F323276

General Info

Members Datasets Scaffolds Average Seq Length
212 159 424 86

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_1023263|Ga0496100_1023263_149_445
Length 98
Sequence MSIGGSAGSGGSQQHLDGYEAPIHGALGSPILLAGAPRGLAIVNGTLAAALGLGLHQWLAGLIVWAVGHSLAVLATRRDPHFAPVLVRHLRQRGYFGC

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
79 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
80 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
84 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
113 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
114 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
115 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
116 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
117 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
118 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
119 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
120 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
123 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
124 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
125 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
126 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
127 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
128 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
129 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
130 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
131 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
132 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
133 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
134 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
135 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
136 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
137 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
138 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
139 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
140 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
141 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
142 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
143 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
144 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
145 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
146 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
147 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
148 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
149 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
150 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
151 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
152 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
153 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
154 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
155 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
156 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
157 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
158 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
159 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.91
Metatranscriptomes 0
Isolates 15.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.96
Nodule 11.32
Rhizoplane 2.36
Rhizosphere 57.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_1023263 3300048903 Bacteria 650
2 JGI25165J46597_1000109 3300003214 Bacteria 149484
3 JGI25165J46597_1015735 3300003214 Bacteria 1018
4 rootH1_10050439 3300003323 Bacteria 2535
5 rootH1_10389526 3300003323 Bacteria 1824
6 Ga0070658_10008577 3300005327 Bacteria 8219
7 Ga0070683_100001387 3300005329 Bacteria 18596
8 Ga0070660_100168334 3300005339 Bacteria 1769
9 Ga0070660_100623569 3300005339 Bacteria 902
10 Ga0070661_100064064 3300005344 Bacteria 2701
11 Ga0070661_101397693 3300005344 Bacteria 589
12 Ga0070661_101487605 3300005344 Bacteria 571
13 Ga0070659_100539526 3300005366 Bacteria 998
14 Ga0070709_11283696 3300005434 Bacteria 590
15 Ga0070714_100268047 3300005435 Bacteria 1583
16 Ga0070713_100126697 3300005436 Bacteria 2247
17 Ga0070663_101220958 3300005455 Bacteria 661
18 Ga0070663_101527643 3300005455 Bacteria 594
19 Ga0070679_100189736 3300005530 Bacteria 2025
20 Ga0070679_100917444 3300005530 Bacteria 819
21 Ga0070684_100000637 3300005535 Bacteria 24083
22 Ga0070686_101180697 3300005544 Bacteria 635
23 Ga0070693_101537102 3300005547 Bacteria 521
24 Ga0068855_100298580 3300005563 Bacteria 1784
25 Ga0068855_100479964 3300005563 Bacteria 1353
26 Ga0070664_100009428 3300005564 Bacteria 7914
27 Ga0068857_100040390 3300005577 Bacteria 4137
28 Ga0068856_100001545 3300005614 Bacteria 24115
29 Ga0081540_1000745 3300005983 Bacteria 29937
30 Ga0081540_1029122 3300005983 Bacteria 3084
31 Ga0070717_10903789 3300006028 Bacteria 804
32 Ga0070716_100285342 3300006173 Bacteria 1141
33 Ga0075370_10570308 3300006353 Bacteria 685
34 Ga0099795_10182725 3300007788 Bacteria 877
35 Ga0105240_10000121 3300009093 Bacteria 163057
36 Ga0105240_10062659 3300009093 Bacteria 4629
37 Ga0105240_10463939 3300009093 Bacteria 1415
38 Ga0105237_10000700 3300009545 Bacteria 46452
39 Ga0105238_11155776 3300009551 Bacteria 798
40 Ga0105238_11711056 3300009551 Bacteria 660
41 Ga0105239_11688109 3300010375 Bacteria 733
42 Ga0157371_10025089 3300013102 Bacteria 4349
43 Ga0157371_10248254 3300013102 Bacteria 1281
44 Ga0157371_10555785 3300013102 Bacteria 851
45 Ga0157372_10002095 3300013307 Bacteria 21691
46 Ga0157376_12258136 3300014969 Bacteria 583
47 Ga0213874_10130058 3300021377 Bacteria 864
48 Ga0213875_10002868 3300021388 Bacteria 10091
49 Ga0209233_1000167 3300025261 Bacteria 149536
50 Ga0209233_1001014 3300025261 Bacteria 11983
51 Ga0209233_1007519 3300025261 Bacteria 3447
52 Ga0207699_11479001 3300025906 Bacteria 502
53 Ga0207705_10005208 3300025909 Bacteria 9749
54 Ga0207705_10097900 3300025909 Bacteria 2155
55 Ga0207695_10000006 3300025913 Bacteria 1135309
56 Ga0207671_10001975 3300025914 Bacteria 22615
57 Ga0207693_10641626 3300025915 Bacteria 825
58 Ga0207660_11139504 3300025917 Bacteria 635
59 Ga0207657_10005598 3300025919 Bacteria 13118
60 Ga0207657_10007994 3300025919 Bacteria 10785
61 Ga0207649_10148216 3300025920 Bacteria 1613
62 Ga0207649_11074830 3300025920 Bacteria 634
63 Ga0207652_10451361 3300025921 Bacteria 1159
64 Ga0207664_10921127 3300025929 Bacteria 784
65 Ga0207690_10470174 3300025932 Bacteria 1013
66 Ga0207665_11303839 3300025939 Bacteria 579
67 Ga0207661_10002993 3300025944 Bacteria 11688
68 Ga0207679_10007620 3300025945 Bacteria 6874
69 Ga0207658_10733890 3300025986 Bacteria 894
70 Ga0207702_10001302 3300026078 Bacteria 24991
71 Ga0207702_11447539 3300026078 Bacteria 681
72 Ga0207641_10850230 3300026088 Bacteria 904
73 Ga0207674_10053187 3300026116 Bacteria 4128
74 Ga0207698_10260307 3300026142 Bacteria 1593
75 Ga0207698_10876534 3300026142 Bacteria 904
76 Ga0209371_1075246 3300027312 Bacteria 592
77 Ga0265337_1001516 3300028556 Bacteria 11403
78 Ga0265326_10023835 3300028558 Bacteria 1747
79 Ga0265319_1002022 3300028563 Bacteria 11414
80 Ga0265334_10001797 3300028573 Bacteria 10221
81 Ga0265318_10010903 3300028577 Bacteria 3938
82 Ga0265323_10000762 3300028653 Bacteria 17257
83 Ga0265336_10000110 3300028666 Bacteria 62531
84 Ga0307517_10000102 3300028786 Bacteria 123775
85 Ga0307517_10084214 3300028786 Bacteria 2679
86 Ga0307515_10122301 3300028794 Bacteria 2936
87 Ga0265338_10000656 3300028800 Bacteria 59900
88 Ga0265324_10000502 3300029957 Bacteria 27092
89 Ga0268256_1067488 3300030500 Bacteria 699
90 Ga0307513_10750161 3300031456 Bacteria 682
91 Ga0307413_10398173 3300031824 Bacteria 1078
92 Ga0307412_10067293 3300031911 Bacteria 2431
93 Ga0307510_10027658 3300033180 Bacteria 6491
94 Ga0395899_0000387 3300037312 Bacteria 52472
95 Ga0395900_0000130 3300037418 Bacteria 126231
96 Ga0395900_0197770 3300037418 Bacteria 2036
97 Ga0395900_0254030 3300037418 Bacteria 1758
98 Ga0395900_0708134 3300037418 Bacteria 940
99 Ga0395900_1559065 3300037418 Bacteria 572
100 Ga0395898_0000274 3300037466 Bacteria 125922
101 Ga0395905_0000287 3300037471 Bacteria 73803
102 Ga0395905_0105822 3300037471 Bacteria 2642
103 Ga0395905_0338988 3300037471 Bacteria 1394
104 Ga0395905_0835290 3300037471 Bacteria 824
105 Ga0436364_0495199 3300037853 Bacteria 16598
106 Ga0395901_0014380 3300038443 Bacteria 8055
107 Ga0395901_0032737 3300038443 Bacteria 5363
108 Ga0395901_0151958 3300038443 Bacteria 2433
109 Ga0395901_0518466 3300038443 Bacteria 1211
110 Ga0436363_0675445 3300039450 Bacteria 2105
111 Ga0451837_0883307 3300041494 Bacteria 634
112 Ga0451849_0549302 3300041505 Bacteria 773
113 Ga0466967_0038085 3300045976 Bacteria 4121
114 Ga0466967_1018131 3300045976 Bacteria 825
115 Ga0495628_0400054 3300046516 Bacteria 1003
116 Ga0495644_0141283 3300046523 Bacteria 919
117 Ga0495648_0095962 3300046524 Bacteria 1649
118 Ga0495648_0197180 3300046524 Bacteria 1011
119 Ga0495652_0089198 3300046529 Bacteria 2525
120 Ga0495652_0169627 3300046529 Bacteria 1686
121 Ga0495587_0134405 3300046536 Bacteria 1413
122 Ga0495645_0924677 3300046543 Bacteria 516
123 Ga0495668_0296227 3300046616 Bacteria 887
124 Ga0495625_0393881 3300046660 Bacteria 867
125 Ga0495624_0338832 3300046690 Bacteria 905
126 Ga0495671_0033911 3300046692 Bacteria 2598
127 Ga0495672_0025468 3300047320 Bacteria 3786
128 Ga0495672_0254331 3300047320 Bacteria 851
129 Ga0495673_0097706 3300047469 Bacteria 1192
130 Ga0496100_0467921 3300048903 Bacteria 968
131 Ga0496101_1522675 3300048904 Bacteria 520
132 Ga0496102_0000117 3300048905 Bacteria 114037
133 Ga0496103_0000076 3300048906 Bacteria 113209
134 Ga0496116_0001044 3300048919 Bacteria 33756
135 Ga0496116_0001227 3300048919 Bacteria 29879
136 Ga0496116_0129614 3300048919 Bacteria 1441
137 Ga0496117_0000201 3300048920 Bacteria 117679
138 Ga0496117_0052177 3300048920 Bacteria 2883
139 Ga0496118_0000097 3300048921 Bacteria 160837
140 Ga0496118_0009599 3300048921 Bacteria 9741
141 Ga0496118_0055156 3300048921 Bacteria 3002
142 Ga0496119_0007936 3300048922 Bacteria 9446
143 Ga0496119_0019820 3300048922 Bacteria 4932
144 Ga0496120_0071914 3300048923 Bacteria 1897
145 Ga0496121_0001383 3300048924 Bacteria 41083
146 Ga0496121_0058372 3300048924 Bacteria 3191
147 Ga0496121_0634794 3300048924 Bacteria 653
148 Ga0496122_0002492 3300048925 Bacteria 26017
149 Ga0496122_0058937 3300048925 Bacteria 2838
150 Ga0496122_0073868 3300048925 Bacteria 2415
151 Ga0496123_0065621 3300048926 Bacteria 2305
152 Ga0496124_0000202 3300048927 Bacteria 117650
153 Ga0496124_0000469 3300048927 Bacteria 69682
154 Ga0496125_0058458 3300048928 Bacteria 3114
155 Ga0496126_0002551 3300048929 Bacteria 24383
156 Ga0501046_0386613 3300049580 Bacteria 1012
157 Ga0501047_0000789 3300049581 Bacteria 33142
158 Ga0501070_0115425 3300049586 Bacteria 2218
159 Ga0501072_0288532 3300049588 Bacteria 1305
160 Ga0501223_000136 3300049663 Bacteria 20934
161 Ga0501224_000005 3300049664 Bacteria 149922
162 Ga0501233_000008 3300049668 Bacteria 34986
163 Ga0501235_000193 3300049669 Bacteria 10723
164 Ga0501225_0000103 3300049705 Bacteria 26604
165 Ga0501234_013511 3300049707 Bacteria 1281
166 Ga0501226_000021 3300049853 Bacteria 127141
167 nmdc:mga03n38_716911_c1 3300050490 Bacteria 577
168 Ga0500635_0000351 3300053080 Bacteria 15015
169 Ga0500635_0040553 3300053080 Bacteria 1554
170 Ga0495619_0476345 3300053085 Bacteria 860
171 Ga0500644_0265942 3300053088 Bacteria 726
172 Ga0500566_0000169 3300053094 Bacteria 33123
173 Ga0500562_006308 3300053108 Bacteria 2990
174 Ga0500607_006308 3300053121 Bacteria 7530
175 Ga0500607_098973 3300053121 Bacteria 1452
176 Ga0500559_0021435 3300053136 Bacteria 2738
177 Ga0500559_0030629 3300053136 Bacteria 2308
178 Ga0500559_0082157 3300053136 Bacteria 1466
179 Ga0500619_232337 3300053154 Bacteria 611
180 Ga0500636_0065734 3300053177 Bacteria 2110
181 2643823225 2643221560 Bacteria 4801179
182 2819555043 2818991438 Bacteria 5793701
183 2844322303 2844315083 Bacteria 8138177
184 2847932695 2847930680 Bacteria 9342022
185 2857529625 2857524615 Bacteria 6615449
186 2903733636 2903727486 Bacteria 8281579
187 2906608994 2906602504 Bacteria 8295279
188 2908740187 2908739725 Bacteria 8628932
189 2922393268 2922393267 Bacteria 8285685
190 2928973991 2928972540 Bacteria 3058286
191 2935683918 2935675223 Bacteria 9928132
192 2935693959 2935684952 Bacteria 9590419
193 2935702787 2935694250 Bacteria 9291695
194 2935722538 2935713505 Bacteria 9608509
195 2935731847 2935722832 Bacteria 9608746
196 2935741181 2935732158 Bacteria 9706831
197 2935750557 2935741537 Bacteria 9707219
198 2935760032 2935750917 Bacteria 9590372
199 2935767015 2935760218 Bacteria 9817913
200 2935769149 2935760218 Bacteria 9817913
201 2935804502 2935801545 Bacteria 9301974
202 2940565931 2940556831 Bacteria 9590747
203 3005603102 3005594810 Bacteria 8716512
204 3005725574 3005718088 Bacteria 8283608
205 8016533319 8016530956 Bacteria 8155261
206 8016546554 8016539877 Bacteria 8155419
207 8016563926 8016557553 Bacteria 8154380
208 8016571644 8016566248 Bacteria 8158151
209 8016575878 8016575299 Bacteria 8154085
210 8016601645 8016595262 Bacteria 8149947
211 8019533106 8019530166 Bacteria 8155624
212 8056972214 8056967851 Bacteria 9038162
213 Ga0496100_1023263
214 JGI25165J46597_1000109
215 JGI25165J46597_1015735
216 rootH1_10050439
217 rootH1_10389526
218 Ga0070658_10008577
219 Ga0070683_100001387
220 Ga0070660_100168334
221 Ga0070660_100623569
222 Ga0070661_100064064
223 Ga0070661_101397693
224 Ga0070661_101487605
225 Ga0070659_100539526
226 Ga0070709_11283696
227 Ga0070714_100268047
228 Ga0070713_100126697
229 Ga0070663_101220958
230 Ga0070663_101527643
231 Ga0070679_100189736
232 Ga0070679_100917444
233 Ga0070684_100000637
234 Ga0070686_101180697
235 Ga0070693_101537102
236 Ga0068855_100298580
237 Ga0068855_100479964
238 Ga0070664_100009428
239 Ga0068857_100040390
240 Ga0068856_100001545
241 Ga0081540_1000745
242 Ga0081540_1029122
243 Ga0070717_10903789
244 Ga0070716_100285342
245 Ga0075370_10570308
246 Ga0099795_10182725
247 Ga0105240_10000121
248 Ga0105240_10062659
249 Ga0105240_10463939
250 Ga0105237_10000700
251 Ga0105238_11155776
252 Ga0105238_11711056
253 Ga0105239_11688109
254 Ga0157371_10025089
255 Ga0157371_10248254
256 Ga0157371_10555785
257 Ga0157372_10002095
258 Ga0157376_12258136
259 Ga0213874_10130058
260 Ga0213875_10002868
261 Ga0209233_1000167
262 Ga0209233_1001014
263 Ga0209233_1007519
264 Ga0207699_11479001
265 Ga0207705_10005208
266 Ga0207705_10097900
267 Ga0207695_10000006
268 Ga0207671_10001975
269 Ga0207693_10641626
270 Ga0207660_11139504
271 Ga0207657_10005598
272 Ga0207657_10007994
273 Ga0207649_10148216
274 Ga0207649_11074830
275 Ga0207652_10451361
276 Ga0207664_10921127
277 Ga0207690_10470174
278 Ga0207665_11303839
279 Ga0207661_10002993
280 Ga0207679_10007620
281 Ga0207658_10733890
282 Ga0207702_10001302
283 Ga0207702_11447539
284 Ga0207641_10850230
285 Ga0207674_10053187
286 Ga0207698_10260307
287 Ga0207698_10876534
288 Ga0209371_1075246
289 Ga0265337_1001516
290 Ga0265326_10023835
291 Ga0265319_1002022
292 Ga0265334_10001797
293 Ga0265318_10010903
294 Ga0265323_10000762
295 Ga0265336_10000110
296 Ga0307517_10000102
297 Ga0307517_10084214
298 Ga0307515_10122301
299 Ga0265338_10000656
300 Ga0265324_10000502
301 Ga0268256_1067488
302 Ga0307513_10750161
303 Ga0307413_10398173
304 Ga0307412_10067293
305 Ga0307510_10027658
306 Ga0395899_0000387
307 Ga0395900_0000130
308 Ga0395900_0197770
309 Ga0395900_0254030
310 Ga0395900_0708134
311 Ga0395900_1559065
312 Ga0395898_0000274
313 Ga0395905_0000287
314 Ga0395905_0105822
315 Ga0395905_0338988
316 Ga0395905_0835290
317 Ga0436364_0495199
318 Ga0395901_0014380
319 Ga0395901_0032737
320 Ga0395901_0151958
321 Ga0395901_0518466
322 Ga0436363_0675445
323 Ga0451837_0883307
324 Ga0451849_0549302
325 Ga0466967_0038085
326 Ga0466967_1018131
327 Ga0495628_0400054
328 Ga0495644_0141283
329 Ga0495648_0095962
330 Ga0495648_0197180
331 Ga0495652_0089198
332 Ga0495652_0169627
333 Ga0495587_0134405
334 Ga0495645_0924677
335 Ga0495668_0296227
336 Ga0495625_0393881
337 Ga0495624_0338832
338 Ga0495671_0033911
339 Ga0495672_0025468
340 Ga0495672_0254331
341 Ga0495673_0097706
342 Ga0496100_0467921
343 Ga0496101_1522675
344 Ga0496102_0000117
345 Ga0496103_0000076
346 Ga0496116_0001044
347 Ga0496116_0001227
348 Ga0496116_0129614
349 Ga0496117_0000201
350 Ga0496117_0052177
351 Ga0496118_0000097
352 Ga0496118_0009599
353 Ga0496118_0055156
354 Ga0496119_0007936
355 Ga0496119_0019820
356 Ga0496120_0071914
357 Ga0496121_0001383
358 Ga0496121_0058372
359 Ga0496121_0634794
360 Ga0496122_0002492
361 Ga0496122_0058937
362 Ga0496122_0073868
363 Ga0496123_0065621
364 Ga0496124_0000202
365 Ga0496124_0000469
366 Ga0496125_0058458
367 Ga0496126_0002551
368 Ga0501046_0386613
369 Ga0501047_0000789
370 Ga0501070_0115425
371 Ga0501072_0288532
372 Ga0501223_000136
373 Ga0501224_000005
374 Ga0501233_000008
375 Ga0501235_000193
376 Ga0501225_0000103
377 Ga0501234_013511
378 Ga0501226_000021
379 nmdc:mga03n38_716911_c1
380 Ga0500635_0000351
381 Ga0500635_0040553
382 Ga0495619_0476345
383 Ga0500644_0265942
384 Ga0500566_0000169
385 Ga0500562_006308
386 Ga0500607_006308
387 Ga0500607_098973
388 Ga0500559_0021435
389 Ga0500559_0030629
390 Ga0500559_0082157
391 Ga0500619_232337
392 Ga0500636_0065734
393 2643823225
394 2819555043
395 2844322303
396 2847932695
397 2857529625
398 2903733636
399 2906608994
400 2908740187
401 2922393268
402 2928973991
403 2935683918
404 2935693959
405 2935702787
406 2935722538
407 2935731847
408 2935741181
409 2935750557
410 2935760032
411 2935767015
412 2935769149
413 2935804502
414 2940565931
415 3005603102
416 3005725574
417 8016533319
418 8016546554
419 8016563926
420 8016571644
421 8016575878
422 8016601645
423 8019533106
424 8056972214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05101

VirB3

Type IV secretory pathway, VirB3-like protein

19

97

0.8

Map