F323083
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 212 | 145 | 424 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0200522|Ga0395900_0200522_1238_1903 |
| Length | 221 |
| Sequence | MLDSRACGNGGSWGVGLDVTIIDCGIGNIKSVLRMFQAADGSAEIIDRPEQLNGAKRVALPGVGAFDAGMSALAEGWIEPLNKLALERKVPVLGICLGMQLLCRKSDEGDLPGLGWIDADVTQLDIDGRSDLKLPHMGWSVVTPTGPNPLIPVEEPEQRFYHVHRYRVVCDREETVLATAEYGRPFTTAVRSDNIFGVQFHPEKSHRFGLGLMRRFLSFPC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 88 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 89 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 90 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 91 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 92 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 93 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 94 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 95 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 96 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 97 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 98 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 99 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 104 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 105 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 106 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 107 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 111 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 115 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 116 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 117 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 118 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 119 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 120 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 121 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 122 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 123 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 124 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 125 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 126 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 127 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 128 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 129 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 130 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 133 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 136 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 137 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 138 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 139 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 140 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 141 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 142 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 143 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 144 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 145 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.28 |
| Metatranscriptomes | 0 |
| Isolates | 4.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.19 |
| Nodule | 0 |
| Rhizoplane | 1.89 |
| Rhizosphere | 91.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0200522 | 3300037418 | Bacteria | 2019 |
| 2 | MBSR1b_contig_461596 | 2162886012 | Bacteria | 3034 |
| 3 | JGI25153J46596_10000894 | 3300003215 | Bacteria | 18140 |
| 4 | Ga0055526_1010676 | 3300003771 | Bacteria | 4242 |
| 5 | Ga0055530_10000225 | 3300003791 | Bacteria | 50204 |
| 6 | Ga0065712_10071808 | 3300005290 | Bacteria | 5043 |
| 7 | Ga0065715_10114238 | 3300005293 | Bacteria | 2458 |
| 8 | Ga0070658_10000002 | 3300005327 | Bacteria | 637290 |
| 9 | Ga0070676_10018468 | 3300005328 | Bacteria | 3866 |
| 10 | Ga0070690_100014654 | 3300005330 | Bacteria | 4654 |
| 11 | Ga0070670_100003986 | 3300005331 | Bacteria | 12325 |
| 12 | Ga0070677_10000995 | 3300005333 | Bacteria | 9162 |
| 13 | Ga0070666_10338364 | 3300005335 | Bacteria | 1075 |
| 14 | Ga0070680_100034631 | 3300005336 | Unclassified | 4072 |
| 15 | Ga0070660_100000379 | 3300005339 | Bacteria | 29599 |
| 16 | Ga0070660_100137022 | 3300005339 | Bacteria | 1961 |
| 17 | Ga0070668_100057248 | 3300005347 | Bacteria | 3012 |
| 18 | Ga0070669_100004851 | 3300005353 | Bacteria | 9708 |
| 19 | Ga0070675_100001908 | 3300005354 | Bacteria | 15399 |
| 20 | Ga0070674_100087627 | 3300005356 | Bacteria | 2239 |
| 21 | Ga0070673_100094120 | 3300005364 | Bacteria | 2455 |
| 22 | Ga0070659_100040501 | 3300005366 | Bacteria | 3641 |
| 23 | Ga0070659_100759727 | 3300005366 | Bacteria | 841 |
| 24 | Ga0070701_10091639 | 3300005438 | Bacteria | 1666 |
| 25 | Ga0070705_100076465 | 3300005440 | Bacteria | 2042 |
| 26 | Ga0070694_100888184 | 3300005444 | Unclassified | 735 |
| 27 | Ga0070663_100224517 | 3300005455 | Bacteria | 1476 |
| 28 | Ga0070678_100072604 | 3300005456 | Unclassified | 2580 |
| 29 | Ga0070662_100010188 | 3300005457 | Bacteria | 6163 |
| 30 | Ga0068867_100045539 | 3300005459 | Bacteria | 3218 |
| 31 | Ga0068867_100173742 | 3300005459 | Bacteria | 1708 |
| 32 | Ga0070707_100201595 | 3300005468 | Unclassified | 1939 |
| 33 | Ga0070698_100298773 | 3300005471 | Bacteria | 1541 |
| 34 | Ga0070699_100327200 | 3300005518 | Bacteria | 1378 |
| 35 | Ga0070672_100020849 | 3300005543 | Bacteria | 4787 |
| 36 | Ga0070686_100042300 | 3300005544 | Bacteria | 2853 |
| 37 | Ga0070665_100002891 | 3300005548 | Bacteria | 18552 |
| 38 | Ga0070665_100073206 | 3300005548 | Unclassified | 3433 |
| 39 | Ga0070704_100444209 | 3300005549 | Bacteria | 1115 |
| 40 | Ga0070664_100603151 | 3300005564 | Bacteria | 1018 |
| 41 | Ga0068857_100011302 | 3300005577 | Bacteria | 7767 |
| 42 | Ga0068856_100885948 | 3300005614 | Unclassified | 911 |
| 43 | Ga0068859_100004337 | 3300005617 | Bacteria | 14464 |
| 44 | Ga0068859_100101288 | 3300005617 | Bacteria | 2937 |
| 45 | Ga0068859_100159017 | 3300005617 | Bacteria | 2338 |
| 46 | Ga0068864_100014406 | 3300005618 | Bacteria | 6568 |
| 47 | Ga0068864_100250771 | 3300005618 | Bacteria | 1643 |
| 48 | Ga0068861_100205961 | 3300005719 | Bacteria | 1654 |
| 49 | Ga0068858_100948023 | 3300005842 | Unclassified | 842 |
| 50 | Ga0068860_100156359 | 3300005843 | Bacteria | 2197 |
| 51 | Ga0068860_100731651 | 3300005843 | Bacteria | 1000 |
| 52 | Ga0075366_10058709 | 3300006195 | Bacteria | 2286 |
| 53 | Ga0075428_100023112 | 3300006844 | Bacteria | 6878 |
| 54 | Ga0075428_100160880 | 3300006844 | Bacteria | 2437 |
| 55 | Ga0075434_100379229 | 3300006871 | Bacteria | 1435 |
| 56 | Ga0075429_100220689 | 3300006880 | Unclassified | 1660 |
| 57 | Ga0097620_100004337 | 3300006931 | Bacteria | 14464 |
| 58 | Ga0097620_100101286 | 3300006931 | Bacteria | 2937 |
| 59 | Ga0097620_100159008 | 3300006931 | Bacteria | 2338 |
| 60 | Ga0105240_10573325 | 3300009093 | Bacteria | 1246 |
| 61 | Ga0105247_10117004 | 3300009101 | Bacteria | 1722 |
| 62 | Ga0114129_10018382 | 3300009147 | Bacteria | 9957 |
| 63 | Ga0114129_10747642 | 3300009147 | Bacteria | 1252 |
| 64 | Ga0114129_11095211 | 3300009147 | Bacteria | 998 |
| 65 | Ga0105248_10306540 | 3300009177 | Bacteria | 1788 |
| 66 | Ga0105249_10103369 | 3300009553 | Bacteria | 2683 |
| 67 | Ga0163162_11720919 | 3300013306 | Bacteria | 716 |
| 68 | Ga0157375_10390467 | 3300013308 | Unclassified | 1558 |
| 69 | Ga0163163_10074837 | 3300014325 | Bacteria | 3379 |
| 70 | Ga0157379_10504094 | 3300014968 | Bacteria | 1122 |
| 71 | Ga0209565_1000107 | 3300025263 | Bacteria | 120938 |
| 72 | Ga0209130_1057325 | 3300025284 | Unclassified | 687 |
| 73 | Ga0209564_1002204 | 3300025295 | Bacteria | 16261 |
| 74 | Ga0209758_1000183 | 3300025297 | Bacteria | 140623 |
| 75 | Ga0209050_1012640 | 3300025298 | Bacteria | 3845 |
| 76 | Ga0207682_10001813 | 3300025893 | Bacteria | 9767 |
| 77 | Ga0207680_10347307 | 3300025903 | Bacteria | 1042 |
| 78 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 79 | Ga0207705_10022860 | 3300025909 | Bacteria | 4457 |
| 80 | Ga0207707_10234508 | 3300025912 | Bacteria | 1596 |
| 81 | Ga0207660_10024529 | 3300025917 | Unclassified | 4084 |
| 82 | Ga0207657_10000576 | 3300025919 | Bacteria | 38985 |
| 83 | Ga0207657_10000749 | 3300025919 | Bacteria | 34403 |
| 84 | Ga0207652_10095513 | 3300025921 | Bacteria | 2619 |
| 85 | Ga0207646_10196254 | 3300025922 | Unclassified | 1823 |
| 86 | Ga0207650_10032819 | 3300025925 | Bacteria | 3757 |
| 87 | Ga0207659_10009575 | 3300025926 | Bacteria | 6059 |
| 88 | Ga0207690_10026611 | 3300025932 | Bacteria | 3644 |
| 89 | Ga0207690_10621261 | 3300025932 | Bacteria | 883 |
| 90 | Ga0207706_10017286 | 3300025933 | Bacteria | 6499 |
| 91 | Ga0207669_10104281 | 3300025937 | Bacteria | 1883 |
| 92 | Ga0207691_10096981 | 3300025940 | Bacteria | 2635 |
| 93 | Ga0207711_10233882 | 3300025941 | Bacteria | 1684 |
| 94 | Ga0207651_10816393 | 3300025960 | Unclassified | 827 |
| 95 | Ga0207668_10328339 | 3300025972 | Bacteria | 1272 |
| 96 | Ga0207648_10305025 | 3300026089 | Bacteria | 1429 |
| 97 | Ga0207676_10141673 | 3300026095 | Bacteria | 2059 |
| 98 | Ga0207676_10298730 | 3300026095 | Unclassified | 1469 |
| 99 | Ga0207674_10177231 | 3300026116 | Bacteria | 2084 |
| 100 | Ga0209982_1009637 | 3300027552 | Bacteria | 1429 |
| 101 | Ga0209974_10034307 | 3300027876 | Bacteria | 1685 |
| 102 | Ga0268266_10158254 | 3300028379 | Unclassified | 2048 |
| 103 | Ga0268265_10158699 | 3300028380 | Unclassified | 1918 |
| 104 | Ga0307408_100000647 | 3300031548 | Bacteria | 29240 |
| 105 | Ga0307408_100014260 | 3300031548 | Bacteria | 5279 |
| 106 | Ga0307408_100014563 | 3300031548 | Bacteria | 5226 |
| 107 | Ga0307408_100436279 | 3300031548 | Unclassified | 1133 |
| 108 | Ga0307405_10039313 | 3300031731 | Bacteria | 2858 |
| 109 | Ga0307405_10432219 | 3300031731 | Bacteria | 1039 |
| 110 | Ga0307405_10547005 | 3300031731 | Bacteria | 936 |
| 111 | Ga0307413_10000062 | 3300031824 | Bacteria | 27702 |
| 112 | Ga0307413_10002733 | 3300031824 | Bacteria | 7245 |
| 113 | Ga0307413_10063649 | 3300031824 | Bacteria | 2288 |
| 114 | Ga0307413_10134488 | 3300031824 | Bacteria | 1698 |
| 115 | Ga0307413_10262290 | 3300031824 | Bacteria | 1289 |
| 116 | Ga0307410_10007124 | 3300031852 | Bacteria | 6098 |
| 117 | Ga0307410_10078698 | 3300031852 | Unclassified | 2308 |
| 118 | Ga0307410_10119292 | 3300031852 | Bacteria | 1921 |
| 119 | Ga0307410_10242961 | 3300031852 | Bacteria | 1396 |
| 120 | Ga0307406_10014805 | 3300031901 | Bacteria | 4495 |
| 121 | Ga0307406_10118056 | 3300031901 | Bacteria | 1839 |
| 122 | Ga0307412_10008860 | 3300031911 | Bacteria | 5761 |
| 123 | Ga0307412_10544010 | 3300031911 | Bacteria | 974 |
| 124 | Ga0307409_100000558 | 3300031995 | Bacteria | 16206 |
| 125 | Ga0307409_100217235 | 3300031995 | Bacteria | 1723 |
| 126 | Ga0307409_100456020 | 3300031995 | Bacteria | 1235 |
| 127 | Ga0307409_100485602 | 3300031995 | Bacteria | 1200 |
| 128 | Ga0307409_100722612 | 3300031995 | Bacteria | 997 |
| 129 | Ga0307416_100008336 | 3300032002 | Bacteria | 6676 |
| 130 | Ga0307416_100021307 | 3300032002 | Bacteria | 4650 |
| 131 | Ga0307416_100034645 | 3300032002 | Bacteria | 3845 |
| 132 | Ga0307416_100160784 | 3300032002 | Bacteria | 2076 |
| 133 | Ga0307414_10020714 | 3300032004 | Bacteria | 4106 |
| 134 | Ga0307414_10914638 | 3300032004 | Bacteria | 805 |
| 135 | Ga0307411_10049836 | 3300032005 | Bacteria | 2724 |
| 136 | Ga0307411_10053331 | 3300032005 | Bacteria | 2649 |
| 137 | Ga0307411_10102877 | 3300032005 | Bacteria | 2025 |
| 138 | Ga0307411_10108347 | 3300032005 | Bacteria | 1982 |
| 139 | Ga0307411_10817834 | 3300032005 | Bacteria | 822 |
| 140 | Ga0307415_100011390 | 3300032126 | Bacteria | 5086 |
| 141 | Ga0307415_100216314 | 3300032126 | Unclassified | 1533 |
| 142 | Ga0373947_0593530 | 3300035725 | Unclassified | 755 |
| 143 | Ga0395899_0001189 | 3300037312 | Bacteria | 22938 |
| 144 | Ga0395899_0025953 | 3300037312 | Bacteria | 4423 |
| 145 | Ga0395899_0113796 | 3300037312 | Bacteria | 1943 |
| 146 | Ga0395899_0392047 | 3300037312 | Bacteria | 921 |
| 147 | Ga0395899_0400162 | 3300037312 | Unclassified | 909 |
| 148 | Ga0395899_0786534 | 3300037312 | Bacteria | 589 |
| 149 | Ga0395900_0000487 | 3300037418 | Bacteria | 56286 |
| 150 | Ga0395900_0000915 | 3300037418 | Bacteria | 38815 |
| 151 | Ga0395900_0001130 | 3300037418 | Bacteria | 33742 |
| 152 | Ga0395900_0009253 | 3300037418 | Bacteria | 10100 |
| 153 | Ga0395900_0009777 | 3300037418 | Bacteria | 9829 |
| 154 | Ga0395900_0089817 | 3300037418 | Bacteria | 3158 |
| 155 | Ga0395898_0040516 | 3300037466 | Bacteria | 4606 |
| 156 | Ga0395898_0257472 | 3300037466 | Bacteria | 1664 |
| 157 | Ga0395905_0000165 | 3300037471 | Bacteria | 109385 |
| 158 | Ga0395905_0012804 | 3300037471 | Bacteria | 8066 |
| 159 | Ga0395905_0034370 | 3300037471 | Bacteria | 4760 |
| 160 | Ga0395905_0211684 | 3300037471 | Bacteria | 1816 |
| 161 | Ga0395905_0532468 | 3300037471 | Bacteria | 1075 |
| 162 | Ga0395905_0549021 | 3300037471 | Bacteria | 1057 |
| 163 | Ga0395901_0000241 | 3300038443 | Bacteria | 68503 |
| 164 | Ga0395901_0000692 | 3300038443 | Bacteria | 38579 |
| 165 | Ga0395901_0000726 | 3300038443 | Bacteria | 37460 |
| 166 | Ga0395901_0339990 | 3300038443 | Bacteria | 1551 |
| 167 | Ga0395901_0740075 | 3300038443 | Bacteria | 977 |
| 168 | Ga0439460_0000014 | 3300042461 | Bacteria | 25137 |
| 169 | Ga0451577_0520449 | 3300042876 | Bacteria | 1080 |
| 170 | Ga0453684_0053300 | 3300044712 | Bacteria | 5281 |
| 171 | Ga0453684_0083469 | 3300044712 | Bacteria | 3976 |
| 172 | Ga0453684_0214257 | 3300044712 | Bacteria | 2236 |
| 173 | Ga0451576_0183080 | 3300045051 | Bacteria | 2187 |
| 174 | Ga0495634_0152913 | 3300046642 | Bacteria | 1458 |
| 175 | Ga0495649_0003973 | 3300046694 | Bacteria | 9762 |
| 176 | Ga0495672_0072105 | 3300047320 | Bacteria | 1952 |
| 177 | Ga0496106_0332590 | 3300048909 | Bacteria | 1220 |
| 178 | Ga0501033_0209789 | 3300049570 | Bacteria | 1389 |
| 179 | Ga0501047_0134476 | 3300049581 | Bacteria | 2353 |
| 180 | Ga0501068_0060548 | 3300049584 | Bacteria | 2299 |
| 181 | Ga0501202_011652 | 3300049652 | Bacteria | 1650 |
| 182 | Ga0501216_008656 | 3300049660 | Bacteria | 1608 |
| 183 | Ga0501217_015256 | 3300049661 | Bacteria | 1747 |
| 184 | Ga0501223_036655 | 3300049663 | Unclassified | 953 |
| 185 | Ga0501224_008139 | 3300049664 | Bacteria | 1528 |
| 186 | Ga0501233_049589 | 3300049668 | Bacteria | 1013 |
| 187 | Ga0501235_007377 | 3300049669 | Bacteria | 2395 |
| 188 | Ga0501249_010444 | 3300049679 | Bacteria | 1944 |
| 189 | Ga0501252_001239 | 3300049682 | Bacteria | 2301 |
| 190 | Ga0501259_031548 | 3300049688 | Bacteria | 1003 |
| 191 | Ga0501221_018718 | 3300049704 | Bacteria | 1336 |
| 192 | Ga0501234_001063 | 3300049707 | Bacteria | 4339 |
| 193 | Ga0501245_011083 | 3300049708 | Bacteria | 1308 |
| 194 | Ga0501262_003717 | 3300049759 | Bacteria | 1759 |
| 195 | Ga0501267_002267 | 3300049764 | Bacteria | 1714 |
| 196 | Ga0501268_000951 | 3300049765 | Bacteria | 3423 |
| 197 | Ga0501035_0114148 | 3300049822 | Bacteria | 2366 |
| 198 | Ga0501044_0433356 | 3300049823 | Bacteria | 1223 |
| 199 | nmdc:mga0k408_68886_c1 | 3300050493 | Bacteria | 1696 |
| 200 | nmdc:mga09592_584831_c1 | 3300050508 | Bacteria | 957 |
| 201 | nmdc:mga0qj67_273916_c1 | 3300050509 | Bacteria | 1368 |
| 202 | Ga0500568_0006094 | 3300053139 | Bacteria | 6112 |
| 203 | 2555244693 | 2554235231 | Bacteria | 5215788 |
| 204 | 2599995616 | 2599185311 | Bacteria | 6354990 |
| 205 | 2600041710 | 2599185319 | Bacteria | 6637840 |
| 206 | 2600065174 | 2599185323 | Bacteria | 6688755 |
| 207 | 2808855005 | 2808606361 | Bacteria | 6136259 |
| 208 | 2808935661 | 2808606378 | Bacteria | 6177535 |
| 209 | 2808963644 | 2808606383 | Bacteria | 6138645 |
| 210 | 2808998398 | 2808606389 | Bacteria | 6138126 |
| 211 | 2929145996 | 2929144301 | Bacteria | 6622272 |
| 212 | 2931370667 | 2931369376 | Bacteria | 6847892 |
| 213 | Ga0395900_0200522 | |||
| 214 | MBSR1b_contig_461596 | |||
| 215 | JGI25153J46596_10000894 | |||
| 216 | Ga0055526_1010676 | |||
| 217 | Ga0055530_10000225 | |||
| 218 | Ga0065712_10071808 | |||
| 219 | Ga0065715_10114238 | |||
| 220 | Ga0070658_10000002 | |||
| 221 | Ga0070676_10018468 | |||
| 222 | Ga0070690_100014654 | |||
| 223 | Ga0070670_100003986 | |||
| 224 | Ga0070677_10000995 | |||
| 225 | Ga0070666_10338364 | |||
| 226 | Ga0070680_100034631 | |||
| 227 | Ga0070660_100000379 | |||
| 228 | Ga0070660_100137022 | |||
| 229 | Ga0070668_100057248 | |||
| 230 | Ga0070669_100004851 | |||
| 231 | Ga0070675_100001908 | |||
| 232 | Ga0070674_100087627 | |||
| 233 | Ga0070673_100094120 | |||
| 234 | Ga0070659_100040501 | |||
| 235 | Ga0070659_100759727 | |||
| 236 | Ga0070701_10091639 | |||
| 237 | Ga0070705_100076465 | |||
| 238 | Ga0070694_100888184 | |||
| 239 | Ga0070663_100224517 | |||
| 240 | Ga0070678_100072604 | |||
| 241 | Ga0070662_100010188 | |||
| 242 | Ga0068867_100045539 | |||
| 243 | Ga0068867_100173742 | |||
| 244 | Ga0070707_100201595 | |||
| 245 | Ga0070698_100298773 | |||
| 246 | Ga0070699_100327200 | |||
| 247 | Ga0070672_100020849 | |||
| 248 | Ga0070686_100042300 | |||
| 249 | Ga0070665_100002891 | |||
| 250 | Ga0070665_100073206 | |||
| 251 | Ga0070704_100444209 | |||
| 252 | Ga0070664_100603151 | |||
| 253 | Ga0068857_100011302 | |||
| 254 | Ga0068856_100885948 | |||
| 255 | Ga0068859_100004337 | |||
| 256 | Ga0068859_100101288 | |||
| 257 | Ga0068859_100159017 | |||
| 258 | Ga0068864_100014406 | |||
| 259 | Ga0068864_100250771 | |||
| 260 | Ga0068861_100205961 | |||
| 261 | Ga0068858_100948023 | |||
| 262 | Ga0068860_100156359 | |||
| 263 | Ga0068860_100731651 | |||
| 264 | Ga0075366_10058709 | |||
| 265 | Ga0075428_100023112 | |||
| 266 | Ga0075428_100160880 | |||
| 267 | Ga0075434_100379229 | |||
| 268 | Ga0075429_100220689 | |||
| 269 | Ga0097620_100004337 | |||
| 270 | Ga0097620_100101286 | |||
| 271 | Ga0097620_100159008 | |||
| 272 | Ga0105240_10573325 | |||
| 273 | Ga0105247_10117004 | |||
| 274 | Ga0114129_10018382 | |||
| 275 | Ga0114129_10747642 | |||
| 276 | Ga0114129_11095211 | |||
| 277 | Ga0105248_10306540 | |||
| 278 | Ga0105249_10103369 | |||
| 279 | Ga0163162_11720919 | |||
| 280 | Ga0157375_10390467 | |||
| 281 | Ga0163163_10074837 | |||
| 282 | Ga0157379_10504094 | |||
| 283 | Ga0209565_1000107 | |||
| 284 | Ga0209130_1057325 | |||
| 285 | Ga0209564_1002204 | |||
| 286 | Ga0209758_1000183 | |||
| 287 | Ga0209050_1012640 | |||
| 288 | Ga0207682_10001813 | |||
| 289 | Ga0207680_10347307 | |||
| 290 | Ga0207705_10000005 | |||
| 291 | Ga0207705_10022860 | |||
| 292 | Ga0207707_10234508 | |||
| 293 | Ga0207660_10024529 | |||
| 294 | Ga0207657_10000576 | |||
| 295 | Ga0207657_10000749 | |||
| 296 | Ga0207652_10095513 | |||
| 297 | Ga0207646_10196254 | |||
| 298 | Ga0207650_10032819 | |||
| 299 | Ga0207659_10009575 | |||
| 300 | Ga0207690_10026611 | |||
| 301 | Ga0207690_10621261 | |||
| 302 | Ga0207706_10017286 | |||
| 303 | Ga0207669_10104281 | |||
| 304 | Ga0207691_10096981 | |||
| 305 | Ga0207711_10233882 | |||
| 306 | Ga0207651_10816393 | |||
| 307 | Ga0207668_10328339 | |||
| 308 | Ga0207648_10305025 | |||
| 309 | Ga0207676_10141673 | |||
| 310 | Ga0207676_10298730 | |||
| 311 | Ga0207674_10177231 | |||
| 312 | Ga0209982_1009637 | |||
| 313 | Ga0209974_10034307 | |||
| 314 | Ga0268266_10158254 | |||
| 315 | Ga0268265_10158699 | |||
| 316 | Ga0307408_100000647 | |||
| 317 | Ga0307408_100014260 | |||
| 318 | Ga0307408_100014563 | |||
| 319 | Ga0307408_100436279 | |||
| 320 | Ga0307405_10039313 | |||
| 321 | Ga0307405_10432219 | |||
| 322 | Ga0307405_10547005 | |||
| 323 | Ga0307413_10000062 | |||
| 324 | Ga0307413_10002733 | |||
| 325 | Ga0307413_10063649 | |||
| 326 | Ga0307413_10134488 | |||
| 327 | Ga0307413_10262290 | |||
| 328 | Ga0307410_10007124 | |||
| 329 | Ga0307410_10078698 | |||
| 330 | Ga0307410_10119292 | |||
| 331 | Ga0307410_10242961 | |||
| 332 | Ga0307406_10014805 | |||
| 333 | Ga0307406_10118056 | |||
| 334 | Ga0307412_10008860 | |||
| 335 | Ga0307412_10544010 | |||
| 336 | Ga0307409_100000558 | |||
| 337 | Ga0307409_100217235 | |||
| 338 | Ga0307409_100456020 | |||
| 339 | Ga0307409_100485602 | |||
| 340 | Ga0307409_100722612 | |||
| 341 | Ga0307416_100008336 | |||
| 342 | Ga0307416_100021307 | |||
| 343 | Ga0307416_100034645 | |||
| 344 | Ga0307416_100160784 | |||
| 345 | Ga0307414_10020714 | |||
| 346 | Ga0307414_10914638 | |||
| 347 | Ga0307411_10049836 | |||
| 348 | Ga0307411_10053331 | |||
| 349 | Ga0307411_10102877 | |||
| 350 | Ga0307411_10108347 | |||
| 351 | Ga0307411_10817834 | |||
| 352 | Ga0307415_100011390 | |||
| 353 | Ga0307415_100216314 | |||
| 354 | Ga0373947_0593530 | |||
| 355 | Ga0395899_0001189 | |||
| 356 | Ga0395899_0025953 | |||
| 357 | Ga0395899_0113796 | |||
| 358 | Ga0395899_0392047 | |||
| 359 | Ga0395899_0400162 | |||
| 360 | Ga0395899_0786534 | |||
| 361 | Ga0395900_0000487 | |||
| 362 | Ga0395900_0000915 | |||
| 363 | Ga0395900_0001130 | |||
| 364 | Ga0395900_0009253 | |||
| 365 | Ga0395900_0009777 | |||
| 366 | Ga0395900_0089817 | |||
| 367 | Ga0395898_0040516 | |||
| 368 | Ga0395898_0257472 | |||
| 369 | Ga0395905_0000165 | |||
| 370 | Ga0395905_0012804 | |||
| 371 | Ga0395905_0034370 | |||
| 372 | Ga0395905_0211684 | |||
| 373 | Ga0395905_0532468 | |||
| 374 | Ga0395905_0549021 | |||
| 375 | Ga0395901_0000241 | |||
| 376 | Ga0395901_0000692 | |||
| 377 | Ga0395901_0000726 | |||
| 378 | Ga0395901_0339990 | |||
| 379 | Ga0395901_0740075 | |||
| 380 | Ga0439460_0000014 | |||
| 381 | Ga0451577_0520449 | |||
| 382 | Ga0453684_0053300 | |||
| 383 | Ga0453684_0083469 | |||
| 384 | Ga0453684_0214257 | |||
| 385 | Ga0451576_0183080 | |||
| 386 | Ga0495634_0152913 | |||
| 387 | Ga0495649_0003973 | |||
| 388 | Ga0495672_0072105 | |||
| 389 | Ga0496106_0332590 | |||
| 390 | Ga0501033_0209789 | |||
| 391 | Ga0501047_0134476 | |||
| 392 | Ga0501068_0060548 | |||
| 393 | Ga0501202_011652 | |||
| 394 | Ga0501216_008656 | |||
| 395 | Ga0501217_015256 | |||
| 396 | Ga0501223_036655 | |||
| 397 | Ga0501224_008139 | |||
| 398 | Ga0501233_049589 | |||
| 399 | Ga0501235_007377 | |||
| 400 | Ga0501249_010444 | |||
| 401 | Ga0501252_001239 | |||
| 402 | Ga0501259_031548 | |||
| 403 | Ga0501221_018718 | |||
| 404 | Ga0501234_001063 | |||
| 405 | Ga0501245_011083 | |||
| 406 | Ga0501262_003717 | |||
| 407 | Ga0501267_002267 | |||
| 408 | Ga0501268_000951 | |||
| 409 | Ga0501035_0114148 | |||
| 410 | Ga0501044_0433356 | |||
| 411 | nmdc:mga0k408_68886_c1 | |||
| 412 | nmdc:mga09592_584831_c1 | |||
| 413 | nmdc:mga0qj67_273916_c1 | |||
| 414 | Ga0500568_0006094 | |||
| 415 | 2555244693 | |||
| 416 | 2599995616 | |||
| 417 | 2600041710 | |||
| 418 | 2600065174 | |||
| 419 | 2808855005 | |||
| 420 | 2808935661 | |||
| 421 | 2808963644 | |||
| 422 | 2808998398 | |||
| 423 | 2929145996 | |||
| 424 | 2931370667 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wjz-assembly1.cif.gz_B | crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity | 0.8903 | 1 | 200 |
| 1ka9-assembly1.cif.gz_H | imidazole glycerol phosphate synthase | 0.8814 | 1 | 200 |
| 4gud-assembly2.cif.gz_B | crystal structure of amidotransferase hish from vibrio cholerae | 0.8777 | 2 | 202 |
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.8713 | 1 | 203 |
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.8671 | 1 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9416 | 3 | 203 | 3.40.50.880 |
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9323 | 3 | 203 | 3.40.50.880 |
| af_Q2FUU1_1_190_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9048 | 3 | 200 | 3.40.50.880 |
| 2wjzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8903 | 1 | 200 | 3.40.50.880 |
| af_Q9SZ30_59_284_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8871 | 3 | 204 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T5PBW5-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.973 | 4 | 203 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A1M3HEC1-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9717 | 3 | 202 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A5P8MXJ8-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9716 | 1 | 204 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A326RMH3-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9699 | 3 | 203 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A838NMG5-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9698 | 3 | 203 |
GO:0000105
GO:0000107 GO:0005737 GO:0006541 GO:0016787 GO:0016829 |