F318244

General Info

Members Datasets Scaffolds Average Seq Length
208 142 206 469

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0109975|Ga0495606_0109975_169_1521
Length 450
Sequence MKPLATAAATALALFATQAGAQTAAPRPDQLAFRDLYKELVETDTSVSTGSCTAAAEKMAARLKAAGYADDQVTLFKVDGFPLDGGLVAQLPGTSPTAKPMLLLGHLDVVNARREDWTRDPYKFIEEDGYFYGRGTSDMKAMVAVWVDTLIRLKQQGYKPKRTIKMALTCGEESGARMNGAQWLAENKPDWIAAEFALNEGGGGRTDGRGKVVTQSIQVGEKSNRTFEVETTNPGGHSSTPIDDNAIYELADAIAKVRAYKFPIRFNDTTRAYFAKEGAARNDDIGRAMAALAKNPADRAAEATVSADRSYNSMLRTTCVNCRVVPGEDADTTRAALIAAIGDAKAKVTLVGRLRPVAVPPPLDPKIMAPAEKLVARYYPGAPLIPVMMTGATDATYVAPIGIPTYGVPVGWGDPEGNGTHGLNERREVRSVYVGRDFLFDLVKAYAAGG

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
70 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
131 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
134 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
139 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
140 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 0.48
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0
Rhizoplane 2.4
Rhizosphere 77.88
Stem 0
Stem Tuber 0
Unclassified 12.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1001930 3300005262 Bacteria 19766
2 Ga0070660_100182454 3300005339 Bacteria 1698
3 Ga0070671_100004599 3300005355 Bacteria 10938
4 Ga0070674_100024769 3300005356 Bacteria 3898
5 Ga0070659_100000316 3300005366 Bacteria 37463
6 Ga0070659_100025594 3300005366 Bacteria 4534
7 Ga0070667_100000873 3300005367 Bacteria 27955
8 Ga0070667_100043205 3300005367 Bacteria 3782
9 Ga0070709_10021518 3300005434 Bacteria 3757
10 Ga0070711_100022956 3300005439 Bacteria 4051
11 Ga0070663_100165266 3300005455 Bacteria 1706
12 Ga0070681_10013138 3300005458 Bacteria 8225
13 Ga0068853_100002521 3300005539 Bacteria 13743
14 Ga0068853_100210475 3300005539 Bacteria 1772
15 Ga0070695_100001021 3300005545 Bacteria 15277
16 Ga0070665_100000221 3300005548 Bacteria 95402
17 Ga0070665_100032327 3300005548 Bacteria 5267
18 Ga0068857_100055966 3300005577 Bacteria 3500
19 Ga0068852_100017160 3300005616 Bacteria 5673
20 Ga0068859_100004470 3300005617 Bacteria 14269
21 Ga0068861_100018076 3300005719 Bacteria 5014
22 Ga0068863_100012499 3300005841 Bacteria 8194
23 Ga0068863_100061557 3300005841 Bacteria 3549
24 Ga0068858_100008273 3300005842 Bacteria 10000
25 Ga0068860_100000274 3300005843 Bacteria 75310
26 Ga0068860_100000834 3300005843 Bacteria 34494
27 Ga0068860_100017236 3300005843 Bacteria 7040
28 Ga0068862_100000149 3300005844 Bacteria 79784
29 Ga0068862_100001856 3300005844 Bacteria 19150
30 Ga0070712_100050570 3300006175 Bacteria 2892
31 Ga0097620_100004470 3300006931 Bacteria 14269
32 Ga0105240_10012475 3300009093 Bacteria 11725
33 Ga0105240_10085743 3300009093 Bacteria 3858
34 Ga0105240_10098490 3300009093 Bacteria 3561
35 Ga0105247_10002474 3300009101 Bacteria 12566
36 Ga0105247_10058391 3300009101 Bacteria 2387
37 Ga0105248_10001123 3300009177 Bacteria 29791
38 Ga0105248_10001554 3300009177 Bacteria 25561
39 Ga0105238_10002100 3300009551 Bacteria 20126
40 Ga0105238_10017044 3300009551 Bacteria 7375
41 Ga0105249_10000056 3300009553 Bacteria 160443
42 Ga0105239_10032806 3300010375 Bacteria 5706
43 Ga0105239_10038198 3300010375 Bacteria 5262
44 Ga0157370_10160188 3300013104 Bacteria 2094
45 Ga0157369_10026893 3300013105 Bacteria 6380
46 Ga0157369_10261698 3300013105 Bacteria 1804
47 Ga0157374_10148476 3300013296 Unclassified 2278
48 Ga0163162_10001764 3300013306 Bacteria 20274
49 Ga0163162_10002965 3300013306 Bacteria 16196
50 Ga0163162_10039502 3300013306 Bacteria 4716
51 Ga0163163_10000006 3300014325 Bacteria 320401
52 Ga0163163_10030511 3300014325 Bacteria 5195
53 Ga0157379_10050588 3300014968 Bacteria 3710
54 Ga0157379_10199264 3300014968 Bacteria 1810
55 Ga0183363_1035 3300015690 Bacteria 46444
56 Ga0213872_10001198 3300021361 Bacteria 17580
57 Ga0213872_10001355 3300021361 Bacteria 16158
58 Ga0213872_10023865 3300021361 Bacteria 2813
59 Ga0213876_10003019 3300021384 Bacteria 9736
60 Ga0209050_1029720 3300025298 Bacteria 1740
61 Ga0207697_10021480 3300025315 Bacteria 2642
62 Ga0207710_10002284 3300025900 Bacteria 8977
63 Ga0207707_10028383 3300025912 Bacteria 4891
64 Ga0207695_10009942 3300025913 Bacteria 11691
65 Ga0207695_10020816 3300025913 Bacteria 7501
66 Ga0207695_10076423 3300025913 Bacteria 3404
67 Ga0207657_10023525 3300025919 Bacteria 5736
68 Ga0207657_10050069 3300025919 Bacteria 3637
69 Ga0207694_10032527 3300025924 Bacteria 3993
70 Ga0207650_10012656 3300025925 Bacteria 5823
71 Ga0207644_10023798 3300025931 Bacteria 4199
72 Ga0207644_10053170 3300025931 Unclassified 2914
73 Ga0207690_10000077 3300025932 Bacteria 85018
74 Ga0207706_10130362 3300025933 Bacteria 2211
75 Ga0207669_10009945 3300025937 Bacteria 4557
76 Ga0207711_10000678 3300025941 Bacteria 33766
77 Ga0207711_10001122 3300025941 Bacteria 25575
78 Ga0207711_10004810 3300025941 Bacteria 11469
79 Ga0207667_10027307 3300025949 Bacteria 6215
80 Ga0207712_10000015 3300025961 Bacteria 346689
81 Ga0207658_10000545 3300025986 Bacteria 34100
82 Ga0207658_10069985 3300025986 Bacteria 2653
83 Ga0207703_10000667 3300026035 Bacteria 34257
84 Ga0207703_10025666 3300026035 Bacteria 4636
85 Ga0207678_10126864 3300026067 Bacteria 2176
86 Ga0207641_10000290 3300026088 Bacteria 62711
87 Ga0207641_10001266 3300026088 Bacteria 25156
88 Ga0207641_10014087 3300026088 Bacteria 6553
89 Ga0207674_10019862 3300026116 Bacteria 7270
90 Ga0207675_100000062 3300026118 Bacteria 80665
91 Ga0207683_10145501 3300026121 Bacteria 2137
92 Ga0207698_10008164 3300026142 Bacteria 6601
93 Ga0207698_10056762 3300026142 Bacteria 3025
94 Ga0207698_10132803 3300026142 Bacteria 2131
95 Ga0265354_1000491 3300028016 Bacteria 6826
96 Ga0268266_10000005 3300028379 Bacteria 1448194
97 Ga0268266_10002612 3300028379 Bacteria 19082
98 Ga0268266_10140470 3300028379 Bacteria 2167
99 Ga0268265_10000021 3300028380 Bacteria 272292
100 Ga0268265_10005048 3300028380 Bacteria 9061
101 Ga0268264_10000058 3300028381 Bacteria 308956
102 Ga0268264_10000060 3300028381 Bacteria 305056
103 Ga0268264_10000277 3300028381 Bacteria 86740
104 Ga0268264_10007933 3300028381 Bacteria 8834
105 Ga0307515_10083939 3300028794 Bacteria 4099
106 Ga0307511_10000937 3300030521 Bacteria 30868
107 Ga0307511_10012047 3300030521 Bacteria 8505
108 Ga0265770_1000488 3300030878 Bacteria 5491
109 Ga0265340_10081717 3300031247 Bacteria 1521
110 Ga0265331_10001981 3300031250 Bacteria 14295
111 Ga0265327_10001467 3300031251 Bacteria 29538
112 Ga0307513_10059069 3300031456 Bacteria 4072
113 Ga0307509_10000025 3300031507 Bacteria 235550
114 Ga0307509_10000074 3300031507 Bacteria 140111
115 Ga0307508_10005365 3300031616 Bacteria 12204
116 Ga0307508_10104390 3300031616 Bacteria 2431
117 Ga0307510_10000006 3300033180 Bacteria 566474
118 Ga0307510_10005434 3300033180 Bacteria 15167
119 Ga0373936_0004088 3300035113 Bacteria 5497
120 Ga0373933_0009370 3300035724 Bacteria 5349
121 Ga0395899_0000311 3300037312 Bacteria 62323
122 Ga0395900_0000004 3300037418 Bacteria 564908
123 Ga0395898_0014948 3300037466 Bacteria 7970
124 Ga0395905_0006537 3300037471 Bacteria 11720
125 Ga0395901_0000005 3300038443 Bacteria 544998
126 Ga0436361_0014016 3300039447 Bacteria 3485
127 Ga0436361_0064588 3300039447 Bacteria 5119
128 Ga0436361_0328321 3300039447 Bacteria 8525
129 Ga0466969_0010513 3300044656 Bacteria 4906
130 Ga0466969_0020308 3300044656 Bacteria 3442
131 Ga0466966_0005349 3300044684 Bacteria 8444
132 Ga0466961_0011546 3300044693 Bacteria 5648
133 Ga0466971_0032887 3300044719 Bacteria 2323
134 Ga0466970_0017929 3300044765 Bacteria 3662
135 Ga0466957_0017271 3300044842 Bacteria 4224
136 Ga0466959_0032332 3300045049 Bacteria 3872
137 Ga0466959_0040849 3300045049 Bacteria 3426
138 Ga0466959_0063609 3300045049 Bacteria 2679
139 Ga0495638_0041538 3300046460 Bacteria 2909
140 Ga0495651_0104106 3300046462 Bacteria 2108
141 Ga0495580_0059879 3300046472 Bacteria 2676
142 Ga0495583_0000279 3300046506 Bacteria 82827
143 Ga0495583_0034344 3300046506 Bacteria 2430
144 Ga0495606_0001229 3300046507 Bacteria 35865
145 Ga0495606_0025393 3300046507 Bacteria 4244
146 Ga0495606_0109975 3300046507 Bacteria 1664
147 Ga0495616_0000358 3300046513 Bacteria 35867
148 Ga0495628_0059477 3300046516 Bacteria 3000
149 Ga0495666_0033647 3300046526 Bacteria 2503
150 Ga0495642_0066347 3300046528 Bacteria 1504
151 Ga0495640_0016348 3300046533 Bacteria 5551
152 Ga0495645_0018790 3300046543 Bacteria 4972
153 Ga0495668_0014017 3300046616 Bacteria 4712
154 Ga0495625_0015548 3300046660 Bacteria 6024
155 Ga0495635_0045855 3300046663 Bacteria 3015
156 Ga0495588_0052486 3300046674 Bacteria 2102
157 Ga0495599_0081170 3300046678 Bacteria 2025
158 Ga0495600_0071108 3300046809 Bacteria 2274
159 Ga0495581_0003045 3300047315 Bacteria 9599
160 Ga0495604_0014882 3300047317 Bacteria 6206
161 Ga0495636_0026929 3300047318 Bacteria 2341
162 Ga0495674_0030061 3300047319 Bacteria 4942
163 Ga0495674_0043424 3300047319 Bacteria 4001
164 Ga0495676_0005613 3300047321 Bacteria 11501
165 Ga0495687_021412 3300047443 Bacteria 3128
166 Ga0495687_031345 3300047443 Bacteria 2440
167 Ga0495677_0023028 3300047445 Bacteria 2261
168 Ga0495673_0006614 3300047469 Bacteria 6793
169 Ga0495686_0000139 3300047472 Bacteria 145796
170 Ga0495686_0003079 3300047472 Bacteria 14759
171 Ga0495602_0039061 3300048088 Bacteria 4377
172 Ga0495614_0000707 3300048089 Bacteria 14051
173 Ga0496102_0016892 3300048905 Bacteria 6386
174 Ga0496115_0010604 3300048918 Bacteria 6892
175 Ga0496115_0026649 3300048918 Bacteria 4514
176 Ga0496115_0036416 3300048918 Bacteria 3896
177 Ga0496115_0113248 3300048918 Bacteria 2229
178 Ga0496117_0000090 3300048920 Bacteria 206388
179 Ga0496117_0017798 3300048920 Bacteria 5923
180 Ga0496118_0000032 3300048921 Bacteria 330072
181 Ga0496118_0119022 3300048921 Bacteria 1728
182 Ga0496119_0000436 3300048922 Bacteria 57111
183 Ga0496120_0000106 3300048923 Bacteria 140132
184 Ga0496120_0000490 3300048923 Bacteria 62027
185 Ga0496124_0085703 3300048927 Bacteria 2580
186 Ga0496124_0093700 3300048927 Bacteria 2444
187 Ga0496125_0000592 3300048928 Bacteria 61806
188 Ga0496125_0049091 3300048928 Bacteria 3510
189 Ga0496126_0000147 3300048929 Bacteria 163338
190 Ga0496126_0012681 3300048929 Bacteria 8625
191 Ga0501249_000129 3300049679 Bacteria 23615
192 Ga0500643_001425 3300053087 Bacteria 13789
193 Ga0500643_008373 3300053087 Bacteria 4066
194 Ga0500555_000121 3300053103 Bacteria 37468
195 Ga0500556_0000013 3300053104 Bacteria 243797
196 Ga0500595_008863 3300053119 Bacteria 4088
197 Ga0500642_0000002 3300053130 Bacteria 795093
198 Ga0500559_0006336 3300053136 Bacteria 5343
199 Ga0500559_0035149 3300053136 Bacteria 2163
200 Ga0500616_0021056 3300053153 Bacteria 3660
201 Ga0500624_000544 3300053157 Bacteria 10609
202 Ga0500627_0000156 3300053158 Bacteria 20300
203 Ga0500637_0056849 3300053178 Bacteria 2235
204 Ga0500645_000105 3300053730 Bacteria 67078
205 Ga0500645_028715 3300053730 Bacteria 1682
206 Ga0466962_0076905 3300061719 Bacteria 1595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053178 Ga0500637_0056849 Ga0500637_0056849_167_1630 443
2 3300030521 Ga0307511_10000937 Ga0307511_1000093730 444
3 3300037312 Ga0395899_0000311 Ga0395899_0000311_49077_50501 446
4 3300037418 Ga0395900_0000004 Ga0395900_0000004_331089_332513 446
5 3300037466 Ga0395898_0014948 Ga0395898_0014948_2316_3740 446
6 3300037471 Ga0395905_0006537 Ga0395905_0006537_1253_2677 446
7 3300038443 Ga0395901_0000005 Ga0395901_0000005_233058_234482 446
8 3300028016 Ga0265354_1000491 Ga0265354_10004912 447
9 3300030878 Ga0265770_1000488 Ga0265770_10004883 447
10 3300010375 Ga0105239_10038198 Ga0105239_100381984 448
11 3300025912 Ga0207707_10028383 Ga0207707_100283832 448
12 3300025931 Ga0207644_10053170 Ga0207644_100531702 448
13 3300028379 Ga0268266_10140470 Ga0268266_101404702 448
14 3300046507 Ga0495606_0109975 Ga0495606_0109975_169_1521 448
15 3300046674 Ga0495588_0052486 Ga0495588_0052486_11_1363 448
16 3300047318 Ga0495636_0026929 Ga0495636_0026929_790_2142 448
17 3300061719 Ga0466962_0076905 Ga0466962_0076905_231_1583 448
18 3300031507 Ga0307509_10000025 Ga0307509_1000002538 449
19 3300046513 Ga0495616_0000358 Ga0495616_0000358_23261_24676 452
20 3300053158 Ga0500627_0000156 Ga0500627_0000156_1185_2600 452
21 3300013306 Ga0163162_10002965 Ga0163162_100029655 453
22 3300014325 Ga0163163_10000006 Ga0163163_10000006143 453
23 3300014968 Ga0157379_10199264 Ga0157379_101992641 453
24 3300046462 Ga0495651_0104106 Ga0495651_0104106_475_1899 453
25 3300047319 Ga0495674_0043424 Ga0495674_0043424_522_1892 453
26 3300048922 Ga0496119_0000436 Ga0496119_0000436_50686_52065 453
27 3300048923 Ga0496120_0000490 Ga0496120_0000490_51106_52485 453
28 3300053136 Ga0500559_0035149 Ga0500559_0035149_781_2148 455
29 3300009177 Ga0105248_10001123 Ga0105248_100011236 456
30 3300025941 Ga0207711_10004810 Ga0207711_100048108 456
31 3300005434 Ga0070709_10021518 Ga0070709_100215182 458
32 3300005545 Ga0070695_100001021 Ga0070695_1000010214 458
33 3300009093 Ga0105240_10085743 Ga0105240_100857432 458
34 3300048905 Ga0496102_0016892 Ga0496102_0016892_2925_4304 458
35 3300048920 Ga0496117_0000090 Ga0496117_0000090_64186_65565 458
36 3300048921 Ga0496118_0000032 Ga0496118_0000032_139472_140851 458
37 3300053119 Ga0500595_008863 Ga0500595_008863_1362_2780 458
38 3300031251 Ga0265327_10001467 Ga0265327_1000146725 461
39 3300033180 Ga0307510_10000006 Ga0307510_10000006251 461
40 3300006175 Ga0070712_100050570 Ga0070712_1000505703 462
41 iso_pu_bacteria 2643221605 2644040649 463
42 3300031616 Ga0307508_10104390 Ga0307508_101043902 464
43 3300005339 Ga0070660_100182454 Ga0070660_1001824542 465
44 3300005366 Ga0070659_100000316 Ga0070659_10000031622 465
45 3300005366 Ga0070659_100025594 Ga0070659_1000255944 465
46 3300025919 Ga0207657_10023525 Ga0207657_100235253 465
47 3300025932 Ga0207690_10000077 Ga0207690_1000007776 465
48 3300025941 Ga0207711_10000678 Ga0207711_1000067822 465
49 3300025949 Ga0207667_10027307 Ga0207667_100273075 465
50 3300026142 Ga0207698_10132803 Ga0207698_101328032 465
51 3300035724 Ga0373933_0009370 Ga0373933_0009370_722_2146 465
52 3300048088 Ga0495602_0039061 Ga0495602_0039061_2372_3796 465
53 3300048927 Ga0496124_0085703 Ga0496124_0085703_1085_2485 465
54 iso_pu_bacteria 2512564014 2512641931 465
55 3300009093 Ga0105240_10012475 Ga0105240_100124757 466
56 3300025913 Ga0207695_10009942 Ga0207695_100099426 466
57 3300028794 Ga0307515_10083939 Ga0307515_100839392 466
58 3300046460 Ga0495638_0041538 Ga0495638_0041538_1173_2597 466
59 3300046506 Ga0495583_0000279 Ga0495583_0000279_36544_37968 466
60 3300053103 Ga0500555_000121 Ga0500555_000121_10640_12064 466
61 3300005355 Ga0070671_100004599 Ga0070671_1000045999 467
62 3300005356 Ga0070674_100024769 Ga0070674_1000247694 467
63 3300005617 Ga0068859_100004470 Ga0068859_10000447010 467
64 3300005719 Ga0068861_100018076 Ga0068861_1000180764 467
65 3300006931 Ga0097620_100004470 Ga0097620_10000447010 467
66 3300009177 Ga0105248_10001554 Ga0105248_100015544 467
67 3300009551 Ga0105238_10017044 Ga0105238_100170446 467
68 3300010375 Ga0105239_10032806 Ga0105239_100328064 467
69 3300014968 Ga0157379_10050588 Ga0157379_100505884 467
70 3300025931 Ga0207644_10023798 Ga0207644_100237982 467
71 3300025933 Ga0207706_10130362 Ga0207706_101303622 467
72 3300025937 Ga0207669_10009945 Ga0207669_100099452 467
73 3300025941 Ga0207711_10001122 Ga0207711_1000112223 467
74 3300026118 Ga0207675_100000062 Ga0207675_10000006214 467
75 3300039447 Ga0436361_0064588 Ga0436361_0064588_884_2299 467
76 3300047443 Ga0495687_021412 Ga0495687_021412_1180_2586 467
77 3300053730 Ga0500645_028715 Ga0500645_028715_240_1646 467
78 3300005548 Ga0070665_100000221 Ga0070665_10000022170 468
79 3300005843 Ga0068860_100017236 Ga0068860_1000172363 468
80 3300005844 Ga0068862_100000149 Ga0068862_10000014934 468
81 3300009101 Ga0105247_10002474 Ga0105247_100024747 468
82 3300009553 Ga0105249_10000056 Ga0105249_10000056114 468
83 3300025900 Ga0207710_10002284 Ga0207710_100022844 468
84 3300025919 Ga0207657_10050069 Ga0207657_100500692 468
85 3300025961 Ga0207712_10000015 Ga0207712_10000015181 468
86 3300026035 Ga0207703_10025666 Ga0207703_100256663 468
87 3300026088 Ga0207641_10001266 Ga0207641_1000126622 468
88 3300028379 Ga0268266_10000005 Ga0268266_1000000569 468
89 3300028380 Ga0268265_10000021 Ga0268265_1000002164 468
90 3300028381 Ga0268264_10007933 Ga0268264_100079333 468
91 3300048918 Ga0496115_0010604 Ga0496115_0010604_4268_5683 468
92 3300048920 Ga0496117_0017798 Ga0496117_0017798_3133_4542 468
93 3300048921 Ga0496118_0119022 Ga0496118_0119022_168_1577 468
94 3300048927 Ga0496124_0093700 Ga0496124_0093700_569_1978 468
95 3300053153 Ga0500616_0021056 Ga0500616_0021056_1562_2971 468
96 3300005367 Ga0070667_100043205 Ga0070667_1000432054 469
97 3300005455 Ga0070663_100165266 Ga0070663_1001652661 469
98 3300005458 Ga0070681_10013138 Ga0070681_100131383 469
99 3300005539 Ga0068853_100002521 Ga0068853_1000025212 469
100 3300005539 Ga0068853_100210475 Ga0068853_1002104752 469
101 3300005548 Ga0070665_100032327 Ga0070665_1000323274 469
102 3300005577 Ga0068857_100055966 Ga0068857_1000559663 469
103 3300005616 Ga0068852_100017160 Ga0068852_1000171603 469
104 3300005841 Ga0068863_100012499 Ga0068863_1000124993 469
105 3300005842 Ga0068858_100008273 Ga0068858_1000082735 469
106 3300005843 Ga0068860_100000274 Ga0068860_10000027427 469
107 3300009101 Ga0105247_10058391 Ga0105247_100583912 469
108 3300009551 Ga0105238_10002100 Ga0105238_100021005 469
109 3300013104 Ga0157370_10160188 Ga0157370_101601882 469
110 3300013105 Ga0157369_10026893 Ga0157369_100268936 469
111 3300013105 Ga0157369_10261698 Ga0157369_102616981 469
112 3300013306 Ga0163162_10039502 Ga0163162_100395023 469
113 3300021361 Ga0213872_10001198 Ga0213872_1000119812 469
114 3300021361 Ga0213872_10001355 Ga0213872_1000135512 469
115 3300021361 Ga0213872_10023865 Ga0213872_100238652 469
116 3300021384 Ga0213876_10003019 Ga0213876_100030192 469
117 3300025298 Ga0209050_1029720 Ga0209050_10297202 469
118 3300025913 Ga0207695_10020816 Ga0207695_100208164 469
119 3300025924 Ga0207694_10032527 Ga0207694_100325272 469
120 3300025925 Ga0207650_10012656 Ga0207650_100126562 469
121 3300025986 Ga0207658_10069985 Ga0207658_100699852 469
122 3300026035 Ga0207703_10000667 Ga0207703_100006675 469
123 3300026067 Ga0207678_10126864 Ga0207678_101268642 469
124 3300026088 Ga0207641_10000290 Ga0207641_1000029016 469
125 3300026116 Ga0207674_10019862 Ga0207674_100198625 469
126 3300026121 Ga0207683_10145501 Ga0207683_101455011 469
127 3300026142 Ga0207698_10008164 Ga0207698_100081642 469
128 3300026142 Ga0207698_10056762 Ga0207698_100567623 469
129 3300028381 Ga0268264_10000058 Ga0268264_10000058278 469
130 3300028381 Ga0268264_10000060 Ga0268264_10000060272 469
131 3300031250 Ga0265331_10001981 Ga0265331_100019812 469
132 3300031456 Ga0307513_10059069 Ga0307513_100590693 469
133 3300035113 Ga0373936_0004088 Ga0373936_0004088_2327_3745 469
134 3300039447 Ga0436361_0014016 Ga0436361_0014016_1675_3099 469
135 3300039447 Ga0436361_0328321 Ga0436361_0328321_1383_2807 469
136 3300045049 Ga0466959_0063609 Ga0466959_0063609_445_1929 469
137 3300046507 Ga0495606_0001229 Ga0495606_0001229_33592_35004 469
138 3300046507 Ga0495606_0025393 Ga0495606_0025393_321_1733 469
139 3300046660 Ga0495625_0015548 Ga0495625_0015548_2275_3687 469
140 3300047469 Ga0495673_0006614 Ga0495673_0006614_5155_6573 469
141 3300047472 Ga0495686_0000139 Ga0495686_0000139_60584_61996 469
142 3300047472 Ga0495686_0003079 Ga0495686_0003079_12693_14105 469
143 3300048918 Ga0496115_0026649 Ga0496115_0026649_1320_2741 469
144 3300048918 Ga0496115_0036416 Ga0496115_0036416_1577_2995 469
145 3300048928 Ga0496125_0000592 Ga0496125_0000592_50214_51626 469
146 3300048929 Ga0496126_0012681 Ga0496126_0012681_2081_3493 469
147 3300049679 Ga0501249_000129 Ga0501249_000129_11728_13149 469
148 3300053087 Ga0500643_008373 Ga0500643_008373_744_2156 469
149 3300053104 Ga0500556_0000013 Ga0500556_0000013_38107_39519 469
150 3300053130 Ga0500642_0000002 Ga0500642_0000002_265546_266958 469
151 3300053157 Ga0500624_000544 Ga0500624_000544_8987_10405 469
152 3300053730 Ga0500645_000105 Ga0500645_000105_56141_57553 469
153 3300005367 Ga0070667_100000873 Ga0070667_10000087330 470
154 3300005841 Ga0068863_100061557 Ga0068863_1000615573 470
155 3300005843 Ga0068860_100000834 Ga0068860_10000083424 470
156 3300013306 Ga0163162_10001764 Ga0163162_100017643 470
157 3300015690 Ga0183363_1035 Ga0183363_103529 470
158 3300025315 Ga0207697_10021480 Ga0207697_100214801 470
159 3300025986 Ga0207658_10000545 Ga0207658_1000054514 470
160 3300026088 Ga0207641_10014087 Ga0207641_100140873 470
161 3300028381 Ga0268264_10000277 Ga0268264_1000027730 470
162 3300033180 Ga0307510_10005434 Ga0307510_100054346 470
163 3300046472 Ga0495580_0059879 Ga0495580_0059879_87_1511 470
164 3300046506 Ga0495583_0034344 Ga0495583_0034344_469_1884 470
165 3300046516 Ga0495628_0059477 Ga0495628_0059477_370_1794 470
166 3300046526 Ga0495666_0033647 Ga0495666_0033647_12_1436 470
167 3300046533 Ga0495640_0016348 Ga0495640_0016348_706_2130 470
168 3300046543 Ga0495645_0018790 Ga0495645_0018790_1388_2812 470
169 3300046616 Ga0495668_0014017 Ga0495668_0014017_366_1781 470
170 3300046663 Ga0495635_0045855 Ga0495635_0045855_1402_2826 470
171 3300046678 Ga0495599_0081170 Ga0495599_0081170_215_1639 470
172 3300046809 Ga0495600_0071108 Ga0495600_0071108_772_2196 470
173 3300047315 Ga0495581_0003045 Ga0495581_0003045_7405_8829 470
174 3300047317 Ga0495604_0014882 Ga0495604_0014882_3939_5363 470
175 3300047319 Ga0495674_0030061 Ga0495674_0030061_2404_3828 470
176 3300047321 Ga0495676_0005613 Ga0495676_0005613_8048_9472 470
177 3300047445 Ga0495677_0023028 Ga0495677_0023028_416_1831 470
178 3300048089 Ga0495614_0000707 Ga0495614_0000707_12329_13753 470
179 3300053087 Ga0500643_001425 Ga0500643_001425_8270_9685 470
180 3300053136 Ga0500559_0006336 Ga0500559_0006336_1856_3271 470
181 3300005439 Ga0070711_100022956 Ga0070711_1000229562 471
182 3300005844 Ga0068862_100001856 Ga0068862_10000185613 471
183 3300009093 Ga0105240_10098490 Ga0105240_100984904 471
184 3300013296 Ga0157374_10148476 Ga0157374_101484762 471
185 3300014325 Ga0163163_10030511 Ga0163163_100305114 471
186 3300025913 Ga0207695_10076423 Ga0207695_100764233 471
187 3300028379 Ga0268266_10002612 Ga0268266_1000261210 471
188 3300028380 Ga0268265_10005048 Ga0268265_100050482 471
189 3300031247 Ga0265340_10081717 Ga0265340_100817171 471
190 3300031507 Ga0307509_10000074 Ga0307509_1000007453 471
191 3300031616 Ga0307508_10005365 Ga0307508_100053654 471
192 3300044656 Ga0466969_0020308 Ga0466969_0020308_376_1800 471
193 3300045049 Ga0466959_0040849 Ga0466959_0040849_59_1483 471
194 3300048918 Ga0496115_0113248 Ga0496115_0113248_598_2154 471
195 3300048928 Ga0496125_0049091 Ga0496125_0049091_399_1925 471
196 3300048929 Ga0496126_0000147 Ga0496126_0000147_14369_15925 471
197 3300005262 Ga0065165_1001930 Ga0065165_10019304 472
198 3300030521 Ga0307511_10012047 Ga0307511_100120477 472
199 3300044656 Ga0466969_0010513 Ga0466969_0010513_1750_3183 472
200 3300044684 Ga0466966_0005349 Ga0466966_0005349_4158_5591 472
201 3300044693 Ga0466961_0011546 Ga0466961_0011546_1015_2448 472
202 3300044719 Ga0466971_0032887 Ga0466971_0032887_620_2053 472
203 3300044765 Ga0466970_0017929 Ga0466970_0017929_2150_3583 472
204 3300044842 Ga0466957_0017271 Ga0466957_0017271_485_1918 472
205 3300045049 Ga0466959_0032332 Ga0466959_0032332_428_1861 472
206 3300046528 Ga0495642_0066347 Ga0495642_0066347_29_1456 472
207 3300047443 Ga0495687_031345 Ga0495687_031345_694_2121 472
208 3300048923 Ga0496120_0000106 Ga0496120_0000106_17672_19102 472

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

102

445

0.89

PF04389

Peptidase_M28

Peptidase family M28

86

294

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.8655 33 202
3ct9-assembly1.cif.gz_B crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution 0.8634 30 465
3ct9-assembly1.cif.gz_B crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution 0.8383 30 465
4h2k-assembly1.cif.gz_A crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.8341 28 467
4ppz-assembly1.cif.gz_A crystal structure of zinc-bound succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 0.8327 32 471
ID Description Score Start End Superfamily
af_Q55DP8_2_191_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.89 33 202 3.40.630.10
af_Q4CR09_10_160_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8781 37 191 3.40.630.10
af_Q4CYZ5_13_177_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8712 40 200 3.40.630.10
af_Q2FWN8_3_180_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8663 31 200 3.40.630.10
1q7lC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8652 33 202 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A4Q3C9A6-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9788 34 402 GO:0004180
GO:0051603
AF-A0A7Y8MEJ4-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9737 38 472 GO:0006508
GO:0008233
AF-A0A7Y8MEJ4-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9715 38 472 GO:0006508
GO:0008233
AF-A0A534A333-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.971 109 457 GO:0006508
GO:0008233
AF-A0A4Q3C9A6-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.971 34 402 GO:0004180
GO:0051603

Feature Viewer

pLDDT pTM Quality
90.11 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map