 3300049577 Bacteria 1474
174 Ga0501067_0007527 3300049583 Bacteria 6052
175 Ga0501068_0002265 3300049584 Bacteria 10250
176 Ga0501069_0015593 3300049585 Bacteria 4074
177 Ga0501070_0009589 3300049586 Bacteria 8178
178 Ga0501070_0224345 3300049586 Bacteria 1540
179 Ga0501071_0003341 3300049587 Bacteria 10027
180 Ga0501071_0050433 3300049587 Bacteria 2998
181 Ga0501073_0000314 3300049589 Bacteria 32139
182 Ga0501074_0007153 3300049590 Bacteria 8061
183 Ga0501076_0039539 3300049592 Bacteria 3703
184 Ga0501077_0005391 3300049593 Bacteria 7774
185 Ga0501079_0004649 3300049741 Bacteria 10169
186 Ga0501080_0001135 3300049742 Bacteria 21930
187 Ga0501081_0073019 3300049743 Bacteria 2393
188 Ga0501035_0050977 3300049822 Bacteria 3707
189 Ga0501044_0000062 3300049823 Bacteria 131395
190 Ga0501045_0005784 3300049824 Bacteria 8555
191 nmdc:mga03n38_32749_c1 3300050490 Bacteria 2205
192 nmdc:mga0yw44_52680_c1 3300050492 Eukaryota 2468
193 nmdc:mga07m45_115_c1 3300050496 Bacteria 32090
194 nmdc:mga07m45_20413_c1 3300050496 Bacteria 3598
195 nmdc:mga05p37_378053_c1 3300050507 Bacteria 1660
196 nmdc:mga09592_7835_c1 3300050508 Bacteria 8682
197 nmdc:mga0qj67_3433_c1 3300050509 Bacteria 11419
198 nmdc:mga06r32_320024_c1 3300050510 Bacteria 1537
199 nmdc:mga08y16_187859_c1 3300050511 Bacteria 2144
200 nmdc:mga0sz30_22_c3 3300050516 Bacteria 64467
201 Ga0500644_0026309 3300053088 Bacteria 1799
202 Ga0500646_0020901 3300053090 Bacteria 1741
203 Ga0500641_0025866 3300053096 Bacteria 2274
204 Ga0500559_0001129 3300053136 Bacteria 16078
205 Ga0500559_0008319 3300053136 Bacteria 4557
206 Ga0500616_0008038 3300053153 Bacteria 6607
207 Ga0500637_0011052 3300053178 Bacteria 4648
208 Ga0501082_0080455 3300060353 Bacteria 2812
209 Ga0530510_0072160 3300061734 Bacteria 2506

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2842747753 2842751506 285
2 iso_pu_bacteria 2842733646 2842734839 301
3 3300005539 Ga0068853_100119057 Ga0068853_1001190572 302
4 3300026041 Ga0207639_10033887 Ga0207639_100338873 302
5 3300048920 Ga0496117_0028486 Ga0496117_0028486_502_1539 302
6 3300005548 Ga0070665_100273590 Ga0070665_1002735903 303
7 3300005577 Ga0068857_100025225 Ga0068857_1000252255 303
8 3300006178 Ga0075367_10052314 Ga0075367_100523143 303
9 3300025923 Ga0207681_10060492 Ga0207681_100604924 303
10 3300048925 Ga0496122_0002359 Ga0496122_0002359_19790_20770 303
11 3300048926 Ga0496123_0000108 Ga0496123_0000108_38981_39961 303
12 3300048927 Ga0496124_0198995 Ga0496124_0198995_528_1508 303
13 3300050496 nmdc:mga07m45_20413_c1 nmdc:mga07m45_20413_c1_1130_2110 303
14 3300053136 Ga0500559_0001129 Ga0500559_0001129_6261_7241 303
15 3300053136 Ga0500559_0008319 Ga0500559_0008319_1135_2115 303
16 3300025292 Ga0209676_1032620 Ga0209676_10326201 308
17 3300006038 Ga0075365_10001639 Ga0075365_100016393 310
18 3300006042 Ga0075368_10015544 Ga0075368_100155443 310
19 3300006048 Ga0075363_100014716 Ga0075363_1000147164 310
20 3300006051 Ga0075364_10027578 Ga0075364_100275785 310
21 3300006173 Ga0070716_100062014 Ga0070716_1000620142 310
22 3300006178 Ga0075367_10020818 Ga0075367_100208185 310
23 3300006186 Ga0075369_10000016 Ga0075369_1000001625 310
24 3300006353 Ga0075370_10000902 Ga0075370_100009029 310
25 3300027866 Ga0209813_10034733 Ga0209813_100347332 310
26 3300050490 nmdc:mga03n38_32749_c1 nmdc:mga03n38_32749_c1_225_1217 310
27 3300050492 nmdc:mga0yw44_52680_c1 nmdc:mga0yw44_52680_c1_1169_2161 310
28 3300050496 nmdc:mga07m45_115_c1 nmdc:mga07m45_115_c1_22673_23665 310
29 3300050508 nmdc:mga09592_7835_c1 nmdc:mga09592_7835_c1_5595_6587 310
30 3300050516 nmdc:mga0sz30_22_c3 nmdc:mga0sz30_22_c3_22233_23225 310
31 3300053088 Ga0500644_0026309 Ga0500644_0026309_365_1378 312
32 3300005327 Ga0070658_10001308 Ga0070658_1000130812 313
33 3300009551 Ga0105238_10003211 Ga0105238_100032119 313
34 3300025909 Ga0207705_10001674 Ga0207705_100016747 313
35 3300025924 Ga0207694_10000332 Ga0207694_1000033215 313
36 3300028379 Ga0268266_10000004 Ga0268266_10000004972 313
37 3300003763 Ga0055529_1001134 Ga0055529_100113413 314
38 3300005367 Ga0070667_100000225 Ga0070667_10000022547 314
39 3300014326 Ga0157380_10045893 Ga0157380_100458934 314
40 3300025272 Ga0209455_1001352 Ga0209455_10013527 314
41 3300025903 Ga0207680_10003207 Ga0207680_100032077 314
42 3300048928 Ga0496125_0047676 Ga0496125_0047676_1789_2808 314
43 3300033180 Ga0307510_10003555 Ga0307510_100035556 315
44 3300053090 Ga0500646_0020901 Ga0500646_0020901_566_1531 315
45 3300005335 Ga0070666_10000005 Ga0070666_10000005201 316
46 3300005367 Ga0070667_100314103 Ga0070667_1003141031 316
47 3300005456 Ga0070678_100136107 Ga0070678_1001361072 316
48 3300005843 Ga0068860_100047552 Ga0068860_1000475522 316
49 3300013306 Ga0163162_10000294 Ga0163162_1000029419 316
50 3300015265 Ga0182005_1020226 Ga0182005_10202262 316
51 3300025903 Ga0207680_10000005 Ga0207680_10000005559 316
52 3300028381 Ga0268264_10038178 Ga0268264_100381782 316
53 3300046471 Ga0495650_0001070 Ga0495650_0001070_17610_18584 316
54 3300048924 Ga0496121_0119494 Ga0496121_0119494_394_1368 316
55 3300048928 Ga0496125_0108137 Ga0496125_0108137_402_1376 316
56 3300048929 Ga0496126_0038936 Ga0496126_0038936_2731_3705 316
57 3300049823 Ga0501044_0000062 Ga0501044_0000062_93261_94346 317
58 3300006358 Ga0068871_100014932 Ga0068871_1000149327 318
59 3300009545 Ga0105237_10212870 Ga0105237_102128702 318
60 3300031730 Ga0307516_10000991 Ga0307516_100009914 318
61 3300046454 Ga0495592_0000346 Ga0495592_0000346_4964_6022 318
62 3300005335 Ga0070666_10015077 Ga0070666_100150777 319
63 3300009092 Ga0105250_10079885 Ga0105250_100798853 319
64 3300009101 Ga0105247_10042572 Ga0105247_100425722 319
65 3300035398 Ga0316574_0005141 Ga0316574_0005141_3944_4939 320
66 3300030521 Ga0307511_10041820 Ga0307511_100418202 321
67 3300049586 Ga0501070_0224345 Ga0501070_0224345_323_1333 322
68 3300005328 Ga0070676_10003770 Ga0070676_100037706 323
69 3300005329 Ga0070683_100041605 Ga0070683_1000416054 323
70 3300005336 Ga0070680_100066633 Ga0070680_1000666332 323
71 3300005355 Ga0070671_100015116 Ga0070671_1000151164 323
72 3300005459 Ga0068867_100011231 Ga0068867_1000112316 323
73 3300005530 Ga0070679_100102733 Ga0070679_1001027334 323
74 3300025912 Ga0207707_10151829 Ga0207707_101518293 323
75 3300025917 Ga0207660_10262069 Ga0207660_102620692 323
76 3300026089 Ga0207648_10010393 Ga0207648_100103938 323
77 3300039438 Ga0436360_0567246 Ga0436360_0567246_2071_3096 324
78 3300049583 Ga0501067_0007527 Ga0501067_0007527_1967_2968 324
79 3300049584 Ga0501068_0002265 Ga0501068_0002265_1892_2893 324
80 3300049585 Ga0501069_0015593 Ga0501069_0015593_1659_2660 324
81 3300049586 Ga0501070_0009589 Ga0501070_0009589_5250_6251 324
82 3300049587 Ga0501071_0003341 Ga0501071_0003341_6968_7969 324
83 3300049589 Ga0501073_0000314 Ga0501073_0000314_28858_29859 324
84 3300049590 Ga0501074_0007153 Ga0501074_0007153_5174_6175 324
85 3300049592 Ga0501076_0039539 Ga0501076_0039539_2058_3059 324
86 3300049593 Ga0501077_0005391 Ga0501077_0005391_1516_2517 324
87 3300049741 Ga0501079_0004649 Ga0501079_0004649_1966_2967 324
88 3300049742 Ga0501080_0001135 Ga0501080_0001135_1953_2954 324
89 3300049743 Ga0501081_0073019 Ga0501081_0073019_127_1128 324
90 3300049822 Ga0501035_0050977 Ga0501035_0050977_1083_2171 324
91 3300061734 Ga0530510_0072160 Ga0530510_0072160_18_1019 324
92 3300031247 Ga0265340_10062514 Ga0265340_100625142 326
93 3300005336 Ga0070680_100348428 Ga0070680_1003484281 327
94 3300005458 Ga0070681_10002603 Ga0070681_100026039 327
95 3300005530 Ga0070679_100077227 Ga0070679_1000772273 327
96 3300025912 Ga0207707_10011614 Ga0207707_100116147 327
97 3300005347 Ga0070668_100021201 Ga0070668_1000212013 328
98 3300005457 Ga0070662_100024974 Ga0070662_1000249743 328
99 3300005459 Ga0068867_100162253 Ga0068867_1001622532 328
100 3300005543 Ga0070672_100013464 Ga0070672_1000134643 328
101 3300005719 Ga0068861_100006662 Ga0068861_1000066621 328
102 3300006846 Ga0075430_100007295 Ga0075430_1000072953 328
103 3300006881 Ga0068865_100039001 Ga0068865_1000390012 328
104 3300009094 Ga0111539_10032739 Ga0111539_100327395 328
105 3300009553 Ga0105249_10059854 Ga0105249_100598543 328
106 3300014326 Ga0157380_10070753 Ga0157380_100707533 328
107 3300025907 Ga0207645_10001254 Ga0207645_1000125410 328
108 3300025923 Ga0207681_10011101 Ga0207681_100111014 328
109 3300025933 Ga0207706_10000228 Ga0207706_1000022828 328
110 3300025938 Ga0207704_10017425 Ga0207704_100174253 328
111 3300025940 Ga0207691_10007519 Ga0207691_100075197 328
112 3300025972 Ga0207668_10038646 Ga0207668_100386464 328
113 3300026075 Ga0207708_10024603 Ga0207708_100246033 328
114 3300026089 Ga0207648_10014774 Ga0207648_100147743 328
115 3300026118 Ga0207675_100001467 Ga0207675_10000146714 328
116 3300027682 Ga0209971_1006543 Ga0209971_10065432 328
117 3300027876 Ga0209974_10002897 Ga0209974_100028973 328
118 3300028380 Ga0268265_10203753 Ga0268265_102037533 328
119 3300032004 Ga0307414_10057732 Ga0307414_100577324 328
120 3300050507 nmdc:mga05p37_378053_c1 nmdc:mga05p37_378053_c1_50_1096 328
121 3300050509 nmdc:mga0qj67_3433_c1 nmdc:mga0qj67_3433_c1_4935_5981 328
122 3300050511 nmdc:mga08y16_187859_c1 nmdc:mga08y16_187859_c1_1073_2119 328
123 iso_pu_bacteria 2881927736 2881928088 328
124 3300005456 Ga0070678_100090992 Ga0070678_1000909923 329
125 3300006844 Ga0075428_100039878 Ga0075428_1000398783 329
126 3300006846 Ga0075430_100103956 Ga0075430_1001039562 329
127 3300042436 Ga0439435_0005016 Ga0439435_0005016_1623_2669 329
128 3300050510 nmdc:mga06r32_320024_c1 nmdc:mga06r32_320024_c1_61_1107 329
129 iso_pu_bacteria 2895511927 2895518510 329
130 3300006163 Ga0070715_10021714 Ga0070715_100217143 330
131 3300006173 Ga0070716_100013841 Ga0070716_1000138412 330
132 3300025928 Ga0207700_10108909 Ga0207700_101089092 330
133 3300049572 Ga0501036_0217351 Ga0501036_0217351_49_1098 330
134 3300049577 Ga0501041_0146355 Ga0501041_0146355_335_1384 330
135 3300049587 Ga0501071_0050433 Ga0501071_0050433_352_1401 330
136 3300049824 Ga0501045_0005784 Ga0501045_0005784_2116_3165 330
137 3300060353 Ga0501082_0080455 Ga0501082_0080455_1212_2261 330
138 3300005328 Ga0070676_10152179 Ga0070676_101521792 331
139 3300005354 Ga0070675_100025239 Ga0070675_1000252395 331
140 3300005436 Ga0070713_100023726 Ga0070713_1000237262 331
141 3300005441 Ga0070700_100007840 Ga0070700_1000078405 331
142 3300005459 Ga0068867_100325344 Ga0068867_1003253442 331
143 3300005844 Ga0068862_100060242 Ga0068862_1000602424 331
144 3300014325 Ga0163163_10037590 Ga0163163_100375902 331
145 3300025923 Ga0207681_10058912 Ga0207681_100589122 331
146 3300025926 Ga0207659_10072597 Ga0207659_100725972 331
147 3300025940 Ga0207691_10141186 Ga0207691_101411863 331
148 3300025944 Ga0207661_10437813 Ga0207661_104378131 331
149 3300026075 Ga0207708_10010373 Ga0207708_100103734 331
150 3300026089 Ga0207648_10100897 Ga0207648_101008972 331
151 3300026118 Ga0207675_100060827 Ga0207675_1000608274 331
152 3300028380 Ga0268265_10048023 Ga0268265_100480232 331
153 3300031507 Ga0307509_10000013 Ga0307509_10000013141 331
154 3300031852 Ga0307410_10003267 Ga0307410_100032677 331
155 3300030521 Ga0307511_10002306 Ga0307511_1000230614 332
156 3300053178 Ga0500637_0011052 Ga0500637_0011052_3382_4398 332
157 3300005336 Ga0070680_100016666 Ga0070680_1000166663 333
158 3300005458 Ga0070681_10006270 Ga0070681_100062707 333
159 3300005530 Ga0070679_100019979 Ga0070679_1000199793 333
160 3300005563 Ga0068855_100001761 Ga0068855_1000017617 333
161 3300005614 Ga0068856_100095125 Ga0068856_1000951254 333
162 3300009093 Ga0105240_10010501 Ga0105240_100105018 333
163 3300009093 Ga0105240_10011424 Ga0105240_100114247 333
164 3300010375 Ga0105239_10206728 Ga0105239_102067282 333
165 3300013104 Ga0157370_10003246 Ga0157370_1000324612 333
166 3300013104 Ga0157370_10171006 Ga0157370_101710063 333
167 3300013105 Ga0157369_10002299 Ga0157369_100022997 333
168 3300013105 Ga0157369_10041055 Ga0157369_100410552 333
169 3300025912 Ga0207707_10000279 Ga0207707_1000027937 333
170 3300025912 Ga0207707_10069195 Ga0207707_100691952 333
171 3300025913 Ga0207695_10009197 Ga0207695_100091977 333
172 3300025913 Ga0207695_10029270 Ga0207695_100292702 333
173 3300025917 Ga0207660_10002539 Ga0207660_100025397 333
174 3300025949 Ga0207667_10016557 Ga0207667_100165578 333
175 3300026078 Ga0207702_10189623 Ga0207702_101896232 333
176 3300028794 Ga0307515_10001344 Ga0307515_1000134451 333
177 3300031456 Ga0307513_10029073 Ga0307513_100290732 333
178 3300005458 Ga0070681_10052643 Ga0070681_100526435 336
179 3300009551 Ga0105238_10495822 Ga0105238_104958221 336
180 3300025912 Ga0207707_10216214 Ga0207707_102162142 336
181 3300025924 Ga0207694_10381647 Ga0207694_103816471 336
182 3300005335 Ga0070666_10003818 Ga0070666_100038182 338
183 3300005355 Ga0070671_100216203 Ga0070671_1002162031 338
184 3300005367 Ga0070667_100017086 Ga0070667_1000170863 338
185 3300005617 Ga0068859_100040948 Ga0068859_1000409483 338
186 3300005618 Ga0068864_100031276 Ga0068864_1000312762 338
187 3300005841 Ga0068863_100002615 Ga0068863_1000026154 338
188 3300005842 Ga0068858_100007361 Ga0068858_10000736110 338
189 3300005843 Ga0068860_100003601 Ga0068860_1000036012 338
190 3300006237 Ga0097621_100064906 Ga0097621_1000649062 338
191 3300006358 Ga0068871_100009478 Ga0068871_1000094784 338
192 3300006931 Ga0097620_100040947 Ga0097620_1000409473 338
193 3300009098 Ga0105245_10040468 Ga0105245_100404682 338
194 3300009177 Ga0105248_10085322 Ga0105248_100853222 338
195 3300013296 Ga0157374_10006280 Ga0157374_100062802 338
196 3300013297 Ga0157378_10019344 Ga0157378_100193445 338
197 3300013306 Ga0163162_10001907 Ga0163162_100019073 338
198 3300014968 Ga0157379_10000187 Ga0157379_1000018721 338
199 3300026035 Ga0207703_10002540 Ga0207703_100025405 338
200 3300026095 Ga0207676_10078273 Ga0207676_100782732 338
201 3300028379 Ga0268266_10207130 Ga0268266_102071302 338
202 3300048907 Ga0496104_0000548 Ga0496104_0000548_1409_2608 338
203 3300048911 Ga0496108_0036053 Ga0496108_0036053_2835_4034 338
204 3300048912 Ga0496109_0041796 Ga0496109_0041796_2783_3982 338
205 3300048913 Ga0496110_0035030 Ga0496110_0035030_375_1574 338
206 3300007788 Ga0099795_10000011 Ga0099795_1000001111 341
207 3300010159 Ga0099796_10000024 Ga0099796_1000002425 341
208 3300027512 Ga0209179_1000033 Ga0209179_100003311 341
209 3300003323 rootH1_10027073 rootH1_100270731 343
210 3300005548 Ga0070665_100003700 Ga0070665_1000037003 343
211 3300028380 Ga0268265_10267134 Ga0268265_102671342 343
212 3300053096 Ga0500641_0025866 Ga0500641_0025866_380_1417 343
213 3300053153 Ga0500616_0008038 Ga0500616_0008038_3858_4895 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02606

LpxK

Tetraacyldisaccharide-1-P 4'-kinase

17

336

0.93

PF03966

Trm112p

Trm112p-like protein

338

379

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.8112 20 334
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.7926 20 334
2ch2-assembly2.cif.gz_C structure of the anopheles gambiae 3-hydroxykynurenine transaminase in complex with inhibitor 0.6586 236 294
8oru-assembly1.cif.gz_BBB cyclic 2,3-diphosphoglycerate synthetase from the hyperthermophilic archaeon methanothermus fervidus bound to 2,3-diphosphoglycerate and adp. 0.6523 42 339
4e03-assembly3.cif.gz_A structure of parf-adp form 2 0.6506 52 167
ID Description Score Start End Superfamily
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9339 18 330 3.40.50.300
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9194 18 330 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8686 18 334 3.40.50.300
af_A0A1D6KF80_27_384_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8318 18 333 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8032 18 334 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382QB50-F1-model_v4 tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.9636 18 184 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A3N9V4C7-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9607 3 329 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A7C8DTK6-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.9592 18 171 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0P7P9-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9588 1 335 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A7V5R0F8-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.9576 5 334 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245

Feature Viewer

pLDDT pTM Quality
90.34 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map