F323707

General Info

Members Datasets Scaffolds Average Seq Length
213 162 426 193

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100666800|Ga0070674_1006668002
Length 207
Sequence LPLVAGQRTVNTTRLEAFSDGVLAIIITIMVLELRVPHGTEWSSLAPLWPKFLSYLLSFVYIGIYWNNHHHMLHVTQQVNGAILWANLHLLFWLSLVPFVTAWMGENHFAAVPTSLYGVVMLAAAIAYLILQRTIIRSQGDQSVLAEAVGNDKKGKISAFSYLVAIPSAFVHPAISGGLYAAVALIWLLPDQRIERVVAAGRGEGTA

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
148 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
159 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
160 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
161 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
162 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 2.82
Rhizosphere 92.96
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100666800 3300005356 Bacteria 886
2 rootH1_10006040 3300003316 Bacteria 22506
3 Ga0065712_10101866 3300005290 Bacteria 2023
4 Ga0065712_10289177 3300005290 Bacteria 876
5 Ga0065707_10082097 3300005295 Bacteria 22143
6 Ga0070658_10138174 3300005327 Bacteria 2034
7 Ga0070683_100011377 3300005329 Bacteria 7690
8 Ga0070683_100115839 3300005329 Bacteria 2530
9 Ga0070683_100308011 3300005329 Bacteria 1507
10 Ga0070670_100072985 3300005331 Bacteria 2948
11 Ga0070670_101139879 3300005331 Bacteria 712
12 Ga0068869_100031690 3300005334 Bacteria 3719
13 Ga0068869_100041370 3300005334 Bacteria 3300
14 Ga0070680_100012915 3300005336 Bacteria 6496
15 Ga0070660_100074780 3300005339 Bacteria 2651
16 Ga0070661_100052677 3300005344 Bacteria 2978
17 Ga0070692_10020904 3300005345 Bacteria 3179
18 Ga0070668_100196874 3300005347 Bacteria 1653
19 Ga0070675_100103115 3300005354 Bacteria 2405
20 Ga0070673_101175910 3300005364 Bacteria 718
21 Ga0070659_100071636 3300005366 Bacteria 2756
22 Ga0070667_100205911 3300005367 Bacteria 1747
23 Ga0070663_100575914 3300005455 Bacteria 944
24 Ga0070678_100079916 3300005456 Bacteria 2475
25 Ga0070662_100000272 3300005457 Bacteria 30514
26 Ga0070662_100205195 3300005457 Bacteria 1566
27 Ga0070681_10052216 3300005458 Bacteria 4077
28 Ga0068867_100008227 3300005459 Bacteria 7366
29 Ga0068867_100022565 3300005459 Bacteria 4500
30 Ga0070685_10360366 3300005466 Bacteria 997
31 Ga0070707_100156407 3300005468 Bacteria 2221
32 Ga0070679_100004564 3300005530 Bacteria 12790
33 Ga0070684_100252574 3300005535 Bacteria 1612
34 Ga0068853_100049397 3300005539 Bacteria 3615
35 Ga0068853_100206925 3300005539 Bacteria 1787
36 Ga0070672_100144523 3300005543 Bacteria 1964
37 Ga0070696_100860294 3300005546 Bacteria 750
38 Ga0070693_100333179 3300005547 Bacteria 1033
39 Ga0068855_100186079 3300005563 Bacteria 2345
40 Ga0070664_100040922 3300005564 Bacteria 3910
41 Ga0070664_100050515 3300005564 Bacteria 3520
42 Ga0070664_100125285 3300005564 Bacteria 2253
43 Ga0070664_100671776 3300005564 Bacteria 964
44 Ga0068857_100043460 3300005577 Bacteria 3986
45 Ga0068854_100031723 3300005578 Bacteria 3673
46 Ga0070702_100080616 3300005615 Bacteria 1948
47 Ga0070702_100167092 3300005615 Bacteria 1428
48 Ga0068852_100704636 3300005616 Bacteria 1020
49 Ga0068859_100299898 3300005617 Unclassified 1700
50 Ga0068866_10027235 3300005718 Bacteria 2708
51 Ga0068861_100488255 3300005719 Bacteria 1111
52 Ga0068861_100607147 3300005719 Bacteria 1005
53 Ga0068863_100815946 3300005841 Bacteria 931
54 Ga0068858_100258593 3300005842 Bacteria 1654
55 Ga0068860_100047040 3300005843 Bacteria 4112
56 Ga0068862_100104930 3300005844 Bacteria 2476
57 Ga0070716_100081876 3300006173 Bacteria 1929
58 Ga0070716_100151537 3300006173 Bacteria 1492
59 Ga0068865_100901183 3300006881 Bacteria 769
60 Ga0075436_100258328 3300006914 Bacteria 1242
61 Ga0097620_100299903 3300006931 Unclassified 1700
62 Ga0105245_10006949 3300009098 Bacteria 9924
63 Ga0105247_10184090 3300009101 Bacteria 1395
64 Ga0114129_10474698 3300009147 Bacteria 1637
65 Ga0105243_10017729 3300009148 Bacteria 5385
66 Ga0105243_10169102 3300009148 Unclassified 1892
67 Ga0105241_10080862 3300009174 Bacteria 2544
68 Ga0105241_10497631 3300009174 Bacteria 1086
69 Ga0105242_10101902 3300009176 Bacteria 2434
70 Ga0105248_10009169 3300009177 Bacteria 10883
71 Ga0105249_10286439 3300009553 Unclassified 1647
72 Ga0105239_10155454 3300010375 Bacteria 2554
73 Ga0105246_10788168 3300011119 Bacteria 842
74 Ga0157371_10080441 3300013102 Bacteria 2308
75 Ga0157371_10142830 3300013102 Bacteria 1705
76 Ga0157370_10025973 3300013104 Bacteria 5789
77 Ga0157369_10002865 3300013105 Bacteria 20599
78 Ga0163162_10304043 3300013306 Bacteria 1727
79 Ga0163162_10631109 3300013306 Bacteria 1196
80 Ga0163162_10708696 3300013306 Bacteria 1128
81 Ga0157372_10016796 3300013307 Bacteria 7856
82 Ga0157375_10058409 3300013308 Bacteria 3816
83 Ga0157375_10062898 3300013308 Bacteria 3689
84 Ga0163163_10087210 3300014325 Bacteria 3131
85 Ga0157380_10000245 3300014326 Bacteria 32686
86 Ga0157380_10534057 3300014326 Bacteria 1147
87 Ga0157380_10770000 3300014326 Bacteria 976
88 Ga0157376_10159165 3300014969 Bacteria 2045
89 Ga0163161_10049757 3300017792 Bacteria 3030
90 Ga0209147_100065 3300025229 Bacteria 232777
91 Ga0207697_10000255 3300025315 Bacteria 29466
92 Ga0207688_10013198 3300025901 Bacteria 4491
93 Ga0207647_10166916 3300025904 Bacteria 1283
94 Ga0207685_10028510 3300025905 Bacteria 1967
95 Ga0207705_10038388 3300025909 Bacteria 3428
96 Ga0207654_10080495 3300025911 Bacteria 1959
97 Ga0207654_10708719 3300025911 Bacteria 723
98 Ga0207707_10088954 3300025912 Bacteria 2698
99 Ga0207707_10360874 3300025912 Bacteria 1251
100 Ga0207660_10023211 3300025917 Bacteria 4188
101 Ga0207657_10001377 3300025919 Bacteria 25939
102 Ga0207649_10166701 3300025920 Bacteria 1531
103 Ga0207649_10288220 3300025920 Bacteria 1196
104 Ga0207652_10052109 3300025921 Bacteria 3511
105 Ga0207646_10149216 3300025922 Bacteria 2108
106 Ga0207681_10079232 3300025923 Bacteria 2314
107 Ga0207650_10030274 3300025925 Bacteria 3898
108 Ga0207650_10114385 3300025925 Bacteria 2093
109 Ga0207687_10004912 3300025927 Bacteria 8879
110 Ga0207706_10000334 3300025933 Bacteria 51180
111 Ga0207709_10281560 3300025935 Bacteria 1228
112 Ga0207709_10891372 3300025935 Bacteria 723
113 Ga0207665_10032665 3300025939 Bacteria 3447
114 Ga0207665_10701616 3300025939 Bacteria 796
115 Ga0207691_10081328 3300025940 Bacteria 2912
116 Ga0207691_10132621 3300025940 Bacteria 2199
117 Ga0207711_10628143 3300025941 Bacteria 1002
118 Ga0207689_10237022 3300025942 Bacteria 1508
119 Ga0207661_10260548 3300025944 Bacteria 1544
120 Ga0207661_10530835 3300025944 Bacteria 1077
121 Ga0207679_10014905 3300025945 Bacteria 5121
122 Ga0207679_10033297 3300025945 Bacteria 3625
123 Ga0207679_10038117 3300025945 Bacteria 3422
124 Ga0207679_10145425 3300025945 Bacteria 1922
125 Ga0207667_10134114 3300025949 Bacteria 2550
126 Ga0207712_10168965 3300025961 Unclassified 1707
127 Ga0207668_10154825 3300025972 Bacteria 1779
128 Ga0207640_10064027 3300025981 Bacteria 2446
129 Ga0207658_10247897 3300025986 Bacteria 1512
130 Ga0207703_10409955 3300026035 Bacteria 1259
131 Ga0207703_10457843 3300026035 Bacteria 1193
132 Ga0207639_10134322 3300026041 Bacteria 2052
133 Ga0207678_10224927 3300026067 Bacteria 1606
134 Ga0207678_11093236 3300026067 Bacteria 706
135 Ga0207641_10137767 3300026088 Bacteria 2198
136 Ga0207641_10794027 3300026088 Bacteria 936
137 Ga0207648_10045265 3300026089 Bacteria 3860
138 Ga0207648_10053099 3300026089 Bacteria 3544
139 Ga0207674_10002672 3300026116 Bacteria 22238
140 Ga0207675_100261480 3300026118 Bacteria 1677
141 Ga0207675_100495645 3300026118 Bacteria 1215
142 Ga0207675_100839245 3300026118 Bacteria 933
143 Ga0207683_10027495 3300026121 Bacteria 4915
144 Ga0207683_10146426 3300026121 Bacteria 2130
145 Ga0207698_10759734 3300026142 Bacteria 969
146 Ga0207698_10953842 3300026142 Bacteria 867
147 Ga0268266_10430937 3300028379 Bacteria 1251
148 Ga0268265_10037681 3300028380 Bacteria 3551
149 Ga0268265_10826248 3300028380 Bacteria 905
150 Ga0268265_11778504 3300028380 Bacteria 623
151 Ga0268264_10020910 3300028381 Bacteria 5346
152 Ga0265318_10000663 3300028577 Bacteria 23466
153 Ga0265338_10000546 3300028800 Bacteria 65848
154 Ga0265338_10019159 3300028800 Bacteria 7281
155 Ga0307413_10310756 3300031824 Bacteria 1199
156 Ga0307414_10821991 3300032004 Bacteria 848
157 Ga0307507_10057657 3300033179 Bacteria 3656
158 Ga0395899_0152443 3300037312 Bacteria 1637
159 Ga0395900_0120452 3300037418 Bacteria 2693
160 Ga0395898_0707021 3300037466 Bacteria 949
161 Ga0436364_0009050 3300037853 Bacteria 866
162 Ga0451853_0821054 3300041512 Bacteria 2799
163 Ga0453683_0110140 3300044673 Bacteria 1731
164 Ga0466966_0112700 3300044684 Bacteria 1675
165 Ga0466963_0013044 3300044694 Bacteria 5095
166 Ga0466963_0163994 3300044694 Bacteria 1547
167 Ga0453684_0251402 3300044712 Bacteria 2030
168 Ga0453684_1334600 3300044712 Bacteria 747
169 Ga0466971_0026809 3300044719 Bacteria 2578
170 Ga0466971_0105459 3300044719 Bacteria 1298
171 Ga0466959_0005979 3300045049 Bacteria 8396
172 Ga0451576_0041978 3300045051 Bacteria 4831
173 Ga0451576_1466871 3300045051 Bacteria 709
174 Ga0466958_0166883 3300045836 Bacteria 1393
175 Ga0495630_1022429 3300046517 Bacteria 628
176 Ga0495656_0061085 3300046615 Bacteria 1645
177 Ga0495669_0106032 3300046684 Bacteria 1309
178 Ga0496101_0153978 3300048904 Bacteria 1760
179 Ga0496106_0098560 3300048909 Bacteria 2265
180 Ga0496109_0960202 3300048912 Bacteria 793
181 Ga0496110_0153313 3300048913 Bacteria 2087
182 Ga0496114_0120606 3300048917 Bacteria 2255
183 Ga0496115_0082134 3300048918 Bacteria 2625
184 Ga0501293_031678 3300049516 Bacteria 568
185 Ga0501032_0176138 3300049569 Bacteria 1401
186 Ga0501033_0425873 3300049570 Bacteria 924
187 Ga0501036_0424565 3300049572 Bacteria 1108
188 Ga0501037_0295949 3300049573 Bacteria 1125
189 Ga0501037_0488449 3300049573 Bacteria 836
190 Ga0501038_0175064 3300049574 Bacteria 1734
191 Ga0501043_0173198 3300049579 Bacteria 1683
192 Ga0501047_0003836 3300049581 Bacteria 14136
193 Ga0501047_0770831 3300049581 Bacteria 777
194 Ga0501069_0501611 3300049585 Bacteria 724
195 Ga0501072_0729275 3300049588 Bacteria 778
196 Ga0501077_0562983 3300049593 Bacteria 732
197 Ga0501223_061282 3300049663 Bacteria 735
198 Ga0501225_0000246 3300049705 Bacteria 16948
199 Ga0501079_0039217 3300049741 Bacteria 3653
200 Ga0501035_0011301 3300049822 Bacteria 8273
201 Ga0501044_0001759 3300049823 Bacteria 25307
202 Ga0501044_0252900 3300049823 Bacteria 1702
203 nmdc:mga05p37_198805_c1 3300050507 Bacteria 2429
204 nmdc:mga0n895_188046_c1 3300050512 Bacteria 2096
205 nmdc:mga08x19_286985_c1 3300050514 Bacteria 1141
206 Ga0495595_0129695 3300053084 Bacteria 1232
207 Ga0500566_0255722 3300053094 Bacteria 849
208 Ga0466962_0135753 3300061719 Bacteria 1190
209 2595090989 2593339131 Bacteria 5116855
210 2777761634 2775507177 Bacteria 4384303
211 2846039225 2846037992 Bacteria 4526407
212 2936343666 2936340661 Bacteria 5139038
213 8007374726 8007371054 Bacteria 4849201
214 Ga0070674_100666800
215 rootH1_10006040
216 Ga0065712_10101866
217 Ga0065712_10289177
218 Ga0065707_10082097
219 Ga0070658_10138174
220 Ga0070683_100011377
221 Ga0070683_100115839
222 Ga0070683_100308011
223 Ga0070670_100072985
224 Ga0070670_101139879
225 Ga0068869_100031690
226 Ga0068869_100041370
227 Ga0070680_100012915
228 Ga0070660_100074780
229 Ga0070661_100052677
230 Ga0070692_10020904
231 Ga0070668_100196874
232 Ga0070675_100103115
233 Ga0070673_101175910
234 Ga0070659_100071636
235 Ga0070667_100205911
236 Ga0070663_100575914
237 Ga0070678_100079916
238 Ga0070662_100000272
239 Ga0070662_100205195
240 Ga0070681_10052216
241 Ga0068867_100008227
242 Ga0068867_100022565
243 Ga0070685_10360366
244 Ga0070707_100156407
245 Ga0070679_100004564
246 Ga0070684_100252574
247 Ga0068853_100049397
248 Ga0068853_100206925
249 Ga0070672_100144523
250 Ga0070696_100860294
251 Ga0070693_100333179
252 Ga0068855_100186079
253 Ga0070664_100040922
254 Ga0070664_100050515
255 Ga0070664_100125285
256 Ga0070664_100671776
257 Ga0068857_100043460
258 Ga0068854_100031723
259 Ga0070702_100080616
260 Ga0070702_100167092
261 Ga0068852_100704636
262 Ga0068859_100299898
263 Ga0068866_10027235
264 Ga0068861_100488255
265 Ga0068861_100607147
266 Ga0068863_100815946
267 Ga0068858_100258593
268 Ga0068860_100047040
269 Ga0068862_100104930
270 Ga0070716_100081876
271 Ga0070716_100151537
272 Ga0068865_100901183
273 Ga0075436_100258328
274 Ga0097620_100299903
275 Ga0105245_10006949
276 Ga0105247_10184090
277 Ga0114129_10474698
278 Ga0105243_10017729
279 Ga0105243_10169102
280 Ga0105241_10080862
281 Ga0105241_10497631
282 Ga0105242_10101902
283 Ga0105248_10009169
284 Ga0105249_10286439
285 Ga0105239_10155454
286 Ga0105246_10788168
287 Ga0157371_10080441
288 Ga0157371_10142830
289 Ga0157370_10025973
290 Ga0157369_10002865
291 Ga0163162_10304043
292 Ga0163162_10631109
293 Ga0163162_10708696
294 Ga0157372_10016796
295 Ga0157375_10058409
296 Ga0157375_10062898
297 Ga0163163_10087210
298 Ga0157380_10000245
299 Ga0157380_10534057
300 Ga0157380_10770000
301 Ga0157376_10159165
302 Ga0163161_10049757
303 Ga0209147_100065
304 Ga0207697_10000255
305 Ga0207688_10013198
306 Ga0207647_10166916
307 Ga0207685_10028510
308 Ga0207705_10038388
309 Ga0207654_10080495
310 Ga0207654_10708719
311 Ga0207707_10088954
312 Ga0207707_10360874
313 Ga0207660_10023211
314 Ga0207657_10001377
315 Ga0207649_10166701
316 Ga0207649_10288220
317 Ga0207652_10052109
318 Ga0207646_10149216
319 Ga0207681_10079232
320 Ga0207650_10030274
321 Ga0207650_10114385
322 Ga0207687_10004912
323 Ga0207706_10000334
324 Ga0207709_10281560
325 Ga0207709_10891372
326 Ga0207665_10032665
327 Ga0207665_10701616
328 Ga0207691_10081328
329 Ga0207691_10132621
330 Ga0207711_10628143
331 Ga0207689_10237022
332 Ga0207661_10260548
333 Ga0207661_10530835
334 Ga0207679_10014905
335 Ga0207679_10033297
336 Ga0207679_10038117
337 Ga0207679_10145425
338 Ga0207667_10134114
339 Ga0207712_10168965
340 Ga0207668_10154825
341 Ga0207640_10064027
342 Ga0207658_10247897
343 Ga0207703_10409955
344 Ga0207703_10457843
345 Ga0207639_10134322
346 Ga0207678_10224927
347 Ga0207678_11093236
348 Ga0207641_10137767
349 Ga0207641_10794027
350 Ga0207648_10045265
351 Ga0207648_10053099
352 Ga0207674_10002672
353 Ga0207675_100261480
354 Ga0207675_100495645
355 Ga0207675_100839245
356 Ga0207683_10027495
357 Ga0207683_10146426
358 Ga0207698_10759734
359 Ga0207698_10953842
360 Ga0268266_10430937
361 Ga0268265_10037681
362 Ga0268265_10826248
363 Ga0268265_11778504
364 Ga0268264_10020910
365 Ga0265318_10000663
366 Ga0265338_10000546
367 Ga0265338_10019159
368 Ga0307413_10310756
369 Ga0307414_10821991
370 Ga0307507_10057657
371 Ga0395899_0152443
372 Ga0395900_0120452
373 Ga0395898_0707021
374 Ga0436364_0009050
375 Ga0451853_0821054
376 Ga0453683_0110140
377 Ga0466966_0112700
378 Ga0466963_0013044
379 Ga0466963_0163994
380 Ga0453684_0251402
381 Ga0453684_1334600
382 Ga0466971_0026809
383 Ga0466971_0105459
384 Ga0466959_0005979
385 Ga0451576_0041978
386 Ga0451576_1466871
387 Ga0466958_0166883
388 Ga0495630_1022429
389 Ga0495656_0061085
390 Ga0495669_0106032
391 Ga0496101_0153978
392 Ga0496106_0098560
393 Ga0496109_0960202
394 Ga0496110_0153313
395 Ga0496114_0120606
396 Ga0496115_0082134
397 Ga0501293_031678
398 Ga0501032_0176138
399 Ga0501033_0425873
400 Ga0501036_0424565
401 Ga0501037_0295949
402 Ga0501037_0488449
403 Ga0501038_0175064
404 Ga0501043_0173198
405 Ga0501047_0003836
406 Ga0501047_0770831
407 Ga0501069_0501611
408 Ga0501072_0729275
409 Ga0501077_0562983
410 Ga0501223_061282
411 Ga0501225_0000246
412 Ga0501079_0039217
413 Ga0501035_0011301
414 Ga0501044_0001759
415 Ga0501044_0252900
416 nmdc:mga05p37_198805_c1
417 nmdc:mga0n895_188046_c1
418 nmdc:mga08x19_286985_c1
419 Ga0495595_0129695
420 Ga0500566_0255722
421 Ga0466962_0135753
422 2595090989
423 2777761634
424 2846039225
425 2936343666
426 8007374726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06736

TMEM175

Endosomal/lysosomal potassium channel TMEM175

14

98

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8149 5 180
7lf6-assembly1.cif.gz_B structure of lysosomal membrane protein 0.7925 3 178
7unm-assembly1.cif.gz_A human tmem175 in an closed state 0.786 1 180
6w8p-assembly1.cif.gz_B structure of membrane protein with ions 0.7837 7 177
8dhm-assembly1.cif.gz_A human tmem175 in complex with 4-aminopyridine 0.782 2 179
ID Description Score Start End Superfamily
af_Q3EBY6_10_127_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.6589 15 124 1.20.930.20
af_A0A0R0HAI4_1_197_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.6211 9 130 1.20.1420.10
af_Q3EBY6_10_127_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.5864 15 124 1.20.930.20
af_A0A0R0HUX5_50_167_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.5525 16 128 1.20.930.20
1sj8A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.55 38 182 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A7R7T422-F1-model_v4 DUF1211 domain-containing protein 0.9889 5 191 GO:0005267
GO:0015252
GO:0016020
AF-A0A2U3QFG1-F1-model_v4 DUF1211 domain-containing protein 0.9883 1 193 GO:0005267
GO:0015252
GO:0016020
AF-A0A529ZQU9-F1-model_v4 DUF1211 domain-containing protein 0.9869 3 126 GO:0005267
GO:0015252
GO:0016020
AF-Q98KD7-F1-model_v4 Mlr1523 protein 0.9858 3 192 GO:0005267
GO:0015252
GO:0016020
AF-A0A2V5PTR6-F1-model_v4 DUF1211 domain-containing protein 0.9853 3 177 GO:0005267
GO:0015252
GO:0016020

Map