F322128

General Info

Members Datasets Scaffolds Average Seq Length
211 177 197 109

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0731274|Ga0501044_0731274_323_610
Length 95
Sequence VKHKPIVPRERANRDVDEAVAYYLSEAGEVVALGFIDALEKAYAHELNLPGLRVWPLTRYSHLVFYVERPDYIDVWRVLHGQRDIPTWMQEPDKV

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
3 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2721755523 Delftia sp. HK171 Isolate Unclassified
9 2738541307 Variovorax sp. GV008 Isolate Unclassified
10 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
11 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
12 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
92 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
97 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
102 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
103 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
105 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
108 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
109 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
112 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
115 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
177 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91
Metatranscriptomes 2.37
Isolates 6.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 0
Rhizoplane 9
Rhizosphere 68.72
Stem 0
Stem Tuber 0
Unclassified 13.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000050 3300002737 Bacteria 157157
2 JGI25163J39215_1000351 3300002771 Bacteria 15275
3 JGI25164J39214_1000025 3300002772 Bacteria 157157
4 JGI25165J46597_1000114 3300003214 Bacteria 144350
5 JGI25165J46597_1000176 3300003214 Bacteria 99160
6 Ga0070676_10411192 3300005328 Bacteria 943
7 Ga0070670_101932333 3300005331 Bacteria 543
8 Ga0068869_100692530 3300005334 Bacteria 868
9 Ga0070666_10636538 3300005335 Bacteria 780
10 Ga0070669_101145237 3300005353 Bacteria 671
11 Ga0070675_100239425 3300005354 Bacteria 1585
12 Ga0070674_100102915 3300005356 Bacteria 2084
13 Ga0070673_100175596 3300005364 Bacteria 1831
14 Ga0070673_100256149 3300005364 Bacteria 1527
15 Ga0070667_100038410 3300005367 Bacteria 4013
16 Ga0070678_100164173 3300005456 Bacteria 1803
17 Ga0070665_100417371 3300005548 Bacteria 1351
18 Ga0070665_100438486 3300005548 Bacteria 1315
19 Ga0068855_100137590 3300005563 Bacteria 2786
20 Ga0068852_100598155 3300005616 Unclassified 1107
21 Ga0075363_100765801 3300006048 Bacteria 585
22 Ga0070715_10253462 3300006163 Plasmid 921
23 Ga0075362_10010502 3300006177 Bacteria 3617
24 Ga0097621_100143090 3300006237 Bacteria 2045
25 Ga0075370_10249911 3300006353 Bacteria 1051
26 Ga0105251_10002368 3300009011 Bacteria 14912
27 Ga0105250_10003216 3300009092 Bacteria 7798
28 Ga0105240_10015235 3300009093 Bacteria 10461
29 Ga0105240_10632966 3300009093 Plasmid 1174
30 Ga0105243_10003115 3300009148 Bacteria 13624
31 Ga0105241_11515760 3300009174 Bacteria 646
32 Ga0105237_10398223 3300009545 Plasmid 1381
33 Ga0105238_10096731 3300009551 Bacteria 2938
34 Ga0105238_10194867 3300009551 Bacteria 2002
35 Ga0105238_12226716 3300009551 Unclassified 583
36 Ga0105033_105125 3300009986 Bacteria 1124
37 Ga0157370_10240541 3300013104 Bacteria 1675
38 Ga0157370_10519409 3300013104 Unclassified 1093
39 Ga0157369_10027832 3300013105 Bacteria 6262
40 Ga0163162_10145947 3300013306 Bacteria 2482
41 Ga0163162_11688052 3300013306 Bacteria 723
42 Ga0157372_10074965 3300013307 Bacteria 3816
43 Ga0163161_10478722 3300017792 Bacteria 1010
44 Ga0213874_10072306 3300021377 Bacteria 1102
45 Ga0213876_10248556 3300021384 Bacteria 945
46 Ga0209760_100033 3300025207 Bacteria 136583
47 Ga0207427_100003 3300025231 Bacteria 1035004
48 Ga0209437_100002 3300025233 Bacteria 1574801
49 Ga0209233_1000004 3300025261 Bacteria 1574798
50 Ga0207696_1005100 3300025711 Bacteria 5515
51 Ga0207655_1000006 3300025728 Bacteria 861092
52 Ga0207713_1007843 3300025735 Bacteria 6224
53 Ga0207680_10426838 3300025903 Bacteria 939
54 Ga0207645_10338483 3300025907 Bacteria 1005
55 Ga0207705_10322775 3300025909 Bacteria 1187
56 Ga0207695_10068939 3300025913 Bacteria 3622
57 Ga0207681_10762803 3300025923 Bacteria 807
58 Ga0207694_10200620 3300025924 Bacteria 1623
59 Ga0207694_10412554 3300025924 Bacteria 1124
60 Ga0207709_10000015 3300025935 Bacteria 493221
61 Ga0207669_10418960 3300025937 Bacteria 1053
62 Ga0207665_10034866 3300025939 Bacteria 3339
63 Ga0207667_10101443 3300025949 Bacteria 2968
64 Ga0207651_10262378 3300025960 Bacteria 1419
65 Ga0207651_10556152 3300025960 Bacteria 998
66 Ga0207651_12158403 3300025960 Bacteria 500
67 Ga0207658_10402595 3300025986 Bacteria 1203
68 Ga0207639_10996854 3300026041 Bacteria 784
69 Ga0207683_10361315 3300026121 Bacteria 1333
70 Ga0207698_10168192 3300026142 Unclassified 1927
71 Ga0268266_10502704 3300028379 Bacteria 1157
72 Ga0307509_10035585 3300031507 Bacteria 5464
73 Ga0307408_100354200 3300031548 Bacteria 1246
74 Ga0307508_10033509 3300031616 Bacteria 4636
75 Ga0307514_10302586 3300031649 Bacteria 894
76 Ga0316579_10123244 3300031691 Bacteria 1246
77 Ga0316576_10003477 3300031727 Bacteria 9240
78 Ga0316576_11019847 3300031727 Unclassified 589
79 Ga0316577_10000533 3300031733 Bacteria 15335
80 Ga0307406_10971055 3300031901 Bacteria 727
81 Ga0307414_10387104 3300032004 Bacteria 1211
82 Ga0316593_10056243 3300032168 Bacteria 1338
83 Ga0316593_10118223 3300032168 Bacteria 950
84 Ga0316592_1088614 3300033524 Bacteria 707
85 Ga0316588_1082591 3300033528 Bacteria 797
86 Ga0316596_1056929 3300033541 Bacteria 1040
87 Ga0373931_0027892 3300035691 Bacteria 2886
88 Ga0316584_0001957 3300036712 Bacteria 12850
89 Ga0395900_0004223 3300037418 Bacteria 15246
90 Ga0395900_0483766 3300037418 Bacteria 1190
91 Ga0395898_0000097 3300037466 Bacteria 230579
92 Ga0395898_0069578 3300037466 Bacteria 3405
93 Ga0395901_0491069 3300038443 Bacteria 1251
94 Ga0400484_19485 3300038725 Bacteria 1437
95 Ga0400483_127668 3300039062 Bacteria 1134
96 Ga0400483_164295 3300039062 Bacteria 1518
97 Ga0436365_1648926 3300039437 Bacteria 4212
98 Ga0436361_0440952 3300039447 Bacteria 1003
99 Ga0436361_1156390 3300039447 Plasmid 577
100 Ga0436363_1294194 3300039450 Bacteria 1975
101 Ga0439436_0000336 3300041404 Bacteria 11576
102 Ga0439447_014164 3300041407 Bacteria 2242
103 Ga0439466_0001464 3300041411 Bacteria 9211
104 Ga0439465_0000517 3300041413 Bacteria 11531
105 Ga0451797_1225709 3300041453 Bacteria 669
106 Ga0451802_1650845 3300041460 Unclassified 518
107 Ga0451802_1757398 3300041460 Bacteria 1007
108 Ga0451841_1076670 3300041498 Plasmid 524
109 Ga0451845_0801880 3300041501 Bacteria 736
110 Ga0451843_1351119 3300041509 Bacteria 772
111 Ga0439431_0002895 3300041997 Bacteria 3777
112 Ga0439433_0012710 3300041999 Bacteria 1847
113 Ga0439442_025196 3300042002 Bacteria 1237
114 Ga0439445_0009000 3300042004 Bacteria 2347
115 Ga0439432_000662 3300042006 Bacteria 12859
116 Ga0439449_0000838 3300042007 Bacteria 11916
117 Ga0439451_109066 3300042009 Plasmid 561
118 Ga0439452_000949 3300042010 Bacteria 13024
119 Ga0439462_0000328 3300042015 Bacteria 8874
120 Ga0450923_183344 3300042125 Bacteria 516
121 Ga0450893_0120439 3300042532 Plasmid 547
122 Ga0451577_0016710 3300042876 Bacteria 6786
123 Ga0451577_0038737 3300042876 Bacteria 4286
124 Ga0451577_0104053 3300042876 Bacteria 2537
125 Ga0451577_0978550 3300042876 Bacteria 760
126 Ga0466972_0223411 3300044658 Bacteria 881
127 Ga0466972_0296466 3300044658 Bacteria 756
128 Ga0466965_0176641 3300044683 Bacteria 1125
129 Ga0466964_0312764 3300044706 Bacteria 795
130 Ga0453684_0000071 3300044712 Bacteria 448904
131 Ga0453684_0121315 3300044712 Bacteria 3155
132 Ga0453684_0816602 3300044712 Bacteria 1004
133 Ga0466968_0028262 3300044735 Bacteria 2312
134 Ga0466957_0001220 3300044842 Bacteria 13416
135 Ga0466960_1032615 3300044901 Bacteria 506
136 Ga0451576_0000974 3300045051 Bacteria 53257
137 Ga0451576_1268115 3300045051 Bacteria 769
138 Ga0495627_003225 3300046453 Bacteria 7335
139 Ga0495650_0333329 3300046471 Unclassified 504
140 Ga0495580_0108314 3300046472 Bacteria 1929
141 Ga0495606_0186374 3300046507 Bacteria 1192
142 Ga0495648_0001535 3300046524 Bacteria 22582
143 Ga0495642_0034657 3300046528 Bacteria 2034
144 Ga0495642_0282069 3300046528 Bacteria 727
145 Ga0495668_0000026 3300046616 Bacteria 297287
146 Ga0495673_0328385 3300047469 Unclassified 543
147 Ga0496100_0769542 3300048903 Bacteria 753
148 Ga0496101_0236987 3300048904 Bacteria 1419
149 Ga0496102_0094579 3300048905 Bacteria 2769
150 Ga0496103_0040256 3300048906 Bacteria 2872
151 Ga0496104_0724267 3300048907 Bacteria 902
152 Ga0496105_0582316 3300048908 Bacteria 870
153 Ga0496106_0653410 3300048909 Bacteria 840
154 Ga0496107_0541265 3300048910 Bacteria 863
155 Ga0496110_1306588 3300048913 Bacteria 634
156 Ga0496111_1172790 3300048914 Bacteria 545
157 Ga0496112_0524837 3300048915 Bacteria 1119
158 Ga0496114_0049314 3300048917 Bacteria 3503
159 Ga0496114_0143755 3300048917 Bacteria 2067
160 Ga0496116_0003950 3300048919 Bacteria 14413
161 Ga0496116_0094722 3300048919 Bacteria 1804
162 Ga0496117_0278163 3300048920 Bacteria 898
163 Ga0496121_0062004 3300048924 Bacteria 3065
164 Ga0496122_0072339 3300048925 Bacteria 2452
165 Ga0496123_0013946 3300048926 Bacteria 6697
166 Ga0496124_0026989 3300048927 Bacteria 5167
167 Ga0496125_0017455 3300048928 Bacteria 6839
168 Ga0501033_1005331 3300049570 Bacteria 557
169 Ga0501034_0085593 3300049571 Bacteria 3153
170 Ga0501034_0805519 3300049571 Bacteria 832
171 Ga0501036_0020913 3300049572 Bacteria 5496
172 Ga0501037_1123623 3300049573 Bacteria 508
173 Ga0501039_0706642 3300049575 Bacteria 788
174 Ga0501040_0090837 3300049576 Bacteria 2123
175 Ga0501043_0008045 3300049579 Bacteria 8325
176 Ga0501047_0001953 3300049581 Bacteria 19818
177 Ga0501047_0584513 3300049581 Bacteria 939
178 Ga0501048_1161980 3300049582 Unclassified 555
179 Ga0501070_0405316 3300049586 Bacteria 1102
180 Ga0501072_0499862 3300049588 Bacteria 962
181 Ga0501074_0005047 3300049590 Bacteria 9468
182 Ga0501080_0073282 3300049742 Bacteria 3185
183 Ga0501080_0110660 3300049742 Bacteria 2546
184 Ga0501080_1512708 3300049742 Bacteria 570
185 Ga0501035_1321376 3300049822 Plasmid 555
186 Ga0501044_0310157 3300049823 Bacteria 1505
187 Ga0501044_0731274 3300049823 Bacteria 873
188 nmdc:mga03683_145775_c1 3300050489 Unclassified 1066
189 nmdc:mga03683_22580_c1 3300050489 Bacteria 2441
190 nmdc:mga03n38_18692_c1 3300050490 Bacteria 2740
191 nmdc:mga07m45_138567_c1 3300050496 Bacteria 1409
192 nmdc:mga09592_1515207_c1 3300050508 Unclassified 545
193 Ga0500644_0017402 3300053088 Bacteria 2087
194 Ga0500586_010606 3300053145 Bacteria 2608
195 Ga0501084_0276886 3300054114 Bacteria 1417
196 Ga0501082_0474836 3300060353 Bacteria 1093
197 Ga0530510_1258506 3300061734 Unclassified 567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_10478722 Ga0163161_104787221 88
2 3300049823 Ga0501044_0731274 Ga0501044_0731274_323_610 95
3 3300031727 Ga0316576_11019847 Ga0316576_110198471 97
4 iso_pu_bacteria 2868088558 2868088928 97
5 3300039437 Ga0436365_1648926 Ga0436365_1648926_3085_3381 98
6 3300053145 Ga0500586_010606 Ga0500586_010606_382_711 99
7 3300049571 Ga0501034_0805519 Ga0501034_0805519_494_796 100
8 iso_pu_bacteria 2643221650 2644282151 101
9 3300042009 Ga0439451_109066 Ga0439451_109066_198_515 104
10 3300042125 Ga0450923_183344 Ga0450923_183344_92_409 104
11 3300042532 Ga0450893_0120439 Ga0450893_0120439_11_328 104
12 3300025909 Ga0207705_10322775 Ga0207705_103227752 105
13 3300031548 Ga0307408_100354200 Ga0307408_1003542003 105
14 3300031901 Ga0307406_10971055 Ga0307406_109710551 105
15 3300042876 Ga0451577_0104053 Ga0451577_0104053_1856_2173 105
16 3300044712 Ga0453684_0000071 Ga0453684_0000071_177214_177531 105
17 3300049571 Ga0501034_0085593 Ga0501034_0085593_252_569 105
18 3300049572 Ga0501036_0020913 Ga0501036_0020913_3681_3998 105
19 3300049579 Ga0501043_0008045 Ga0501043_0008045_3775_4092 105
20 3300049581 Ga0501047_0001953 Ga0501047_0001953_2402_2719 105
21 3300049586 Ga0501070_0405316 Ga0501070_0405316_315_632 105
22 3300049590 Ga0501074_0005047 Ga0501074_0005047_175_492 105
23 3300049742 Ga0501080_0073282 Ga0501080_0073282_265_582 105
24 3300049822 Ga0501035_1321376 Ga0501035_1321376_153_470 105
25 3300054114 Ga0501084_0276886 Ga0501084_0276886_410_727 105
26 3300060353 Ga0501082_0474836 Ga0501082_0474836_275_592 105
27 iso_pu_bacteria 2599185292 2599905725 105
28 iso_pu_bacteria 2599185356 2600217422 105
29 iso_pu_bacteria 2600255313 2601777592 105
30 iso_pu_bacteria 2643221541 2643728514 105
31 iso_pu_bacteria 2643221606 2644046367 105
32 iso_pu_bacteria 2643221671 2644392248 105
33 iso_pu_bacteria 2721755523 2722882333 105
34 iso_pu_bacteria 2738541307 2738881055 105
35 iso_pu_bacteria 2821443989 2821445765 105
36 iso_pu_bacteria 2839138175 2839139920 105
37 iso_pu_bacteria 8019769354 8019775657 105
38 iso_pu_bacteria 8057798959 8057799658 105
39 3300009551 Ga0105238_12226716 Ga0105238_122267162 106
40 3300021377 Ga0213874_10072306 Ga0213874_100723063 106
41 3300035691 Ga0373931_0027892 Ga0373931_0027892_33_353 106
42 3300039450 Ga0436363_1294194 Ga0436363_1294194_960_1280 106
43 3300046472 Ga0495580_0108314 Ga0495580_0108314_422_745 106
44 3300046524 Ga0495648_0001535 Ga0495648_0001535_5674_5997 106
45 3300047469 Ga0495673_0328385 Ga0495673_0328385_156_479 106
46 3300053088 Ga0500644_0017402 Ga0500644_0017402_392_712 106
47 3300009551 Ga0105238_10096731 Ga0105238_100967314 107
48 3300025924 Ga0207694_10200620 Ga0207694_102006202 107
49 3300025960 Ga0207651_12158403 Ga0207651_121584032 107
50 3300044658 Ga0466972_0223411 Ga0466972_0223411_293_616 107
51 3300044706 Ga0466964_0312764 Ga0466964_0312764_402_725 107
52 3300044735 Ga0466968_0028262 Ga0466968_0028262_1742_2065 107
53 3300046528 Ga0495642_0282069 Ga0495642_0282069_209_532 107
54 3300049582 Ga0501048_1161980 Ga0501048_1161980_171_494 107
55 3300005563 Ga0068855_100137590 Ga0068855_1001375903 108
56 3300005616 Ga0068852_100598155 Ga0068852_1005981553 108
57 3300006353 Ga0075370_10249911 Ga0075370_102499113 108
58 3300009011 Ga0105251_10002368 Ga0105251_1000236817 108
59 3300009093 Ga0105240_10015235 Ga0105240_100152353 108
60 3300009174 Ga0105241_11515760 Ga0105241_115157602 108
61 3300009545 Ga0105237_10398223 Ga0105237_103982231 108
62 3300013104 Ga0157370_10519409 Ga0157370_105194092 108
63 3300013105 Ga0157369_10027832 Ga0157369_100278325 108
64 3300013307 Ga0157372_10074965 Ga0157372_100749652 108
65 3300021384 Ga0213876_10248556 Ga0213876_102485563 108
66 3300025728 Ga0207655_1000006 Ga0207655_1000006747 108
67 3300025735 Ga0207713_1007843 Ga0207713_10078438 108
68 3300025913 Ga0207695_10068939 Ga0207695_100689393 108
69 3300025923 Ga0207681_10762803 Ga0207681_107628032 108
70 3300025949 Ga0207667_10101443 Ga0207667_101014434 108
71 3300026142 Ga0207698_10168192 Ga0207698_101681923 108
72 3300037418 Ga0395900_0483766 Ga0395900_0483766_707_1033 108
73 3300037466 Ga0395898_0069578 Ga0395898_0069578_2627_2953 108
74 3300038443 Ga0395901_0491069 Ga0395901_0491069_363_689 108
75 3300046616 Ga0495668_0000026 Ga0495668_0000026_250172_250501 108
76 3300050489 nmdc:mga03683_145775_c1 nmdc:mga03683_145775_c1_166_492 108
77 3300050496 nmdc:mga07m45_138567_c1 nmdc:mga07m45_138567_c1_715_1041 108
78 3300050508 nmdc:mga09592_1515207_c1 nmdc:mga09592_1515207_c1_97_423 108
79 3300002737 JGI25162J39368_1000050 JGI25162J39368_100005051 109
80 3300002771 JGI25163J39215_1000351 JGI25163J39215_100035110 109
81 3300002772 JGI25164J39214_1000025 JGI25164J39214_1000025110 109
82 3300003214 JGI25165J46597_1000114 JGI25165J46597_1000114110 109
83 3300003214 JGI25165J46597_1000176 JGI25165J46597_100017652 109
84 3300005328 Ga0070676_10411192 Ga0070676_104111922 109
85 3300005331 Ga0070670_101932333 Ga0070670_1019323331 109
86 3300005334 Ga0068869_100692530 Ga0068869_1006925302 109
87 3300005335 Ga0070666_10636538 Ga0070666_106365381 109
88 3300005353 Ga0070669_101145237 Ga0070669_1011452372 109
89 3300005354 Ga0070675_100239425 Ga0070675_1002394252 109
90 3300005356 Ga0070674_100102915 Ga0070674_1001029151 109
91 3300005364 Ga0070673_100175596 Ga0070673_1001755963 109
92 3300005364 Ga0070673_100256149 Ga0070673_1002561494 109
93 3300005367 Ga0070667_100038410 Ga0070667_1000384106 109
94 3300005456 Ga0070678_100164173 Ga0070678_1001641734 109
95 3300005548 Ga0070665_100417371 Ga0070665_1004173712 109
96 3300005548 Ga0070665_100438486 Ga0070665_1004384863 109
97 3300006048 Ga0075363_100765801 Ga0075363_1007658011 109
98 3300006163 Ga0070715_10253462 Ga0070715_102534622 109
99 3300006177 Ga0075362_10010502 Ga0075362_100105024 109
100 3300006237 Ga0097621_100143090 Ga0097621_1001430903 109
101 3300009092 Ga0105250_10003216 Ga0105250_100032165 109
102 3300009093 Ga0105240_10632966 Ga0105240_106329663 109
103 3300009148 Ga0105243_10003115 Ga0105243_100031158 109
104 3300009551 Ga0105238_10194867 Ga0105238_101948673 109
105 3300009986 Ga0105033_105125 Ga0105033_1051251 109
106 3300013104 Ga0157370_10240541 Ga0157370_102405412 109
107 3300013306 Ga0163162_10145947 Ga0163162_101459472 109
108 3300013306 Ga0163162_11688052 Ga0163162_116880522 109
109 3300025207 Ga0209760_100033 Ga0209760_10003339 109
110 3300025231 Ga0207427_100003 Ga0207427_100003902 109
111 3300025233 Ga0209437_100002 Ga0209437_100002112 109
112 3300025261 Ga0209233_1000004 Ga0209233_10000041314 109
113 3300025711 Ga0207696_1005100 Ga0207696_10051003 109
114 3300025903 Ga0207680_10426838 Ga0207680_104268382 109
115 3300025907 Ga0207645_10338483 Ga0207645_103384832 109
116 3300025924 Ga0207694_10412554 Ga0207694_104125542 109
117 3300025935 Ga0207709_10000015 Ga0207709_10000015215 109
118 3300025937 Ga0207669_10418960 Ga0207669_104189601 109
119 3300025939 Ga0207665_10034866 Ga0207665_100348665 109
120 3300025960 Ga0207651_10262378 Ga0207651_102623782 109
121 3300025960 Ga0207651_10556152 Ga0207651_105561522 109
122 3300025986 Ga0207658_10402595 Ga0207658_104025952 109
123 3300026041 Ga0207639_10996854 Ga0207639_109968542 109
124 3300026121 Ga0207683_10361315 Ga0207683_103613153 109
125 3300028379 Ga0268266_10502704 Ga0268266_105027042 109
126 3300031507 Ga0307509_10035585 Ga0307509_100355855 109
127 3300031616 Ga0307508_10033509 Ga0307508_100335095 109
128 3300031649 Ga0307514_10302586 Ga0307514_103025862 109
129 3300031691 Ga0316579_10123244 Ga0316579_101232442 109
130 3300031727 Ga0316576_10003477 Ga0316576_100034772 109
131 3300031733 Ga0316577_10000533 Ga0316577_1000053314 109
132 3300032004 Ga0307414_10387104 Ga0307414_103871042 109
133 3300032168 Ga0316593_10056243 Ga0316593_100562433 109
134 3300032168 Ga0316593_10118223 Ga0316593_101182231 109
135 3300033524 Ga0316592_1088614 Ga0316592_10886141 109
136 3300033528 Ga0316588_1082591 Ga0316588_10825911 109
137 3300033541 Ga0316596_1056929 Ga0316596_10569292 109
138 3300036712 Ga0316584_0001957 Ga0316584_0001957_5033_5362 109
139 3300037418 Ga0395900_0004223 Ga0395900_0004223_6739_7068 109
140 3300037466 Ga0395898_0000097 Ga0395898_0000097_221980_222309 109
141 3300038725 Ga0400484_19485 Ga0400484_19485_589_918 109
142 3300039062 Ga0400483_127668 Ga0400483_127668_328_657 109
143 3300039062 Ga0400483_164295 Ga0400483_164295_751_1080 109
144 3300039447 Ga0436361_0440952 Ga0436361_0440952_351_680 109
145 3300039447 Ga0436361_1156390 Ga0436361_1156390_158_487 109
146 3300041404 Ga0439436_0000336 Ga0439436_0000336_5867_6199 109
147 3300041407 Ga0439447_014164 Ga0439447_014164_891_1223 109
148 3300041411 Ga0439466_0001464 Ga0439466_0001464_6851_7183 109
149 3300041413 Ga0439465_0000517 Ga0439465_0000517_8151_8483 109
150 3300041453 Ga0451797_1225709 Ga0451797_1225709_301_633 109
151 3300041460 Ga0451802_1650845 Ga0451802_1650845_23_370 109
152 3300041460 Ga0451802_1757398 Ga0451802_1757398_266_595 109
153 3300041498 Ga0451841_1076670 Ga0451841_1076670_162_494 109
154 3300041501 Ga0451845_0801880 Ga0451845_0801880_357_689 109
155 3300041509 Ga0451843_1351119 Ga0451843_1351119_264_611 109
156 3300041997 Ga0439431_0002895 Ga0439431_0002895_34_366 109
157 3300041999 Ga0439433_0012710 Ga0439433_0012710_1504_1836 109
158 3300042002 Ga0439442_025196 Ga0439442_025196_553_885 109
159 3300042004 Ga0439445_0009000 Ga0439445_0009000_447_779 109
160 3300042006 Ga0439432_000662 Ga0439432_000662_3359_3691 109
161 3300042007 Ga0439449_0000838 Ga0439449_0000838_5991_6323 109
162 3300042010 Ga0439452_000949 Ga0439452_000949_5338_5670 109
163 3300042015 Ga0439462_0000328 Ga0439462_0000328_3994_4326 109
164 3300042876 Ga0451577_0016710 Ga0451577_0016710_3067_3396 109
165 3300042876 Ga0451577_0038737 Ga0451577_0038737_1833_2165 109
166 3300042876 Ga0451577_0978550 Ga0451577_0978550_211_540 109
167 3300044658 Ga0466972_0296466 Ga0466972_0296466_386_730 109
168 3300044683 Ga0466965_0176641 Ga0466965_0176641_21_365 109
169 3300044712 Ga0453684_0121315 Ga0453684_0121315_734_1066 109
170 3300044712 Ga0453684_0816602 Ga0453684_0816602_415_744 109
171 3300044842 Ga0466957_0001220 Ga0466957_0001220_8011_8340 109
172 3300044901 Ga0466960_1032615 Ga0466960_1032615_128_457 109
173 3300045051 Ga0451576_0000974 Ga0451576_0000974_30378_30707 109
174 3300045051 Ga0451576_1268115 Ga0451576_1268115_296_625 109
175 3300046453 Ga0495627_003225 Ga0495627_003225_1533_1865 109
176 3300046471 Ga0495650_0333329 Ga0495650_0333329_39_386 109
177 3300046507 Ga0495606_0186374 Ga0495606_0186374_687_1019 109
178 3300046528 Ga0495642_0034657 Ga0495642_0034657_244_576 109
179 3300048903 Ga0496100_0769542 Ga0496100_0769542_21_353 109
180 3300048904 Ga0496101_0236987 Ga0496101_0236987_973_1305 109
181 3300048905 Ga0496102_0094579 Ga0496102_0094579_515_847 109
182 3300048906 Ga0496103_0040256 Ga0496103_0040256_2098_2430 109
183 3300048907 Ga0496104_0724267 Ga0496104_0724267_399_731 109
184 3300048908 Ga0496105_0582316 Ga0496105_0582316_268_600 109
185 3300048909 Ga0496106_0653410 Ga0496106_0653410_177_509 109
186 3300048910 Ga0496107_0541265 Ga0496107_0541265_90_422 109
187 3300048913 Ga0496110_1306588 Ga0496110_1306588_117_449 109
188 3300048914 Ga0496111_1172790 Ga0496111_1172790_199_531 109
189 3300048915 Ga0496112_0524837 Ga0496112_0524837_322_654 109
190 3300048917 Ga0496114_0049314 Ga0496114_0049314_850_1182 109
191 3300048917 Ga0496114_0143755 Ga0496114_0143755_588_917 109
192 3300048919 Ga0496116_0003950 Ga0496116_0003950_7282_7611 109
193 3300048919 Ga0496116_0094722 Ga0496116_0094722_322_651 109
194 3300048920 Ga0496117_0278163 Ga0496117_0278163_94_423 109
195 3300048924 Ga0496121_0062004 Ga0496121_0062004_506_835 109
196 3300048925 Ga0496122_0072339 Ga0496122_0072339_1803_2135 109
197 3300048926 Ga0496123_0013946 Ga0496123_0013946_1245_1577 109
198 3300048927 Ga0496124_0026989 Ga0496124_0026989_2383_2712 109
199 3300048928 Ga0496125_0017455 Ga0496125_0017455_2090_2419 109
200 3300049570 Ga0501033_1005331 Ga0501033_1005331_165_494 109
201 3300049573 Ga0501037_1123623 Ga0501037_1123623_162_491 109
202 3300049575 Ga0501039_0706642 Ga0501039_0706642_242_574 109
203 3300049576 Ga0501040_0090837 Ga0501040_0090837_1123_1455 109
204 3300049581 Ga0501047_0584513 Ga0501047_0584513_336_665 109
205 3300049588 Ga0501072_0499862 Ga0501072_0499862_394_723 109
206 3300049742 Ga0501080_0110660 Ga0501080_0110660_1813_2142 109
207 3300049742 Ga0501080_1512708 Ga0501080_1512708_77_409 109
208 3300049823 Ga0501044_0310157 Ga0501044_0310157_1121_1450 109
209 3300050489 nmdc:mga03683_22580_c1 nmdc:mga03683_22580_c1_428_760 109
210 3300050490 nmdc:mga03n38_18692_c1 nmdc:mga03n38_18692_c1_1670_2002 109
211 3300061734 Ga0530510_1258506 Ga0530510_1258506_172_504 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

6

85

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ycu-assembly1.cif.gz_C-2 heterotetramer of antitoxin prpa together with toxin prpt from pseudoalteromonas rubra 0.8516 3 100
6xrw-assembly2.cif.gz_C chromosomal parde ta system from p. aeruginosa 0.8458 3 94
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.8434 2 100
5cze-assembly1.cif.gz_J crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.8374 4 100
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.8352 2 100
ID Description Score Start End Superfamily
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8606 5 100 3.30.2310.20
af_Q8T088_152_364_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.835 65 94 2.130.10.10
af_A0A2R8RLT5_222_342_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8167 66 95 2.30.29.30
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.815 1 98 3.30.2310.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8108 5 100 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A534E6Y1-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9663 1 84
AF-A0A0S4U0F7-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9388 1 103
AF-A0A2A2B0J1-F1-model_v4 Plasmid stabilization protein 0.9383 1 103
AF-A0A7X4AC99-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9314 1 94
AF-A0A522J9M2-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9303 1 106

Feature Viewer

pLDDT pTM Quality
87.43 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map