F323083

General Info

Members Datasets Scaffolds Average Seq Length
212 145 424 205

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0200522|Ga0395900_0200522_1238_1903
Length 221
Sequence MLDSRACGNGGSWGVGLDVTIIDCGIGNIKSVLRMFQAADGSAEIIDRPEQLNGAKRVALPGVGAFDAGMSALAEGWIEPLNKLALERKVPVLGICLGMQLLCRKSDEGDLPGLGWIDADVTQLDIDGRSDLKLPHMGWSVVTPTGPNPLIPVEEPEQRFYHVHRYRVVCDREETVLATAEYGRPFTTAVRSDNIFGVQFHPEKSHRFGLGLMRRFLSFPC

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
115 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
116 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
117 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
118 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
119 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
120 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
121 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
122 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
123 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
124 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
125 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
126 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
127 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
128 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
129 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
137 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
138 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
139 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
140 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
141 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
142 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
143 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
144 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
145 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.28
Metatranscriptomes 0
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.19
Nodule 0
Rhizoplane 1.89
Rhizosphere 91.98
Stem 0
Stem Tuber 0
Unclassified 10.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0200522 3300037418 Bacteria 2019
2 MBSR1b_contig_461596 2162886012 Bacteria 3034
3 JGI25153J46596_10000894 3300003215 Bacteria 18140
4 Ga0055526_1010676 3300003771 Bacteria 4242
5 Ga0055530_10000225 3300003791 Bacteria 50204
6 Ga0065712_10071808 3300005290 Bacteria 5043
7 Ga0065715_10114238 3300005293 Bacteria 2458
8 Ga0070658_10000002 3300005327 Bacteria 637290
9 Ga0070676_10018468 3300005328 Bacteria 3866
10 Ga0070690_100014654 3300005330 Bacteria 4654
11 Ga0070670_100003986 3300005331 Bacteria 12325
12 Ga0070677_10000995 3300005333 Bacteria 9162
13 Ga0070666_10338364 3300005335 Bacteria 1075
14 Ga0070680_100034631 3300005336 Unclassified 4072
15 Ga0070660_100000379 3300005339 Bacteria 29599
16 Ga0070660_100137022 3300005339 Bacteria 1961
17 Ga0070668_100057248 3300005347 Bacteria 3012
18 Ga0070669_100004851 3300005353 Bacteria 9708
19 Ga0070675_100001908 3300005354 Bacteria 15399
20 Ga0070674_100087627 3300005356 Bacteria 2239
21 Ga0070673_100094120 3300005364 Bacteria 2455
22 Ga0070659_100040501 3300005366 Bacteria 3641
23 Ga0070659_100759727 3300005366 Bacteria 841
24 Ga0070701_10091639 3300005438 Bacteria 1666
25 Ga0070705_100076465 3300005440 Bacteria 2042
26 Ga0070694_100888184 3300005444 Unclassified 735
27 Ga0070663_100224517 3300005455 Bacteria 1476
28 Ga0070678_100072604 3300005456 Unclassified 2580
29 Ga0070662_100010188 3300005457 Bacteria 6163
30 Ga0068867_100045539 3300005459 Bacteria 3218
31 Ga0068867_100173742 3300005459 Bacteria 1708
32 Ga0070707_100201595 3300005468 Unclassified 1939
33 Ga0070698_100298773 3300005471 Bacteria 1541
34 Ga0070699_100327200 3300005518 Bacteria 1378
35 Ga0070672_100020849 3300005543 Bacteria 4787
36 Ga0070686_100042300 3300005544 Bacteria 2853
37 Ga0070665_100002891 3300005548 Bacteria 18552
38 Ga0070665_100073206 3300005548 Unclassified 3433
39 Ga0070704_100444209 3300005549 Bacteria 1115
40 Ga0070664_100603151 3300005564 Bacteria 1018
41 Ga0068857_100011302 3300005577 Bacteria 7767
42 Ga0068856_100885948 3300005614 Unclassified 911
43 Ga0068859_100004337 3300005617 Bacteria 14464
44 Ga0068859_100101288 3300005617 Bacteria 2937
45 Ga0068859_100159017 3300005617 Bacteria 2338
46 Ga0068864_100014406 3300005618 Bacteria 6568
47 Ga0068864_100250771 3300005618 Bacteria 1643
48 Ga0068861_100205961 3300005719 Bacteria 1654
49 Ga0068858_100948023 3300005842 Unclassified 842
50 Ga0068860_100156359 3300005843 Bacteria 2197
51 Ga0068860_100731651 3300005843 Bacteria 1000
52 Ga0075366_10058709 3300006195 Bacteria 2286
53 Ga0075428_100023112 3300006844 Bacteria 6878
54 Ga0075428_100160880 3300006844 Bacteria 2437
55 Ga0075434_100379229 3300006871 Bacteria 1435
56 Ga0075429_100220689 3300006880 Unclassified 1660
57 Ga0097620_100004337 3300006931 Bacteria 14464
58 Ga0097620_100101286 3300006931 Bacteria 2937
59 Ga0097620_100159008 3300006931 Bacteria 2338
60 Ga0105240_10573325 3300009093 Bacteria 1246
61 Ga0105247_10117004 3300009101 Bacteria 1722
62 Ga0114129_10018382 3300009147 Bacteria 9957
63 Ga0114129_10747642 3300009147 Bacteria 1252
64 Ga0114129_11095211 3300009147 Bacteria 998
65 Ga0105248_10306540 3300009177 Bacteria 1788
66 Ga0105249_10103369 3300009553 Bacteria 2683
67 Ga0163162_11720919 3300013306 Bacteria 716
68 Ga0157375_10390467 3300013308 Unclassified 1558
69 Ga0163163_10074837 3300014325 Bacteria 3379
70 Ga0157379_10504094 3300014968 Bacteria 1122
71 Ga0209565_1000107 3300025263 Bacteria 120938
72 Ga0209130_1057325 3300025284 Unclassified 687
73 Ga0209564_1002204 3300025295 Bacteria 16261
74 Ga0209758_1000183 3300025297 Bacteria 140623
75 Ga0209050_1012640 3300025298 Bacteria 3845
76 Ga0207682_10001813 3300025893 Bacteria 9767
77 Ga0207680_10347307 3300025903 Bacteria 1042
78 Ga0207705_10000005 3300025909 Bacteria 673478
79 Ga0207705_10022860 3300025909 Bacteria 4457
80 Ga0207707_10234508 3300025912 Bacteria 1596
81 Ga0207660_10024529 3300025917 Unclassified 4084
82 Ga0207657_10000576 3300025919 Bacteria 38985
83 Ga0207657_10000749 3300025919 Bacteria 34403
84 Ga0207652_10095513 3300025921 Bacteria 2619
85 Ga0207646_10196254 3300025922 Unclassified 1823
86 Ga0207650_10032819 3300025925 Bacteria 3757
87 Ga0207659_10009575 3300025926 Bacteria 6059
88 Ga0207690_10026611 3300025932 Bacteria 3644
89 Ga0207690_10621261 3300025932 Bacteria 883
90 Ga0207706_10017286 3300025933 Bacteria 6499
91 Ga0207669_10104281 3300025937 Bacteria 1883
92 Ga0207691_10096981 3300025940 Bacteria 2635
93 Ga0207711_10233882 3300025941 Bacteria 1684
94 Ga0207651_10816393 3300025960 Unclassified 827
95 Ga0207668_10328339 3300025972 Bacteria 1272
96 Ga0207648_10305025 3300026089 Bacteria 1429
97 Ga0207676_10141673 3300026095 Bacteria 2059
98 Ga0207676_10298730 3300026095 Unclassified 1469
99 Ga0207674_10177231 3300026116 Bacteria 2084
100 Ga0209982_1009637 3300027552 Bacteria 1429
101 Ga0209974_10034307 3300027876 Bacteria 1685
102 Ga0268266_10158254 3300028379 Unclassified 2048
103 Ga0268265_10158699 3300028380 Unclassified 1918
104 Ga0307408_100000647 3300031548 Bacteria 29240
105 Ga0307408_100014260 3300031548 Bacteria 5279
106 Ga0307408_100014563 3300031548 Bacteria 5226
107 Ga0307408_100436279 3300031548 Unclassified 1133
108 Ga0307405_10039313 3300031731 Bacteria 2858
109 Ga0307405_10432219 3300031731 Bacteria 1039
110 Ga0307405_10547005 3300031731 Bacteria 936
111 Ga0307413_10000062 3300031824 Bacteria 27702
112 Ga0307413_10002733 3300031824 Bacteria 7245
113 Ga0307413_10063649 3300031824 Bacteria 2288
114 Ga0307413_10134488 3300031824 Bacteria 1698
115 Ga0307413_10262290 3300031824 Bacteria 1289
116 Ga0307410_10007124 3300031852 Bacteria 6098
117 Ga0307410_10078698 3300031852 Unclassified 2308
118 Ga0307410_10119292 3300031852 Bacteria 1921
119 Ga0307410_10242961 3300031852 Bacteria 1396
120 Ga0307406_10014805 3300031901 Bacteria 4495
121 Ga0307406_10118056 3300031901 Bacteria 1839
122 Ga0307412_10008860 3300031911 Bacteria 5761
123 Ga0307412_10544010 3300031911 Bacteria 974
124 Ga0307409_100000558 3300031995 Bacteria 16206
125 Ga0307409_100217235 3300031995 Bacteria 1723
126 Ga0307409_100456020 3300031995 Bacteria 1235
127 Ga0307409_100485602 3300031995 Bacteria 1200
128 Ga0307409_100722612 3300031995 Bacteria 997
129 Ga0307416_100008336 3300032002 Bacteria 6676
130 Ga0307416_100021307 3300032002 Bacteria 4650
131 Ga0307416_100034645 3300032002 Bacteria 3845
132 Ga0307416_100160784 3300032002 Bacteria 2076
133 Ga0307414_10020714 3300032004 Bacteria 4106
134 Ga0307414_10914638 3300032004 Bacteria 805
135 Ga0307411_10049836 3300032005 Bacteria 2724
136 Ga0307411_10053331 3300032005 Bacteria 2649
137 Ga0307411_10102877 3300032005 Bacteria 2025
138 Ga0307411_10108347 3300032005 Bacteria 1982
139 Ga0307411_10817834 3300032005 Bacteria 822
140 Ga0307415_100011390 3300032126 Bacteria 5086
141 Ga0307415_100216314 3300032126 Unclassified 1533
142 Ga0373947_0593530 3300035725 Unclassified 755
143 Ga0395899_0001189 3300037312 Bacteria 22938
144 Ga0395899_0025953 3300037312 Bacteria 4423
145 Ga0395899_0113796 3300037312 Bacteria 1943
146 Ga0395899_0392047 3300037312 Bacteria 921
147 Ga0395899_0400162 3300037312 Unclassified 909
148 Ga0395899_0786534 3300037312 Bacteria 589
149 Ga0395900_0000487 3300037418 Bacteria 56286
150 Ga0395900_0000915 3300037418 Bacteria 38815
151 Ga0395900_0001130 3300037418 Bacteria 33742
152 Ga0395900_0009253 3300037418 Bacteria 10100
153 Ga0395900_0009777 3300037418 Bacteria 9829
154 Ga0395900_0089817 3300037418 Bacteria 3158
155 Ga0395898_0040516 3300037466 Bacteria 4606
156 Ga0395898_0257472 3300037466 Bacteria 1664
157 Ga0395905_0000165 3300037471 Bacteria 109385
158 Ga0395905_0012804 3300037471 Bacteria 8066
159 Ga0395905_0034370 3300037471 Bacteria 4760
160 Ga0395905_0211684 3300037471 Bacteria 1816
161 Ga0395905_0532468 3300037471 Bacteria 1075
162 Ga0395905_0549021 3300037471 Bacteria 1057
163 Ga0395901_0000241 3300038443 Bacteria 68503
164 Ga0395901_0000692 3300038443 Bacteria 38579
165 Ga0395901_0000726 3300038443 Bacteria 37460
166 Ga0395901_0339990 3300038443 Bacteria 1551
167 Ga0395901_0740075 3300038443 Bacteria 977
168 Ga0439460_0000014 3300042461 Bacteria 25137
169 Ga0451577_0520449 3300042876 Bacteria 1080
170 Ga0453684_0053300 3300044712 Bacteria 5281
171 Ga0453684_0083469 3300044712 Bacteria 3976
172 Ga0453684_0214257 3300044712 Bacteria 2236
173 Ga0451576_0183080 3300045051 Bacteria 2187
174 Ga0495634_0152913 3300046642 Bacteria 1458
175 Ga0495649_0003973 3300046694 Bacteria 9762
176 Ga0495672_0072105 3300047320 Bacteria 1952
177 Ga0496106_0332590 3300048909 Bacteria 1220
178 Ga0501033_0209789 3300049570 Bacteria 1389
179 Ga0501047_0134476 3300049581 Bacteria 2353
180 Ga0501068_0060548 3300049584 Bacteria 2299
181 Ga0501202_011652 3300049652 Bacteria 1650
182 Ga0501216_008656 3300049660 Bacteria 1608
183 Ga0501217_015256 3300049661 Bacteria 1747
184 Ga0501223_036655 3300049663 Unclassified 953
185 Ga0501224_008139 3300049664 Bacteria 1528
186 Ga0501233_049589 3300049668 Bacteria 1013
187 Ga0501235_007377 3300049669 Bacteria 2395
188 Ga0501249_010444 3300049679 Bacteria 1944
189 Ga0501252_001239 3300049682 Bacteria 2301
190 Ga0501259_031548 3300049688 Bacteria 1003
191 Ga0501221_018718 3300049704 Bacteria 1336
192 Ga0501234_001063 3300049707 Bacteria 4339
193 Ga0501245_011083 3300049708 Bacteria 1308
194 Ga0501262_003717 3300049759 Bacteria 1759
195 Ga0501267_002267 3300049764 Bacteria 1714
196 Ga0501268_000951 3300049765 Bacteria 3423
197 Ga0501035_0114148 3300049822 Bacteria 2366
198 Ga0501044_0433356 3300049823 Bacteria 1223
199 nmdc:mga0k408_68886_c1 3300050493 Bacteria 1696
200 nmdc:mga09592_584831_c1 3300050508 Bacteria 957
201 nmdc:mga0qj67_273916_c1 3300050509 Bacteria 1368
202 Ga0500568_0006094 3300053139 Bacteria 6112
203 2555244693 2554235231 Bacteria 5215788
204 2599995616 2599185311 Bacteria 6354990
205 2600041710 2599185319 Bacteria 6637840
206 2600065174 2599185323 Bacteria 6688755
207 2808855005 2808606361 Bacteria 6136259
208 2808935661 2808606378 Bacteria 6177535
209 2808963644 2808606383 Bacteria 6138645
210 2808998398 2808606389 Bacteria 6138126
211 2929145996 2929144301 Bacteria 6622272
212 2931370667 2931369376 Bacteria 6847892
213 Ga0395900_0200522
214 MBSR1b_contig_461596
215 JGI25153J46596_10000894
216 Ga0055526_1010676
217 Ga0055530_10000225
218 Ga0065712_10071808
219 Ga0065715_10114238
220 Ga0070658_10000002
221 Ga0070676_10018468
222 Ga0070690_100014654
223 Ga0070670_100003986
224 Ga0070677_10000995
225 Ga0070666_10338364
226 Ga0070680_100034631
227 Ga0070660_100000379
228 Ga0070660_100137022
229 Ga0070668_100057248
230 Ga0070669_100004851
231 Ga0070675_100001908
232 Ga0070674_100087627
233 Ga0070673_100094120
234 Ga0070659_100040501
235 Ga0070659_100759727
236 Ga0070701_10091639
237 Ga0070705_100076465
238 Ga0070694_100888184
239 Ga0070663_100224517
240 Ga0070678_100072604
241 Ga0070662_100010188
242 Ga0068867_100045539
243 Ga0068867_100173742
244 Ga0070707_100201595
245 Ga0070698_100298773
246 Ga0070699_100327200
247 Ga0070672_100020849
248 Ga0070686_100042300
249 Ga0070665_100002891
250 Ga0070665_100073206
251 Ga0070704_100444209
252 Ga0070664_100603151
253 Ga0068857_100011302
254 Ga0068856_100885948
255 Ga0068859_100004337
256 Ga0068859_100101288
257 Ga0068859_100159017
258 Ga0068864_100014406
259 Ga0068864_100250771
260 Ga0068861_100205961
261 Ga0068858_100948023
262 Ga0068860_100156359
263 Ga0068860_100731651
264 Ga0075366_10058709
265 Ga0075428_100023112
266 Ga0075428_100160880
267 Ga0075434_100379229
268 Ga0075429_100220689
269 Ga0097620_100004337
270 Ga0097620_100101286
271 Ga0097620_100159008
272 Ga0105240_10573325
273 Ga0105247_10117004
274 Ga0114129_10018382
275 Ga0114129_10747642
276 Ga0114129_11095211
277 Ga0105248_10306540
278 Ga0105249_10103369
279 Ga0163162_11720919
280 Ga0157375_10390467
281 Ga0163163_10074837
282 Ga0157379_10504094
283 Ga0209565_1000107
284 Ga0209130_1057325
285 Ga0209564_1002204
286 Ga0209758_1000183
287 Ga0209050_1012640
288 Ga0207682_10001813
289 Ga0207680_10347307
290 Ga0207705_10000005
291 Ga0207705_10022860
292 Ga0207707_10234508
293 Ga0207660_10024529
294 Ga0207657_10000576
295 Ga0207657_10000749
296 Ga0207652_10095513
297 Ga0207646_10196254
298 Ga0207650_10032819
299 Ga0207659_10009575
300 Ga0207690_10026611
301 Ga0207690_10621261
302 Ga0207706_10017286
303 Ga0207669_10104281
304 Ga0207691_10096981
305 Ga0207711_10233882
306 Ga0207651_10816393
307 Ga0207668_10328339
308 Ga0207648_10305025
309 Ga0207676_10141673
310 Ga0207676_10298730
311 Ga0207674_10177231
312 Ga0209982_1009637
313 Ga0209974_10034307
314 Ga0268266_10158254
315 Ga0268265_10158699
316 Ga0307408_100000647
317 Ga0307408_100014260
318 Ga0307408_100014563
319 Ga0307408_100436279
320 Ga0307405_10039313
321 Ga0307405_10432219
322 Ga0307405_10547005
323 Ga0307413_10000062
324 Ga0307413_10002733
325 Ga0307413_10063649
326 Ga0307413_10134488
327 Ga0307413_10262290
328 Ga0307410_10007124
329 Ga0307410_10078698
330 Ga0307410_10119292
331 Ga0307410_10242961
332 Ga0307406_10014805
333 Ga0307406_10118056
334 Ga0307412_10008860
335 Ga0307412_10544010
336 Ga0307409_100000558
337 Ga0307409_100217235
338 Ga0307409_100456020
339 Ga0307409_100485602
340 Ga0307409_100722612
341 Ga0307416_100008336
342 Ga0307416_100021307
343 Ga0307416_100034645
344 Ga0307416_100160784
345 Ga0307414_10020714
346 Ga0307414_10914638
347 Ga0307411_10049836
348 Ga0307411_10053331
349 Ga0307411_10102877
350 Ga0307411_10108347
351 Ga0307411_10817834
352 Ga0307415_100011390
353 Ga0307415_100216314
354 Ga0373947_0593530
355 Ga0395899_0001189
356 Ga0395899_0025953
357 Ga0395899_0113796
358 Ga0395899_0392047
359 Ga0395899_0400162
360 Ga0395899_0786534
361 Ga0395900_0000487
362 Ga0395900_0000915
363 Ga0395900_0001130
364 Ga0395900_0009253
365 Ga0395900_0009777
366 Ga0395900_0089817
367 Ga0395898_0040516
368 Ga0395898_0257472
369 Ga0395905_0000165
370 Ga0395905_0012804
371 Ga0395905_0034370
372 Ga0395905_0211684
373 Ga0395905_0532468
374 Ga0395905_0549021
375 Ga0395901_0000241
376 Ga0395901_0000692
377 Ga0395901_0000726
378 Ga0395901_0339990
379 Ga0395901_0740075
380 Ga0439460_0000014
381 Ga0451577_0520449
382 Ga0453684_0053300
383 Ga0453684_0083469
384 Ga0453684_0214257
385 Ga0451576_0183080
386 Ga0495634_0152913
387 Ga0495649_0003973
388 Ga0495672_0072105
389 Ga0496106_0332590
390 Ga0501033_0209789
391 Ga0501047_0134476
392 Ga0501068_0060548
393 Ga0501202_011652
394 Ga0501216_008656
395 Ga0501217_015256
396 Ga0501223_036655
397 Ga0501224_008139
398 Ga0501233_049589
399 Ga0501235_007377
400 Ga0501249_010444
401 Ga0501252_001239
402 Ga0501259_031548
403 Ga0501221_018718
404 Ga0501234_001063
405 Ga0501245_011083
406 Ga0501262_003717
407 Ga0501267_002267
408 Ga0501268_000951
409 Ga0501035_0114148
410 Ga0501044_0433356
411 nmdc:mga0k408_68886_c1
412 nmdc:mga09592_584831_c1
413 nmdc:mga0qj67_273916_c1
414 Ga0500568_0006094
415 2555244693
416 2599995616
417 2600041710
418 2600065174
419 2808855005
420 2808935661
421 2808963644
422 2808998398
423 2929145996
424 2931370667

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

20

217

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wjz-assembly1.cif.gz_B crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.8903 1 200
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.8814 1 200
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.8777 2 202
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.8713 1 203
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.8671 1 203
ID Description Score Start End Superfamily
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9416 3 203 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9323 3 203 3.40.50.880
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9048 3 200 3.40.50.880
2wjzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8903 1 200 3.40.50.880
af_Q9SZ30_59_284_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8871 3 204 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2T5PBW5-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.973 4 203 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A1M3HEC1-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9717 3 202 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A5P8MXJ8-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9716 1 204 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A326RMH3-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9699 3 203 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A838NMG5-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9698 3 203 GO:0000105
GO:0000107
GO:0005737
GO:0006541
GO:0016787
GO:0016829

Map