F320498

General Info

Members Datasets Scaffolds Average Seq Length
210 154 210 495

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1000234|Ga0265337_100023416
Length 539
Sequence MNIALLLEMAADGAGERVALGPRSGGASYRELLRLARNSGEWLASQPGQRAGLLDGNSAAVPLLLFGSALAGKAFAPVSYRLAAASLHAVLERFGPGVLVTAPDAALPVPLPGGLVVKAREQFLREVRRGAAGPSTRIPAAEDIAALLFTSGTTGAPKTAVLRQRQLAAYIIGTVEFLSAEPGEAALISVPPYHIAGISAILSSVYAGRRIVQLDAFEPRAWVRLVNEESVTHAMVVPTMLTRILDVLLADGERLPSLRHLSYGGGRMPSKTIETALRLLPHVDFVNAYGLTETSSTIAVLDPEDHRRFAAGGXAGRRRLNSVGRPLPGVRIEIRGPGGKAVGPGVSGEVFVRGEQVSGEYLDGARLDDGWFATRDAGYLDADGYLFLDGRLDDIIVRGGENLSPGEIEDVLLEHPAVREVAVVGLPDPEWGERVVAVVVPAAGAAQDAAVLQRWVRERLRGSRTPSRVEFVPSLPYTETGKLLRRQVRDQIHVRLAAIIIGLDQLSDARTRSRRPSATVGNRARDRGRNCLVTGCCVT

Samples

Sample ID Description Type Environment
1 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
80 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
148 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
149 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
150 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
151 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
152 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
153 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
154 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.1
Nodule 0
Rhizoplane 3.33
Rhizosphere 80.48
Stem 0
Stem Tuber 0
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10008779 3300003791 Bacteria 3992
2 Ga0055531_10018752 3300003794 Bacteria 2839
3 Ga0065165_1001150 3300005262 Bacteria 30970
4 Ga0065707_10082851 3300005295 Bacteria 11736
5 Ga0070670_100143624 3300005331 Bacteria 2064
6 Ga0070668_100001718 3300005347 Bacteria 15910
7 Ga0070668_100009455 3300005347 Bacteria 7232
8 Ga0070667_100011416 3300005367 Bacteria 7345
9 Ga0070709_10025678 3300005434 Bacteria 3483
10 Ga0070681_10002532 3300005458 Bacteria 16751
11 Ga0070706_100014490 3300005467 Bacteria 7283
12 Ga0070665_100000819 3300005548 Bacteria 40675
13 Ga0068855_100030988 3300005563 Bacteria 6391
14 Ga0068855_100036691 3300005563 Bacteria 5831
15 Ga0068855_100111355 3300005563 Bacteria 3143
16 Ga0068856_100209153 3300005614 Bacteria 1966
17 Ga0068864_100000139 3300005618 Bacteria 69907
18 Ga0068864_100000169 3300005618 Bacteria 60005
19 Ga0068863_100000191 3300005841 Bacteria 65293
20 Ga0068863_100000218 3300005841 Bacteria 61402
21 Ga0068858_100000020 3300005842 Bacteria 175896
22 Ga0068858_100000107 3300005842 Bacteria 87216
23 Ga0068858_100001764 3300005842 Bacteria 22065
24 Ga0068860_100000109 3300005843 Bacteria 132169
25 Ga0068860_100012334 3300005843 Bacteria 8421
26 Ga0068862_100056092 3300005844 Bacteria 3375
27 Ga0068862_100067716 3300005844 Bacteria 3079
28 Ga0081539_10017625 3300005985 Bacteria 5002
29 Ga0075428_100030618 3300006844 Bacteria 5950
30 Ga0075431_100013775 3300006847 Bacteria 8167
31 Ga0075435_100039368 3300007076 Bacteria 3772
32 Ga0105240_10006856 3300009093 Bacteria 16651
33 Ga0105240_10020596 3300009093 Bacteria 8792
34 Ga0105240_10116584 3300009093 Bacteria 3222
35 Ga0111539_10048832 3300009094 Bacteria 5050
36 Ga0111539_10131484 3300009094 Bacteria 2931
37 Ga0105241_10009484 3300009174 Bacteria 7148
38 Ga0105248_10205525 3300009177 Bacteria 2219
39 Ga0105237_10083104 3300009545 Bacteria 3194
40 Ga0105237_10193940 3300009545 Bacteria 2031
41 Ga0105238_10013219 3300009551 Bacteria 8328
42 Ga0105238_10111456 3300009551 Bacteria 2716
43 Ga0105239_10063077 3300010375 Bacteria 4068
44 Ga0157369_10234341 3300013105 Bacteria 1919
45 Ga0157372_10133180 3300013307 Bacteria 2861
46 Ga0163163_10198794 3300014325 Bacteria 2053
47 Ga0163163_10209173 3300014325 Bacteria 2000
48 Ga0157380_10000346 3300014326 Bacteria 27776
49 Ga0157379_10033589 3300014968 Bacteria 4575
50 Ga0209758_1001199 3300025297 Bacteria 32733
51 Ga0209050_1000810 3300025298 Bacteria 44010
52 Ga0209257_1000842 3300025304 Bacteria 44039
53 Ga0207697_10031187 3300025315 Bacteria 2181
54 Ga0207684_10010004 3300025910 Bacteria 8361
55 Ga0207707_10046803 3300025912 Bacteria 3768
56 Ga0207695_10016498 3300025913 Bacteria 8635
57 Ga0207695_10024795 3300025913 Bacteria 6733
58 Ga0207695_10043757 3300025913 Unclassified 4768
59 Ga0207695_10061381 3300025913 Bacteria 3885
60 Ga0207695_10072068 3300025913 Bacteria 3527
61 Ga0207671_10070350 3300025914 Bacteria 2608
62 Ga0207664_10066667 3300025929 Bacteria 2886
63 Ga0207711_10007867 3300025941 Bacteria 8916
64 Ga0207667_10071022 3300025949 Bacteria 3622
65 Ga0207667_10266863 3300025949 Bacteria 1750
66 Ga0207668_10000078 3300025972 Bacteria 73213
67 Ga0207668_10047739 3300025972 Bacteria 2933
68 Ga0207658_10073062 3300025986 Bacteria 2602
69 Ga0207703_10000146 3300026035 Bacteria 83180
70 Ga0207703_10000824 3300026035 Bacteria 30526
71 Ga0207641_10000019 3300026088 Bacteria 295899
72 Ga0207641_10000166 3300026088 Bacteria 93398
73 Ga0207676_10000686 3300026095 Bacteria 26793
74 Ga0207676_10000924 3300026095 Bacteria 22721
75 Ga0207675_100032689 3300026118 Bacteria 4846
76 Ga0207698_10029512 3300026142 Bacteria 3930
77 Ga0207698_10060287 3300026142 Bacteria 2950
78 Ga0207428_10170578 3300027907 Bacteria 1648
79 Ga0268266_10001114 3300028379 Bacteria 33574
80 Ga0268264_10000002 3300028381 Bacteria 1153045
81 Ga0268264_10005483 3300028381 Bacteria 10758
82 Ga0265337_1000234 3300028556 Bacteria 30013
83 Ga0265326_10009134 3300028558 Bacteria 2966
84 Ga0265319_1001561 3300028563 Bacteria 13484
85 Ga0265334_10000260 3300028573 Bacteria 29896
86 Ga0265323_10026758 3300028653 Bacteria 2172
87 Ga0265322_10004082 3300028654 Bacteria 4370
88 Ga0265338_10001140 3300028800 Bacteria 43976
89 Ga0265324_10001187 3300029957 Bacteria 15523
90 Ga0307511_10003807 3300030521 Bacteria 15449
91 Ga0307511_10029563 3300030521 Bacteria 4945
92 Ga0265332_10003692 3300031238 Bacteria 7327
93 Ga0265320_10008407 3300031240 Bacteria 6319
94 Ga0265320_10020376 3300031240 Bacteria 3597
95 Ga0265340_10002578 3300031247 Bacteria 10294
96 Ga0265339_10052434 3300031249 Bacteria 2222
97 Ga0265331_10006715 3300031250 Bacteria 6750
98 Ga0265327_10000008 3300031251 Bacteria 658870
99 Ga0265327_10000076 3300031251 Bacteria 212272
100 Ga0265327_10037629 3300031251 Bacteria 2647
101 Ga0265316_10003298 3300031344 Bacteria 16376
102 Ga0307513_10002875 3300031456 Bacteria 23588
103 Ga0307413_10010327 3300031824 Bacteria 4522
104 Ga0307410_10006665 3300031852 Bacteria 6250
105 Ga0307407_10020932 3300031903 Bacteria 3362
106 Ga0307409_100006747 3300031995 Bacteria 6790
107 Ga0307416_100107086 3300032002 Bacteria 2452
108 Ga0307411_10005437 3300032005 Bacteria 6257
109 Ga0373944_0016207 3300035089 Bacteria 2098
110 Ga0373923_0011305 3300035111 Bacteria 3271
111 Ga0373936_0007109 3300035113 Bacteria 4211
112 Ga0373956_0039777 3300035119 Bacteria 2085
113 Ga0373946_0006627 3300035171 Bacteria 4206
114 Ga0373933_0042908 3300035724 Bacteria 2674
115 Ga0373947_0012682 3300035725 Bacteria 4833
116 Ga0373937_0001606 3300036401 Bacteria 18984
117 Ga0373937_0018237 3300036401 Bacteria 6263
118 Ga0373937_0110316 3300036401 Bacteria 2559
119 Ga0373925_0001114 3300037068 Bacteria 23886
120 Ga0395899_0000083 3300037312 Bacteria 161878
121 Ga0395899_0006587 3300037312 Bacteria 8997
122 Ga0395900_0000004 3300037418 Bacteria 564908
123 Ga0395900_0000237 3300037418 Bacteria 86507
124 Ga0395898_0008176 3300037466 Bacteria 11073
125 Ga0395905_0006577 3300037471 Bacteria 11677
126 Ga0395905_0017657 3300037471 Bacteria 6772
127 Ga0395901_0000005 3300038443 Bacteria 544998
128 Ga0395901_0000028 3300038443 Bacteria 242653
129 Ga0436365_1154802 3300039437 Bacteria 5403
130 Ga0466972_0003226 3300044658 Bacteria 8094
131 Ga0466972_0044526 3300044658 Bacteria 2152
132 Ga0466961_0013076 3300044693 Bacteria 5310
133 Ga0451576_0022516 3300045051 Bacteria 6832
134 Ga0495629_0036347 3300046459 Bacteria 3477
135 Ga0495651_0146065 3300046462 Bacteria 1710
136 Ga0495653_0021976 3300046463 Bacteria 5163
137 Ga0495653_0113411 3300046463 Bacteria 1944
138 Ga0495582_0083235 3300046473 Bacteria 1778
139 Ga0495608_0034239 3300046511 Bacteria 3430
140 Ga0495608_0078522 3300046511 Bacteria 2147
141 Ga0495608_0088166 3300046511 Bacteria 2009
142 Ga0495628_0031385 3300046516 Bacteria 4298
143 Ga0495628_0117302 3300046516 Bacteria 2044
144 Ga0495630_0068664 3300046517 Bacteria 2666
145 Ga0495630_0151461 3300046517 Bacteria 1764
146 Ga0495640_0082479 3300046533 Bacteria 2135
147 Ga0495586_0065862 3300046535 Bacteria 1975
148 Ga0495587_0067353 3300046536 Bacteria 2087
149 Ga0495597_0001834 3300046542 Bacteria 14518
150 Ga0495645_0064745 3300046543 Bacteria 2645
151 Ga0495622_0008974 3300046557 Bacteria 4633
152 Ga0495667_0001628 3300046559 Bacteria 14874
153 Ga0495667_0060666 3300046559 Bacteria 2480
154 Ga0495668_0053913 3300046616 Bacteria 2223
155 Ga0495635_0003359 3300046663 Bacteria 11058
156 Ga0495657_0004764 3300046675 Bacteria 10815
157 Ga0495657_0071572 3300046675 Bacteria 2263
158 Ga0495613_0048577 3300046689 Bacteria 3134
159 Ga0495672_0000358 3300047320 Bacteria 58575
160 Ga0495680_0003871 3300047322 Bacteria 14478
161 Ga0495680_0014435 3300047322 Bacteria 6840
162 Ga0495675_0020657 3300047444 Bacteria 4192
163 Ga0495684_0006132 3300047471 Bacteria 9357
164 Ga0495684_0007895 3300047471 Bacteria 8230
165 Ga0495602_0011830 3300048088 Bacteria 9010
166 Ga0496101_0091052 3300048904 Bacteria 2269
167 Ga0496101_0125114 3300048904 Bacteria 1948
168 Ga0496103_0102671 3300048906 Bacteria 1811
169 Ga0496104_0104927 3300048907 Bacteria 2708
170 Ga0496107_0080877 3300048910 Bacteria 2370
171 Ga0496110_0095602 3300048913 Bacteria 2661
172 Ga0496112_0014215 3300048915 Bacteria 7377
173 Ga0496116_0103441 3300048919 Bacteria 1695
174 Ga0496117_0014083 3300048920 Bacteria 6915
175 Ga0496118_0014532 3300048921 Bacteria 7362
176 Ga0496118_0018300 3300048921 Bacteria 6326
177 Ga0496118_0039445 3300048921 Bacteria 3768
178 Ga0496119_0041792 3300048922 Bacteria 2914
179 Ga0496119_0071789 3300048922 Bacteria 2025
180 Ga0496121_0000009 3300048924 Bacteria 836971
181 Ga0496121_0000600 3300048924 Bacteria 67818
182 Ga0496126_0000048 3300048929 Bacteria 317977
183 Ga0496126_0001159 3300048929 Bacteria 43639
184 Ga0496126_0004993 3300048929 Bacteria 15466
185 Ga0496126_0013851 3300048929 Bacteria 8181
186 Ga0501034_0071331 3300049571 Bacteria 3483
187 Ga0501037_0060895 3300049573 Bacteria 2753
188 Ga0501046_0021700 3300049580 Bacteria 5297
189 Ga0501069_0000005 3300049585 Bacteria 189293
190 Ga0501070_0000001 3300049586 Bacteria 519187
191 Ga0501070_0034768 3300049586 Bacteria 4212
192 Ga0501080_0000809 3300049742 Bacteria 25504
193 nmdc:mga06r32_85033_c1 3300050510 Bacteria 3084
194 nmdc:mga08y16_15645_c1 3300050511 Bacteria 7977
195 nmdc:mga0rr50_185256_c1 3300050513 Bacteria 1703
196 Ga0495601_0027823 3300053077 Bacteria 3498
197 Ga0500635_0000042 3300053080 Bacteria 90313
198 Ga0495595_0022746 3300053084 Bacteria 2754
199 Ga0495619_0002740 3300053085 Bacteria 11508
200 Ga0495619_0021253 3300053085 Bacteria 4141
201 Ga0500647_0053895 3300053091 Bacteria 1935
202 Ga0500566_0026252 3300053094 Bacteria 3410
203 Ga0500555_002495 3300053103 Bacteria 5319
204 Ga0500595_006192 3300053119 Bacteria 5115
205 Ga0500608_034172 3300053122 Bacteria 2421
206 Ga0500590_003597 3300053148 Bacteria 7179
207 Ga0500603_009660 3300053150 Bacteria 2162
208 Ga0500637_0003313 3300053178 Bacteria 7406
209 Ga0500625_035336 3300053729 Bacteria 2367
210 Ga0500596_003442 3300053735 Bacteria 3010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0014532 Ga0496118_0014532_11_1231 401
2 3300048906 Ga0496103_0102671 Ga0496103_0102671_42_1358 431
3 3300007076 Ga0075435_100039368 Ga0075435_1000393685 440
4 3300050513 nmdc:mga0rr50_185256_c1 nmdc:mga0rr50_185256_c1_117_1523 444
5 3300046533 Ga0495640_0082479 Ga0495640_0082479_740_2119 454
6 3300049585 Ga0501069_0000005 Ga0501069_0000005_29541_31025 454
7 3300049586 Ga0501070_0000001 Ga0501070_0000001_498767_500251 454
8 3300049742 Ga0501080_0000809 Ga0501080_0000809_19160_20644 454
9 3300046675 Ga0495657_0071572 Ga0495657_0071572_841_2244 455
10 3300053085 Ga0495619_0002740 Ga0495619_0002740_10086_11489 455
11 3300005985 Ga0081539_10017625 Ga0081539_100176255 463
12 3300006844 Ga0075428_100030618 Ga0075428_1000306182 463
13 3300006847 Ga0075431_100013775 Ga0075431_1000137754 463
14 3300009545 Ga0105237_10083104 Ga0105237_100831042 464
15 3300009093 Ga0105240_10020596 Ga0105240_100205967 469
16 3300025913 Ga0207695_10072068 Ga0207695_100720682 469
17 3300036401 Ga0373937_0110316 Ga0373937_0110316_1089_2519 469
18 3300046463 Ga0495653_0113411 Ga0495653_0113411_435_1865 469
19 3300046511 Ga0495608_0088166 Ga0495608_0088166_552_1982 469
20 3300048904 Ga0496101_0091052 Ga0496101_0091052_348_1787 469
21 3300048907 Ga0496104_0104927 Ga0496104_0104927_439_1878 469
22 3300048910 Ga0496107_0080877 Ga0496107_0080877_368_1807 469
23 3300053085 Ga0495619_0021253 Ga0495619_0021253_2700_4130 469
24 3300005563 Ga0068855_100111355 Ga0068855_1001113552 470
25 3300009545 Ga0105237_10193940 Ga0105237_101939402 470
26 3300025914 Ga0207671_10070350 Ga0207671_100703502 470
27 3300025949 Ga0207667_10071022 Ga0207667_100710223 470
28 3300049571 Ga0501034_0071331 Ga0501034_0071331_1232_2674 470
29 3300049573 Ga0501037_0060895 Ga0501037_0060895_1097_2539 470
30 3300049580 Ga0501046_0021700 Ga0501046_0021700_1174_2616 470
31 3300049586 Ga0501070_0034768 Ga0501070_0034768_1353_2795 470
32 3300053091 Ga0500647_0053895 Ga0500647_0053895_16_1449 472
33 3300046517 Ga0495630_0068664 Ga0495630_0068664_156_1607 473
34 3300014968 Ga0157379_10033589 Ga0157379_100335893 474
35 3300046462 Ga0495651_0146065 Ga0495651_0146065_52_1506 474
36 3300046473 Ga0495582_0083235 Ga0495582_0083235_249_1709 474
37 3300046511 Ga0495608_0034239 Ga0495608_0034239_1104_2564 474
38 3300046516 Ga0495628_0031385 Ga0495628_0031385_2635_4095 474
39 3300046517 Ga0495630_0151461 Ga0495630_0151461_18_1478 474
40 3300046535 Ga0495586_0065862 Ga0495586_0065862_401_1861 474
41 3300046543 Ga0495645_0064745 Ga0495645_0064745_582_2042 474
42 3300046559 Ga0495667_0060666 Ga0495667_0060666_60_1520 474
43 3300046689 Ga0495613_0048577 Ga0495613_0048577_1489_2949 474
44 3300047322 Ga0495680_0014435 Ga0495680_0014435_2529_3989 474
45 3300047444 Ga0495675_0020657 Ga0495675_0020657_1828_3288 474
46 3300047471 Ga0495684_0007895 Ga0495684_0007895_3005_4465 474
47 3300053077 Ga0495601_0027823 Ga0495601_0027823_1702_3162 474
48 3300053084 Ga0495595_0022746 Ga0495595_0022746_1089_2549 474
49 3300037312 Ga0395899_0006587 Ga0395899_0006587_4822_6324 480
50 3300037418 Ga0395900_0000237 Ga0395900_0000237_82332_83834 480
51 3300037466 Ga0395898_0008176 Ga0395898_0008176_2641_4143 480
52 3300038443 Ga0395901_0000028 Ga0395901_0000028_238625_240127 480
53 3300009094 Ga0111539_10131484 Ga0111539_101314842 481
54 3300036401 Ga0373937_0001606 Ga0373937_0001606_6860_8362 481
55 3300037471 Ga0395905_0017657 Ga0395905_0017657_3798_5291 481
56 3300046536 Ga0495587_0067353 Ga0495587_0067353_168_1670 481
57 3300048088 Ga0495602_0011830 Ga0495602_0011830_6845_8347 481
58 3300005618 Ga0068864_100000139 Ga0068864_10000013932 482
59 3300005841 Ga0068863_100000218 Ga0068863_1000002187 482
60 3300005842 Ga0068858_100000107 Ga0068858_10000010732 482
61 3300014325 Ga0163163_10198794 Ga0163163_101987942 482
62 3300025913 Ga0207695_10043757 Ga0207695_100437572 482
63 3300026035 Ga0207703_10000146 Ga0207703_1000014661 482
64 3300026088 Ga0207641_10000019 Ga0207641_10000019159 482
65 3300026095 Ga0207676_10000924 Ga0207676_100009244 482
66 3300045051 Ga0451576_0022516 Ga0451576_0022516_4791_6260 482
67 3300005434 Ga0070709_10025678 Ga0070709_100256782 483
68 3300025929 Ga0207664_10066667 Ga0207664_100666673 483
69 3300047320 Ga0495672_0000358 Ga0495672_0000358_15489_16955 484
70 3300048929 Ga0496126_0004993 Ga0496126_0004993_5758_7236 484
71 3300044658 Ga0466972_0044526 Ga0466972_0044526_189_1658 485
72 3300044693 Ga0466961_0013076 Ga0466961_0013076_752_2239 485
73 3300048929 Ga0496126_0013851 Ga0496126_0013851_298_1800 485
74 3300035111 Ga0373923_0011305 Ga0373923_0011305_1728_3251 486
75 3300035113 Ga0373936_0007109 Ga0373936_0007109_1602_3125 486
76 3300035119 Ga0373956_0039777 Ga0373956_0039777_372_1895 486
77 3300035724 Ga0373933_0042908 Ga0373933_0042908_1037_2560 486
78 3300036401 Ga0373937_0018237 Ga0373937_0018237_3936_5459 486
79 3300046463 Ga0495653_0021976 Ga0495653_0021976_2863_4392 486
80 3300046516 Ga0495628_0117302 Ga0495628_0117302_491_2014 486
81 3300046559 Ga0495667_0001628 Ga0495667_0001628_1369_2892 486
82 3300046663 Ga0495635_0003359 Ga0495635_0003359_6586_8109 486
83 3300046675 Ga0495657_0004764 Ga0495657_0004764_5163_6686 486
84 3300047322 Ga0495680_0003871 Ga0495680_0003871_11969_13492 486
85 3300047471 Ga0495684_0006132 Ga0495684_0006132_3841_5364 486
86 3300005844 Ga0068862_100067716 Ga0068862_1000677162 488
87 3300031251 Ga0265327_10037629 Ga0265327_100376293 488
88 3300005563 Ga0068855_100030988 Ga0068855_1000309884 489
89 3300048929 Ga0496126_0000048 Ga0496126_0000048_237399_238904 489
90 3300005843 Ga0068860_100012334 Ga0068860_1000123344 490
91 3300028381 Ga0268264_10005483 Ga0268264_100054834 490
92 3300035089 Ga0373944_0016207 Ga0373944_0016207_508_1995 490
93 3300035171 Ga0373946_0006627 Ga0373946_0006627_1354_2841 490
94 3300037068 Ga0373925_0001114 Ga0373925_0001114_17694_19181 490
95 3300046542 Ga0495597_0001834 Ga0495597_0001834_196_1683 490
96 3300048920 Ga0496117_0014083 Ga0496117_0014083_5409_6896 490
97 3300053729 Ga0500625_035336 Ga0500625_035336_18_1505 490
98 3300053735 Ga0500596_003442 Ga0500596_003442_18_1505 490
99 3300005467 Ga0070706_100014490 Ga0070706_1000144902 491
100 3300009174 Ga0105241_10009484 Ga0105241_100094847 491
101 3300025910 Ga0207684_10010004 Ga0207684_100100045 491
102 3300026142 Ga0207698_10029512 Ga0207698_100295123 491
103 3300044658 Ga0466972_0003226 Ga0466972_0003226_477_1964 491
104 3300048921 Ga0496118_0039445 Ga0496118_0039445_1178_2674 491
105 3300050510 nmdc:mga06r32_85033_c1 nmdc:mga06r32_85033_c1_695_2203 491
106 3300031240 Ga0265320_10008407 Ga0265320_100084075 492
107 3300032002 Ga0307416_100107086 Ga0307416_1001070863 492
108 3300009094 Ga0111539_10048832 Ga0111539_100488323 493
109 3300027907 Ga0207428_10170578 Ga0207428_101705781 493
110 3300031251 Ga0265327_10000008 Ga0265327_10000008521 493
111 3300050511 nmdc:mga08y16_15645_c1 nmdc:mga08y16_15645_c1_4833_6335 493
112 3300028556 Ga0265337_1000234 Ga0265337_100023416 494
113 3300028558 Ga0265326_10009134 Ga0265326_100091343 494
114 3300028563 Ga0265319_1001561 Ga0265319_100156113 494
115 3300028573 Ga0265334_10000260 Ga0265334_1000026011 494
116 3300028653 Ga0265323_10026758 Ga0265323_100267581 494
117 3300028654 Ga0265322_10004082 Ga0265322_100040822 494
118 3300028800 Ga0265338_10001140 Ga0265338_100011404 494
119 3300029957 Ga0265324_10001187 Ga0265324_100011879 494
120 3300031238 Ga0265332_10003692 Ga0265332_100036925 494
121 3300031240 Ga0265320_10020376 Ga0265320_100203762 494
122 3300031247 Ga0265340_10002578 Ga0265340_100025783 494
123 3300031249 Ga0265339_10052434 Ga0265339_100524342 494
124 3300031344 Ga0265316_10003298 Ga0265316_100032985 494
125 3300031824 Ga0307413_10010327 Ga0307413_100103274 494
126 3300031852 Ga0307410_10006665 Ga0307410_100066655 494
127 3300031903 Ga0307407_10020932 Ga0307407_100209322 494
128 3300031995 Ga0307409_100006747 Ga0307409_1000067475 494
129 3300032005 Ga0307411_10005437 Ga0307411_100054372 494
130 3300035725 Ga0373947_0012682 Ga0373947_0012682_2985_4475 494
131 3300046616 Ga0495668_0053913 Ga0495668_0053913_419_1909 494
132 3300005347 Ga0070668_100009455 Ga0070668_1000094558 495
133 3300005563 Ga0068855_100036691 Ga0068855_1000366917 495
134 3300005843 Ga0068860_100000109 Ga0068860_10000010935 495
135 3300025972 Ga0207668_10047739 Ga0207668_100477392 495
136 3300028381 Ga0268264_10000002 Ga0268264_10000002586 495
137 3300046511 Ga0495608_0078522 Ga0495608_0078522_101_1597 495
138 3300005842 Ga0068858_100001764 Ga0068858_1000017647 496
139 3300025315 Ga0207697_10031187 Ga0207697_100311872 496
140 3300030521 Ga0307511_10029563 Ga0307511_100295634 496
141 3300048913 Ga0496110_0095602 Ga0496110_0095602_290_1789 496
142 3300048929 Ga0496126_0001159 Ga0496126_0001159_41516_43015 496
143 3300053119 Ga0500595_006192 Ga0500595_006192_3294_4790 496
144 3300005295 Ga0065707_10082851 Ga0065707_100828512 497
145 3300005458 Ga0070681_10002532 Ga0070681_1000253214 497
146 3300005614 Ga0068856_100209153 Ga0068856_1002091531 497
147 3300009093 Ga0105240_10006856 Ga0105240_1000685613 497
148 3300010375 Ga0105239_10063077 Ga0105239_100630772 497
149 3300013105 Ga0157369_10234341 Ga0157369_102343412 497
150 3300013307 Ga0157372_10133180 Ga0157372_101331802 497
151 3300014326 Ga0157380_10000346 Ga0157380_100003462 497
152 3300025912 Ga0207707_10046803 Ga0207707_100468033 497
153 3300025913 Ga0207695_10024795 Ga0207695_100247954 497
154 3300025913 Ga0207695_10061381 Ga0207695_100613813 497
155 3300025949 Ga0207667_10266863 Ga0207667_102668631 497
156 3300026142 Ga0207698_10060287 Ga0207698_100602873 497
157 3300031250 Ga0265331_10006715 Ga0265331_100067153 497
158 3300031251 Ga0265327_10000076 Ga0265327_1000007670 497
159 3300048915 Ga0496112_0014215 Ga0496112_0014215_1332_2840 497
160 3300003791 Ga0055530_10008779 Ga0055530_100087793 498
161 3300003794 Ga0055531_10018752 Ga0055531_100187524 498
162 3300005262 Ga0065165_1001150 Ga0065165_10011503 498
163 3300005331 Ga0070670_100143624 Ga0070670_1001436241 498
164 3300005347 Ga0070668_100001718 Ga0070668_1000017184 498
165 3300005367 Ga0070667_100011416 Ga0070667_1000114162 498
166 3300005548 Ga0070665_100000819 Ga0070665_1000008193 498
167 3300005618 Ga0068864_100000169 Ga0068864_10000016943 498
168 3300005841 Ga0068863_100000191 Ga0068863_10000019114 498
169 3300005842 Ga0068858_100000020 Ga0068858_1000000209 498
170 3300005844 Ga0068862_100056092 Ga0068862_1000560923 498
171 3300009093 Ga0105240_10116584 Ga0105240_101165842 498
172 3300009177 Ga0105248_10205525 Ga0105248_102055252 498
173 3300009551 Ga0105238_10013219 Ga0105238_100132197 498
174 3300009551 Ga0105238_10111456 Ga0105238_101114562 498
175 3300014325 Ga0163163_10209173 Ga0163163_102091732 498
176 3300025297 Ga0209758_1001199 Ga0209758_10011994 498
177 3300025298 Ga0209050_1000810 Ga0209050_100081045 498
178 3300025304 Ga0209257_1000842 Ga0209257_10008424 498
179 3300025913 Ga0207695_10016498 Ga0207695_100164988 498
180 3300025941 Ga0207711_10007867 Ga0207711_100078675 498
181 3300025972 Ga0207668_10000078 Ga0207668_1000007849 498
182 3300025986 Ga0207658_10073062 Ga0207658_100730622 498
183 3300026035 Ga0207703_10000824 Ga0207703_1000082414 498
184 3300026088 Ga0207641_10000166 Ga0207641_1000016669 498
185 3300026095 Ga0207676_10000686 Ga0207676_100006866 498
186 3300026118 Ga0207675_100032689 Ga0207675_1000326893 498
187 3300028379 Ga0268266_10001114 Ga0268266_1000111413 498
188 3300030521 Ga0307511_10003807 Ga0307511_100038074 498
189 3300031456 Ga0307513_10002875 Ga0307513_100028754 498
190 3300037312 Ga0395899_0000083 Ga0395899_0000083_62950_64458 498
191 3300037418 Ga0395900_0000004 Ga0395900_0000004_97184_98692 498
192 3300037471 Ga0395905_0006577 Ga0395905_0006577_10012_11520 498
193 3300038443 Ga0395901_0000005 Ga0395901_0000005_466886_468394 498
194 3300039437 Ga0436365_1154802 Ga0436365_1154802_1518_3029 498
195 3300046459 Ga0495629_0036347 Ga0495629_0036347_884_2395 498
196 3300046557 Ga0495622_0008974 Ga0495622_0008974_664_2175 498
197 3300048904 Ga0496101_0125114 Ga0496101_0125114_60_1571 498
198 3300048919 Ga0496116_0103441 Ga0496116_0103441_38_1549 498
199 3300048921 Ga0496118_0018300 Ga0496118_0018300_630_2141 498
200 3300048922 Ga0496119_0041792 Ga0496119_0041792_376_1887 498
201 3300048922 Ga0496119_0071789 Ga0496119_0071789_400_1911 498
202 3300048924 Ga0496121_0000009 Ga0496121_0000009_816582_818093 498
203 3300048924 Ga0496121_0000600 Ga0496121_0000600_22641_24152 498
204 3300053080 Ga0500635_0000042 Ga0500635_0000042_17288_18799 498
205 3300053094 Ga0500566_0026252 Ga0500566_0026252_657_2168 498
206 3300053103 Ga0500555_002495 Ga0500555_002495_1188_2699 498
207 3300053122 Ga0500608_034172 Ga0500608_034172_722_2233 498
208 3300053148 Ga0500590_003597 Ga0500590_003597_158_1669 498
209 3300053150 Ga0500603_009660 Ga0500603_009660_350_1861 498
210 3300053178 Ga0500637_0003313 Ga0500637_0003313_3876_5387 498

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

407

482

0.97

PF00501

AMP-binding

AMP-binding enzyme

7

362

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u5y-assembly1.cif.gz_D crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica 0.8804 404 497
5bus-assembly1.cif.gz_B o-succinylbenzoate coenzyme a synthetase (mene) from bacillus subtilis, in complex with amp 0.8593 6 394
5gtd-assembly1.cif.gz_B o-succinylbenzoate coa synthetase (mene) from bacillus subtilis in complex with the acyl-adenylate intermediate osb-amp 0.8592 6 391
5x8f-assembly1.cif.gz_A ternary complex structure of a double mutant i454ra456k of o-succinylbenzoate coa synthetase (mene) from bacillus subtilis bound with amp and its product analogue osb-ncoa at 1.76 angstrom 0.856 6 488
5x8g-assembly2.cif.gz_D binary complex structure of a double mutant i454ra456k of o-succinylbenzoate coa synthetase (mene) from bacillus subtilis bound with its product analogue osb-ncoa at 1.90 angstrom 0.8553 6 489
ID Description Score Start End Superfamily
af_Q2G2V3_396_492_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9766 393 488 3.30.300.30
af_P69451_456_557_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9697 394 490 3.30.300.30
af_P31552_422_517_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9685 395 488 3.30.300.30
5buqA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9671 394 473 3.30.300.30
af_P38137_433_538_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9614 394 492 3.30.300.30
ID Description Score Start End GO Terms
AF-A0A850DEG4-F1-model_v4 O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26) 0.9773 411 489 GO:0016877
AF-A0A257US53-F1-model_v4 AMP-binding enzyme C-terminal domain-containing protein 0.9498 390 491 GO:0006631
GO:0031956
AF-A0A3D5MRC7-F1-model_v4 AMP-binding enzyme C-terminal domain-containing protein 0.9454 391 490 GO:0016405
AF-A0A850DEG4-F1-model_v4 O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26) 0.9422 411 489 GO:0016877
AF-A0A838KQ73-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9174 391 492 GO:0016877

Feature Viewer

pLDDT pTM Quality
89.27 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map