F319420

General Info

Members Datasets Scaffolds Average Seq Length
209 162 204 335

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0000002|Ga0466965_0000002_217099_218244
Length 381
Sequence MAASPAERPDDASGTPDADGPLDVTGATGMAPASLNVGPHVKSIGFLSFGHWSSSPGSQARSASDVLLQSIDLAVAAEELGADGAYFRVHHYARQLASPFPLLAAAGAKTSRIELGTGVIDMRYENPLYMAEDAGAADLIAGGRLQLGVSRGSPEQVIDGWRYFGYDAPAGQSMADVARANTEVLLKVIDGARFAEPNPRPMFPXXXPGLLGIEPQSPGLRDRIWWGAGSDATAVWAAQQGMNLMSSTLKEDESGEPFHVQQRKQIEAFHAAWADAGHERVPRVSVSRSIFAIVDDRDHMYFGGGQRDEHDQFGQLDDYRAVFGRSYAAEPDVLVEQLREDEAIAAADTLLLTVPNQLGVDYNAHVLESILTHVAPPLGWR

Samples

Sample ID Description Type Environment
1 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
2 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
3 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
4 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
5 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
87 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
150 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
155 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0.48
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.97
Nodule 0.48
Rhizoplane 7.66
Rhizosphere 64.59
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10013011 3300002067 Bacteria 2623
2 JGI24738J21930_10028470 3300002075 Bacteria 1143
3 JGI25162J39368_1000766 3300002737 Bacteria 21719
4 JGI25165J46597_1000958 3300003214 Bacteria 19665
5 Ga0055539_1000008 3300003752 Bacteria 537665
6 Ga0055533_1000001 3300003756 Bacteria 1863437
7 Ga0055525_1000489 3300003759 Bacteria 20528
8 Ga0055541_1005619 3300003841 Bacteria 2180
9 Ga0070683_100225272 3300005329 Bacteria 1782
10 Ga0070675_100178786 3300005354 Bacteria 1833
11 Ga0070703_10029054 3300005406 Bacteria 1656
12 Ga0070709_10045545 3300005434 Bacteria 2723
13 Ga0070711_100032335 3300005439 Bacteria 3478
14 Ga0070700_100209309 3300005441 Bacteria 1375
15 Ga0070681_10058927 3300005458 Bacteria 3819
16 Ga0070681_10310103 3300005458 Bacteria 1487
17 Ga0070684_100092600 3300005535 Bacteria 2690
18 Ga0070664_100048587 3300005564 Bacteria 3585
19 Ga0070664_100092888 3300005564 Bacteria 2614
20 Ga0070664_100241136 3300005564 Bacteria 1623
21 Ga0068857_100016654 3300005577 Bacteria 6440
22 Ga0068857_100090058 3300005577 Bacteria 2745
23 Ga0068859_100423221 3300005617 Bacteria 1428
24 Ga0068864_100442954 3300005618 Bacteria 1241
25 Ga0068863_100204906 3300005841 Bacteria 1898
26 Ga0068860_100000301 3300005843 Bacteria 68703
27 Ga0068862_100125412 3300005844 Bacteria 2266
28 Ga0075365_10003412 3300006038 Bacteria 8178
29 Ga0075365_10033873 3300006038 Bacteria 3295
30 Ga0075368_10029501 3300006042 Bacteria 2121
31 Ga0075363_100001293 3300006048 Bacteria 9331
32 Ga0075363_100007064 3300006048 Bacteria 5134
33 Ga0075364_10008351 3300006051 Bacteria 6185
34 Ga0075364_10037085 3300006051 Bacteria 3154
35 Ga0075364_10048148 3300006051 Bacteria 2777
36 Ga0075364_10171985 3300006051 Bacteria 1464
37 Ga0070715_10082540 3300006163 Bacteria 1462
38 Ga0070716_100168305 3300006173 Bacteria 1428
39 Ga0075362_10015647 3300006177 Bacteria 3089
40 Ga0075369_10007097 3300006186 Bacteria 4257
41 Ga0075436_100063277 3300006914 Bacteria 2557
42 Ga0097620_100423213 3300006931 Bacteria 1428
43 Ga0111539_10213655 3300009094 Bacteria 2247
44 Ga0111539_10357445 3300009094 Bacteria 1700
45 Ga0105248_10051229 3300009177 Bacteria 4633
46 Ga0105248_10166519 3300009177 Bacteria 2485
47 Ga0105246_10159988 3300011119 Bacteria 1714
48 Ga0157369_10051662 3300013105 Bacteria 4448
49 Ga0157369_10418578 3300013105 Bacteria 1389
50 Ga0157369_10500480 3300013105 Bacteria 1257
51 Ga0163163_10254812 3300014325 Bacteria 1806
52 Ga0157380_10103181 3300014326 Bacteria 2379
53 Ga0157380_10230859 3300014326 Bacteria 1662
54 Ga0157380_10240270 3300014326 Bacteria 1632
55 Ga0157377_10116595 3300014745 Bacteria 1613
56 Ga0157377_10180111 3300014745 Bacteria 1328
57 Ga0157376_10478513 3300014969 Bacteria 1220
58 Ga0206353_10994146 3300020082 Bacteria 1759
59 Ga0209566_100050 3300025225 Bacteria 234653
60 Ga0209674_100001 3300025226 Bacteria 4013750
61 Ga0209563_100001 3300025230 Bacteria 4013775
62 Ga0209563_100408 3300025230 Bacteria 15335
63 Ga0209437_100023 3300025233 Bacteria 614195
64 Ga0209677_100001 3300025253 Bacteria 4013787
65 Ga0209233_1000219 3300025261 Bacteria 104797
66 Ga0207705_10115686 3300025909 Bacteria 1985
67 Ga0207707_10096512 3300025912 Bacteria 2583
68 Ga0207707_10345122 3300025912 Bacteria 1283
69 Ga0207657_10288279 3300025919 Bacteria 1302
70 Ga0207649_10166054 3300025920 Bacteria 1533
71 Ga0207691_10127996 3300025940 Bacteria 2245
72 Ga0207711_10029086 3300025941 Bacteria 4658
73 Ga0207689_10099718 3300025942 Bacteria 2386
74 Ga0207679_10058949 3300025945 Bacteria 2847
75 Ga0207668_10279862 3300025972 Bacteria 1368
76 Ga0207708_10012200 3300026075 Bacteria 6409
77 Ga0207708_10082196 3300026075 Bacteria 2476
78 Ga0207674_10005588 3300026116 Bacteria 14904
79 Ga0207683_10190917 3300026121 Bacteria 1860
80 Ga0207698_10137749 3300026142 Bacteria 2097
81 Ga0209813_10011756 3300027866 Bacteria 2296
82 Ga0268266_10417460 3300028379 Bacteria 1271
83 Ga0268265_10132633 3300028380 Bacteria 2073
84 Ga0268264_10000269 3300028381 Bacteria 91321
85 Ga0307513_10092277 3300031456 Bacteria 3083
86 Ga0307508_10202993 3300031616 Bacteria 1583
87 Ga0307405_10196270 3300031731 Bacteria 1462
88 Ga0307413_10065426 3300031824 Bacteria 2264
89 Ga0307410_10058146 3300031852 Bacteria 2635
90 Ga0307406_10053601 3300031901 Bacteria 2570
91 Ga0307409_100203962 3300031995 Bacteria 1771
92 Ga0307416_100191778 3300032002 Bacteria 1928
93 Ga0307414_10326711 3300032004 Bacteria 1308
94 Ga0307415_100260593 3300032126 Bacteria 1414
95 Ga0307507_10013800 3300033179 Bacteria 9741
96 Ga0373926_0016520 3300035083 Bacteria 2526
97 Ga0395899_0108756 3300037312 Bacteria 1995
98 Ga0395898_0135416 3300037466 Bacteria 2358
99 Ga0395898_0270933 3300037466 Bacteria 1619
100 Ga0436365_0602453 3300039437 Bacteria 3732
101 Ga0451791_0323369 3300041451 Bacteria 1662
102 Ga0451797_1112773 3300041453 Bacteria 1891
103 Ga0466972_0042524 3300044658 Bacteria 2208
104 Ga0466965_0000002 3300044683 Bacteria 297957
105 Ga0466966_0077533 3300044684 Bacteria 2074
106 Ga0466961_0013475 3300044693 Bacteria 5236
107 Ga0466968_0031543 3300044735 Bacteria 2199
108 Ga0466968_0056650 3300044735 Bacteria 1684
109 Ga0466970_0006780 3300044765 Bacteria 5733
110 Ga0466970_0012153 3300044765 Bacteria 4396
111 Ga0466960_0025231 3300044901 Bacteria 2688
112 Ga0466959_0025312 3300045049 Bacteria 4397
113 Ga0466959_0028932 3300045049 Bacteria 4104
114 Ga0466958_0040539 3300045836 Bacteria 2799
115 Ga0495629_0016888 3300046459 Bacteria 5238
116 Ga0495651_0019879 3300046462 Bacteria 5207
117 Ga0495664_0003156 3300046477 Bacteria 8948
118 Ga0495594_0011047 3300046499 Bacteria 4691
119 Ga0495608_0030780 3300046511 Bacteria 3631
120 Ga0495587_0013606 3300046536 Bacteria 5112
121 Ga0495635_0005824 3300046663 Bacteria 8589
122 Ga0495657_0001278 3300046675 Bacteria 21878
123 Ga0495658_0034704 3300046683 Bacteria 2769
124 Ga0495613_0003967 3300046689 Bacteria 11079
125 Ga0495624_0156196 3300046690 Bacteria 1394
126 Ga0495670_0130322 3300046691 Bacteria 1310
127 Ga0495600_0028828 3300046809 Bacteria 3592
128 Ga0495581_0127508 3300047315 Bacteria 1482
129 Ga0495604_0001554 3300047317 Bacteria 18918
130 Ga0495636_0045839 3300047318 Bacteria 1823
131 Ga0495686_0047305 3300047472 Bacteria 2717
132 Ga0495593_0075639 3300047673 Bacteria 1745
133 Ga0496102_0092037 3300048905 Bacteria 2808
134 Ga0496103_0033935 3300048906 Bacteria 3119
135 Ga0496107_0154970 3300048910 Bacteria 1696
136 Ga0496108_0151655 3300048911 Bacteria 2000
137 Ga0496108_0166117 3300048911 Bacteria 1908
138 Ga0496109_0019105 3300048912 Bacteria 6035
139 Ga0496109_0048598 3300048912 Bacteria 3860
140 Ga0496109_0264726 3300048912 Bacteria 1620
141 Ga0496110_0047595 3300048913 Bacteria 3757
142 Ga0496111_0040470 3300048914 Bacteria 3343
143 Ga0496113_0133446 3300048916 Bacteria 1950
144 Ga0496114_0001275 3300048917 Bacteria 19037
145 Ga0496114_0007299 3300048917 Bacteria 8730
146 Ga0496114_0113368 3300048917 Bacteria 2324
147 Ga0496117_0016303 3300048920 Bacteria 6277
148 Ga0496119_0001809 3300048922 Bacteria 24850
149 Ga0496121_0047073 3300048924 Bacteria 3683
150 Ga0501032_0024838 3300049569 Bacteria 4134
151 Ga0501032_0047703 3300049569 Bacteria 2892
152 Ga0501033_0004672 3300049570 Bacteria 10961
153 Ga0501033_0331720 3300049570 Bacteria 1067
154 Ga0501034_0051611 3300049571 Bacteria 4147
155 Ga0501034_0097937 3300049571 Bacteria 2929
156 Ga0501034_0287742 3300049571 Bacteria 1582
157 Ga0501036_0335056 3300049572 Bacteria 1264
158 Ga0501037_0044449 3300049573 Bacteria 3262
159 Ga0501038_0078372 3300049574 Bacteria 2788
160 Ga0501039_0263655 3300049575 Bacteria 1354
161 Ga0501068_0228772 3300049584 Bacteria 1182
162 Ga0501069_0019086 3300049585 Bacteria 3705
163 Ga0501069_0139391 3300049585 Bacteria 1391
164 Ga0501070_0046828 3300049586 Bacteria 3596
165 Ga0501073_0000366 3300049589 Bacteria 30456
166 Ga0501074_0206566 3300049590 Bacteria 1399
167 Ga0501074_0332667 3300049590 Bacteria 1078
168 Ga0501080_0029142 3300049742 Bacteria 5139
169 Ga0501080_0116899 3300049742 Bacteria 2472
170 Ga0501080_0130691 3300049742 Bacteria 2325
171 Ga0501271_005959 3300049768 Bacteria 1200
172 Ga0501035_0028384 3300049822 Bacteria 5108
173 Ga0501044_0005944 3300049823 Bacteria 13510
174 nmdc:mga03n38_6344_c1 3300050490 Bacteria 4102
175 nmdc:mga00v17_132443_c1 3300050491 Bacteria 1594
176 nmdc:mga00v17_27801_c1 3300050491 Bacteria 3306
177 nmdc:mga00v17_2955_c1 3300050491 Bacteria 8725
178 nmdc:mga0yw44_1010_c1 3300050492 Bacteria 10760
179 nmdc:mga0yw44_12068_c1 3300050492 Bacteria 4488
180 nmdc:mga0yw44_14204_c1 3300050492 Bacteria 4219
181 nmdc:mga0yw44_15837_c1 3300050492 Bacteria 4053
182 nmdc:mga0yw44_1813_c1 3300050492 Bacteria 8738
183 nmdc:mga0yw44_20915_c1 3300050492 Bacteria 3642
184 nmdc:mga0yw44_87037_c1 3300050492 Bacteria 1969
185 nmdc:mga06z11_13843_c1 3300050494 Bacteria 3557
186 nmdc:mga08y16_71170_c1 3300050511 Bacteria 3625
187 nmdc:mga08x19_289923_c1 3300050514 Bacteria 1135
188 nmdc:mga08x19_35832_c1 3300050514 Bacteria 3140
189 nmdc:mga0sz30_1050_c1 3300050516 Bacteria 9949
190 Ga0500643_000444 3300053087 Bacteria 30955
191 Ga0500644_0000019 3300053088 Bacteria 102598
192 Ga0500640_005917 3300053095 Bacteria 4617
193 Ga0500556_0000001 3300053104 Bacteria 1135060
194 Ga0500556_0000204 3300053104 Bacteria 48558
195 Ga0500593_001484 3300053117 Bacteria 8442
196 Ga0500559_0000317 3300053136 Bacteria 36554
197 Ga0500568_0000003 3300053139 Bacteria 863587
198 Ga0500568_0000174 3300053139 Bacteria 56251
199 Ga0500616_0000376 3300053153 Bacteria 62549
200 Ga0590074_002143 3300059423 Bacteria 3235
201 Ga0590075_001518 3300059424 Bacteria 5778
202 Ga0501082_0237689 3300060353 Bacteria 1586
203 Ga0466962_0202062 3300061719 Bacteria 971
204 Ga0530510_0250275 3300061734 Bacteria 1320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061719 Ga0466962_0202062 Ga0466962_0202062_167_955 260
2 3300049585 Ga0501069_0139391 Ga0501069_0139391_412_1287 290
3 3300049571 Ga0501034_0287742 Ga0501034_0287742_29_979 307
4 3300045836 Ga0466958_0040539 Ga0466958_0040539_1804_2745 311
5 3300005564 Ga0070664_100092888 Ga0070664_1000928883 315
6 3300014326 Ga0157380_10103181 Ga0157380_101031813 315
7 3300005564 Ga0070664_100241136 Ga0070664_1002411362 316
8 3300025920 Ga0207649_10166054 Ga0207649_101660541 316
9 3300047318 Ga0495636_0045839 Ga0495636_0045839_192_1208 316
10 3300005434 Ga0070709_10045545 Ga0070709_100455453 317
11 3300005439 Ga0070711_100032335 Ga0070711_1000323352 317
12 3300006173 Ga0070716_100168305 Ga0070716_1001683052 317
13 3300039437 Ga0436365_0602453 Ga0436365_0602453_544_1566 317
14 3300046499 Ga0495594_0011047 Ga0495594_0011047_1644_2660 317
15 3300050511 nmdc:mga08y16_71170_c1 nmdc:mga08y16_71170_c1_200_1222 318
16 3300006163 Ga0070715_10082540 Ga0070715_100825402 319
17 3300025942 Ga0207689_10099718 Ga0207689_100997181 319
18 3300033179 Ga0307507_10013800 Ga0307507_100138005 319
19 3300046459 Ga0495629_0016888 Ga0495629_0016888_3682_4704 319
20 3300046462 Ga0495651_0019879 Ga0495651_0019879_342_1364 319
21 3300046477 Ga0495664_0003156 Ga0495664_0003156_3595_4617 319
22 3300046536 Ga0495587_0013606 Ga0495587_0013606_3688_4710 319
23 3300046663 Ga0495635_0005824 Ga0495635_0005824_394_1416 319
24 3300046675 Ga0495657_0001278 Ga0495657_0001278_3607_4629 319
25 3300046683 Ga0495658_0034704 Ga0495658_0034704_351_1373 319
26 3300046689 Ga0495613_0003967 Ga0495613_0003967_9647_10669 319
27 3300046690 Ga0495624_0156196 Ga0495624_0156196_325_1347 319
28 3300046809 Ga0495600_0028828 Ga0495600_0028828_417_1439 319
29 3300047315 Ga0495581_0127508 Ga0495581_0127508_113_1135 319
30 3300047317 Ga0495604_0001554 Ga0495604_0001554_5352_6374 319
31 3300047673 Ga0495593_0075639 Ga0495593_0075639_384_1406 319
32 3300049570 Ga0501033_0331720 Ga0501033_0331720_51_1016 319
33 3300053095 Ga0500640_005917 Ga0500640_005917_181_1203 319
34 3300005354 Ga0070675_100178786 Ga0070675_1001787862 320
35 3300005441 Ga0070700_100209309 Ga0070700_1002093091 320
36 3300005535 Ga0070684_100092600 Ga0070684_1000926002 320
37 3300005564 Ga0070664_100048587 Ga0070664_1000485875 320
38 3300005577 Ga0068857_100016654 Ga0068857_1000166545 320
39 3300005841 Ga0068863_100204906 Ga0068863_1002049061 320
40 3300005844 Ga0068862_100125412 Ga0068862_1001254124 320
41 3300011119 Ga0105246_10159988 Ga0105246_101599881 320
42 3300014325 Ga0163163_10254812 Ga0163163_102548121 320
43 3300014745 Ga0157377_10116595 Ga0157377_101165952 320
44 3300025945 Ga0207679_10058949 Ga0207679_100589493 320
45 3300026075 Ga0207708_10012200 Ga0207708_100122001 320
46 3300026116 Ga0207674_10005588 Ga0207674_1000558817 320
47 3300028380 Ga0268265_10132633 Ga0268265_101326333 320
48 3300037466 Ga0395898_0270933 Ga0395898_0270933_65_1102 320
49 3300048912 Ga0496109_0048598 Ga0496109_0048598_2570_3607 320
50 3300048912 Ga0496109_0264726 Ga0496109_0264726_40_1005 320
51 3300005406 Ga0070703_10029054 Ga0070703_100290542 321
52 3300046691 Ga0495670_0130322 Ga0495670_0130322_55_1071 321
53 3300053104 Ga0500556_0000001 Ga0500556_0000001_1126416_1127441 323
54 3300053139 Ga0500568_0000003 Ga0500568_0000003_498531_499556 323
55 3300025940 Ga0207691_10127996 Ga0207691_101279963 324
56 3300025972 Ga0207668_10279862 Ga0207668_102798622 324
57 3300053153 Ga0500616_0000376 Ga0500616_0000376_56427_57458 324
58 3300005458 Ga0070681_10058927 Ga0070681_100589273 325
59 3300005617 Ga0068859_100423221 Ga0068859_1004232211 325
60 3300006931 Ga0097620_100423213 Ga0097620_1004232131 325
61 3300009177 Ga0105248_10051229 Ga0105248_100512293 325
62 3300025912 Ga0207707_10345122 Ga0207707_103451221 325
63 3300025941 Ga0207711_10029086 Ga0207711_100290861 325
64 3300050514 nmdc:mga08x19_35832_c1 nmdc:mga08x19_35832_c1_1687_2703 325
65 3300005618 Ga0068864_100442954 Ga0068864_1004429541 326
66 3300009094 Ga0111539_10357445 Ga0111539_103574451 326
67 3300026121 Ga0207683_10190917 Ga0207683_101909172 326
68 3300026142 Ga0207698_10137749 Ga0207698_101377491 326
69 3300048905 Ga0496102_0092037 Ga0496102_0092037_660_1700 326
70 3300048917 Ga0496114_0001275 Ga0496114_0001275_5477_6499 326
71 3300048917 Ga0496114_0007299 Ga0496114_0007299_6590_7609 329
72 3300005458 Ga0070681_10310103 Ga0070681_103101031 331
73 3300006914 Ga0075436_100063277 Ga0075436_1000632772 331
74 3300009177 Ga0105248_10166519 Ga0105248_101665193 331
75 3300025912 Ga0207707_10096512 Ga0207707_100965123 331
76 3300048920 Ga0496117_0016303 Ga0496117_0016303_1346_2371 331
77 3300048924 Ga0496121_0047073 Ga0496121_0047073_724_1749 331
78 3300049586 Ga0501070_0046828 Ga0501070_0046828_2021_3046 331
79 3300049742 Ga0501080_0130691 Ga0501080_0130691_788_1813 331
80 3300050514 nmdc:mga08x19_289923_c1 nmdc:mga08x19_289923_c1_68_1084 331
81 3300005329 Ga0070683_100225272 Ga0070683_1002252722 332
82 3300048922 Ga0496119_0001809 Ga0496119_0001809_10988_12013 332
83 3300049570 Ga0501033_0004672 Ga0501033_0004672_4476_5501 332
84 3300049572 Ga0501036_0335056 Ga0501036_0335056_217_1242 332
85 3300049768 Ga0501271_005959 Ga0501271_005959_14_1015 332
86 iso_pu_bacteria 2894232714 2894242042 333
87 3300049569 Ga0501032_0047703 Ga0501032_0047703_1367_2404 334
88 3300049573 Ga0501037_0044449 Ga0501037_0044449_2208_3245 334
89 3300049822 Ga0501035_0028384 Ga0501035_0028384_2246_3283 334
90 3300049823 Ga0501044_0005944 Ga0501044_0005944_2282_3319 334
91 iso_pu_bacteria 2848297114 2848297685 334
92 3300028379 Ga0268266_10417460 Ga0268266_104174601 335
93 3300049589 Ga0501073_0000366 Ga0501073_0000366_6850_7875 335
94 iso_pu_bacteria 2919443155 2919445133 336
95 3300032004 Ga0307414_10326711 Ga0307414_103267111 337
96 3300035083 Ga0373926_0016520 Ga0373926_0016520_287_1354 337
97 iso_pu_bacteria 2919055335 2919058241 337
98 3300002075 JGI24738J21930_10028470 JGI24738J21930_100284701 338
99 3300002737 JGI25162J39368_1000766 JGI25162J39368_100076620 338
100 3300003214 JGI25165J46597_1000958 JGI25165J46597_10009584 338
101 3300005577 Ga0068857_100090058 Ga0068857_1000900583 338
102 3300005843 Ga0068860_100000301 Ga0068860_10000030154 338
103 3300006038 Ga0075365_10033873 Ga0075365_100338733 338
104 3300006042 Ga0075368_10029501 Ga0075368_100295012 338
105 3300006048 Ga0075363_100001293 Ga0075363_1000012937 338
106 3300006048 Ga0075363_100007064 Ga0075363_1000070644 338
107 3300006051 Ga0075364_10037085 Ga0075364_100370852 338
108 3300006051 Ga0075364_10048148 Ga0075364_100481482 338
109 3300006051 Ga0075364_10171985 Ga0075364_101719851 338
110 3300006177 Ga0075362_10015647 Ga0075362_100156474 338
111 3300009094 Ga0111539_10213655 Ga0111539_102136552 338
112 3300014326 Ga0157380_10230859 Ga0157380_102308592 338
113 3300014326 Ga0157380_10240270 Ga0157380_102402702 338
114 3300014745 Ga0157377_10180111 Ga0157377_101801112 338
115 3300014969 Ga0157376_10478513 Ga0157376_104785131 338
116 3300020082 Ga0206353_10994146 Ga0206353_109941461 338
117 3300025233 Ga0209437_100023 Ga0209437_1000234 338
118 3300025261 Ga0209233_1000219 Ga0209233_10002194 338
119 3300025909 Ga0207705_10115686 Ga0207705_101156862 338
120 3300025919 Ga0207657_10288279 Ga0207657_102882792 338
121 3300026075 Ga0207708_10082196 Ga0207708_100821962 338
122 3300027866 Ga0209813_10011756 Ga0209813_100117561 338
123 3300028381 Ga0268264_10000269 Ga0268264_1000026953 338
124 3300031456 Ga0307513_10092277 Ga0307513_100922773 338
125 3300031731 Ga0307405_10196270 Ga0307405_101962702 338
126 3300031824 Ga0307413_10065426 Ga0307413_100654263 338
127 3300031852 Ga0307410_10058146 Ga0307410_100581463 338
128 3300031901 Ga0307406_10053601 Ga0307406_100536012 338
129 3300031995 Ga0307409_100203962 Ga0307409_1002039622 338
130 3300032002 Ga0307416_100191778 Ga0307416_1001917781 338
131 3300032126 Ga0307415_100260593 Ga0307415_1002605931 338
132 3300041451 Ga0451791_0323369 Ga0451791_0323369_484_1503 338
133 3300041453 Ga0451797_1112773 Ga0451797_1112773_219_1238 338
134 3300046511 Ga0495608_0030780 Ga0495608_0030780_227_1246 338
135 3300048910 Ga0496107_0154970 Ga0496107_0154970_576_1595 338
136 3300048911 Ga0496108_0151655 Ga0496108_0151655_243_1262 338
137 3300048911 Ga0496108_0166117 Ga0496108_0166117_506_1525 338
138 3300048912 Ga0496109_0019105 Ga0496109_0019105_4579_5598 338
139 3300048913 Ga0496110_0047595 Ga0496110_0047595_819_1838 338
140 3300048914 Ga0496111_0040470 Ga0496111_0040470_2009_3028 338
141 3300048916 Ga0496113_0133446 Ga0496113_0133446_834_1853 338
142 3300048917 Ga0496114_0113368 Ga0496114_0113368_770_1789 338
143 3300049571 Ga0501034_0097937 Ga0501034_0097937_429_1538 338
144 3300049584 Ga0501068_0228772 Ga0501068_0228772_98_1117 338
145 3300049585 Ga0501069_0019086 Ga0501069_0019086_2187_3206 338
146 3300049590 Ga0501074_0206566 Ga0501074_0206566_228_1247 338
147 3300049742 Ga0501080_0029142 Ga0501080_0029142_101_1120 338
148 3300050490 nmdc:mga03n38_6344_c1 nmdc:mga03n38_6344_c1_2430_3449 338
149 3300050491 nmdc:mga00v17_132443_c1 nmdc:mga00v17_132443_c1_16_1035 338
150 3300050491 nmdc:mga00v17_27801_c1 nmdc:mga00v17_27801_c1_775_1794 338
151 3300050492 nmdc:mga0yw44_12068_c1 nmdc:mga0yw44_12068_c1_1839_2858 338
152 3300050492 nmdc:mga0yw44_15837_c1 nmdc:mga0yw44_15837_c1_636_1655 338
153 3300050492 nmdc:mga0yw44_1813_c1 nmdc:mga0yw44_1813_c1_4747_5766 338
154 3300050492 nmdc:mga0yw44_20915_c1 nmdc:mga0yw44_20915_c1_2369_3388 338
155 3300050494 nmdc:mga06z11_13843_c1 nmdc:mga06z11_13843_c1_1078_2097 338
156 3300053087 Ga0500643_000444 Ga0500643_000444_17009_18031 338
157 3300053088 Ga0500644_0000019 Ga0500644_0000019_10677_11696 338
158 3300059423 Ga0590074_002143 Ga0590074_002143_1406_2431 338
159 3300059424 Ga0590075_001518 Ga0590075_001518_234_1259 338
160 3300060353 Ga0501082_0237689 Ga0501082_0237689_210_1229 338
161 3300061734 Ga0530510_0250275 Ga0530510_0250275_234_1256 338
162 3300049590 Ga0501074_0332667 Ga0501074_0332667_25_1050 339
163 3300049742 Ga0501080_0116899 Ga0501080_0116899_627_1664 339
164 3300053104 Ga0500556_0000204 Ga0500556_0000204_39423_40448 339
165 3300053117 Ga0500593_001484 Ga0500593_001484_4595_5620 339
166 iso_pu_bacteria 2902405164 2902408672 339
167 3300006186 Ga0075369_10007097 Ga0075369_100070974 340
168 3300013105 Ga0157369_10051662 Ga0157369_100516622 340
169 3300031616 Ga0307508_10202993 Ga0307508_102029932 340
170 3300037312 Ga0395899_0108756 Ga0395899_0108756_28_1062 340
171 3300037466 Ga0395898_0135416 Ga0395898_0135416_108_1142 340
172 3300044735 Ga0466968_0031543 Ga0466968_0031543_69_1172 340
173 3300048906 Ga0496103_0033935 Ga0496103_0033935_1201_2238 340
174 3300050491 nmdc:mga00v17_2955_c1 nmdc:mga00v17_2955_c1_6633_7661 340
175 3300050492 nmdc:mga0yw44_1010_c1 nmdc:mga0yw44_1010_c1_1306_2334 340
176 3300050492 nmdc:mga0yw44_14204_c1 nmdc:mga0yw44_14204_c1_960_1988 340
177 3300050492 nmdc:mga0yw44_87037_c1 nmdc:mga0yw44_87037_c1_499_1575 340
178 3300050516 nmdc:mga0sz30_1050_c1 nmdc:mga0sz30_1050_c1_1334_2362 340
179 3300053139 Ga0500568_0000174 Ga0500568_0000174_4470_5498 340
180 3300003752 Ga0055539_1000008 Ga0055539_1000008182 341
181 3300003756 Ga0055533_1000001 Ga0055533_1000001889 341
182 3300003759 Ga0055525_1000489 Ga0055525_100048911 341
183 3300003841 Ga0055541_1005619 Ga0055541_10056192 341
184 3300025225 Ga0209566_100050 Ga0209566_10005099 341
185 3300025226 Ga0209674_100001 Ga0209674_100001889 341
186 3300025230 Ga0209563_100001 Ga0209563_100001889 341
187 3300025253 Ga0209677_100001 Ga0209677_100001889 341
188 3300044683 Ga0466965_0000002 Ga0466965_0000002_217099_218244 341
189 3300049569 Ga0501032_0024838 Ga0501032_0024838_1141_2199 341
190 3300049571 Ga0501034_0051611 Ga0501034_0051611_969_2027 341
191 3300049574 Ga0501038_0078372 Ga0501038_0078372_664_1722 341
192 3300049575 Ga0501039_0263655 Ga0501039_0263655_184_1242 341
193 3300006038 Ga0075365_10003412 Ga0075365_100034123 342
194 3300006051 Ga0075364_10008351 Ga0075364_100083517 342
195 3300053136 Ga0500559_0000317 Ga0500559_0000317_25570_26637 342
196 3300002067 JGI24735J21928_10013011 JGI24735J21928_100130112 343
197 3300013105 Ga0157369_10418578 Ga0157369_104185781 343
198 3300013105 Ga0157369_10500480 Ga0157369_105004801 343
199 3300025230 Ga0209563_100408 Ga0209563_1004087 343
200 3300044658 Ga0466972_0042524 Ga0466972_0042524_1054_2085 343
201 3300044684 Ga0466966_0077533 Ga0466966_0077533_299_1330 343
202 3300044693 Ga0466961_0013475 Ga0466961_0013475_2806_3837 343
203 3300044735 Ga0466968_0056650 Ga0466968_0056650_311_1342 343
204 3300044765 Ga0466970_0006780 Ga0466970_0006780_1102_2133 343
205 3300044765 Ga0466970_0012153 Ga0466970_0012153_1309_2340 343
206 3300044901 Ga0466960_0025231 Ga0466960_0025231_1591_2622 343
207 3300045049 Ga0466959_0025312 Ga0466959_0025312_1151_2182 343
208 3300045049 Ga0466959_0028932 Ga0466959_0028932_29_1060 343
209 3300047472 Ga0495686_0047305 Ga0495686_0047305_1045_2076 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

44

301

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.7614 5 338
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.7529 5 338
1luc-assembly1.cif.gz_A bacterial luciferase 0.7496 5 343
1luc-assembly1.cif.gz_A bacterial luciferase 0.7453 5 343
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.743 3 340
ID Description Score Start End Superfamily
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7439 4 339 3.20.20.30
1m41A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7344 4 329 3.20.20.30
af_P9WM03_11_339_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7318 29 258 3.20.20.30
3fgcC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7299 5 343 3.20.20.30
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7291 3 330 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A520EI98-F1-model_v4 deleted 0.9958 4 147
AF-A0A6G3V0Y8-F1-model_v4 deleted 0.9954 4 147
AF-A0A3S1GJS5-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9919 4 138 GO:0005829
GO:0016705
AF-A0A1G9LSH2-F1-model_v4 Luciferase-like monooxygenase 0.9797 4 174 GO:0004497
GO:0005829
GO:0016705
AF-A0A1R4GGP8-F1-model_v4 Alkanal monooxygenase alpha chain (EC 1.14.14.3) 0.9794 2 340 GO:0005829
GO:0047646

Feature Viewer

pLDDT pTM Quality
93.63 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map