F317550
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 208 | 144 | 207 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100581083|Ga0068855_1005810832 |
| Length | 95 |
| Sequence | MRLTSDARCFSIRCMRTTLDIADDVLQAAKERARRENKTAGEVISELARAALTMPVPTATKASEPRAHYGIRPFPKRGGVVTNELIDRLREDDAY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 45 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 99 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 101 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 102 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 103 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 104 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 105 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 109 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 110 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 111 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 112 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 119 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 120 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 121 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 122 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 123 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 124 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 125 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 126 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 130 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 131 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 134 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 135 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 136 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.17 |
| Rhizosphere | 90.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1007894 | 3300000546 | Bacteria | 1146 |
| 2 | Ga0070658_10872205 | 3300005327 | Bacteria | 782 |
| 3 | Ga0070676_10106821 | 3300005328 | Unclassified | 1737 |
| 4 | Ga0070683_100423967 | 3300005329 | Bacteria | 1269 |
| 5 | Ga0070690_101117635 | 3300005330 | Bacteria | 626 |
| 6 | Ga0070666_10673675 | 3300005335 | Unclassified | 757 |
| 7 | Ga0070666_11420550 | 3300005335 | Unclassified | 518 |
| 8 | Ga0070680_101199841 | 3300005336 | Unclassified | 656 |
| 9 | Ga0068868_100121594 | 3300005338 | Bacteria | 2130 |
| 10 | Ga0070687_101471916 | 3300005343 | Unclassified | 511 |
| 11 | Ga0070661_100458551 | 3300005344 | Unclassified | 1015 |
| 12 | Ga0070669_100111486 | 3300005353 | Bacteria | 2076 |
| 13 | Ga0070675_102035546 | 3300005354 | Unclassified | 529 |
| 14 | Ga0070674_101131407 | 3300005356 | Unclassified | 692 |
| 15 | Ga0070659_101130581 | 3300005366 | Unclassified | 691 |
| 16 | Ga0070659_102002957 | 3300005366 | Bacteria | 520 |
| 17 | Ga0070709_11511481 | 3300005434 | Unclassified | 545 |
| 18 | Ga0070714_100232054 | 3300005435 | Unclassified | 1700 |
| 19 | Ga0070714_101639817 | 3300005435 | Unclassified | 628 |
| 20 | Ga0070701_10184700 | 3300005438 | Bacteria | 1223 |
| 21 | Ga0070705_101351986 | 3300005440 | Unclassified | 592 |
| 22 | Ga0070678_100983563 | 3300005456 | Unclassified | 775 |
| 23 | Ga0070662_100130410 | 3300005457 | Bacteria | 1937 |
| 24 | Ga0068867_100382569 | 3300005459 | Bacteria | 1182 |
| 25 | Ga0068867_100996896 | 3300005459 | Bacteria | 759 |
| 26 | Ga0070699_100966440 | 3300005518 | Unclassified | 781 |
| 27 | Ga0070679_101080390 | 3300005530 | Bacteria | 747 |
| 28 | Ga0070684_100668745 | 3300005535 | Bacteria | 967 |
| 29 | Ga0070697_101487617 | 3300005536 | Bacteria | 605 |
| 30 | Ga0070672_100230913 | 3300005543 | Bacteria | 1554 |
| 31 | Ga0070686_100448663 | 3300005544 | Bacteria | 991 |
| 32 | Ga0070696_101471413 | 3300005546 | Bacteria | 582 |
| 33 | Ga0068855_100581083 | 3300005563 | Bacteria | 1210 |
| 34 | Ga0070664_100092816 | 3300005564 | Bacteria | 2614 |
| 35 | Ga0068857_100670034 | 3300005577 | Bacteria | 984 |
| 36 | Ga0068854_100851266 | 3300005578 | Bacteria | 798 |
| 37 | Ga0068852_100003917 | 3300005616 | Bacteria | 10457 |
| 38 | Ga0068852_100130549 | 3300005616 | Bacteria | 2313 |
| 39 | Ga0068852_101815636 | 3300005616 | Bacteria | 632 |
| 40 | Ga0068852_102802064 | 3300005616 | Unclassified | 506 |
| 41 | Ga0068859_102592235 | 3300005617 | Unclassified | 558 |
| 42 | Ga0068864_100358373 | 3300005618 | Bacteria | 1378 |
| 43 | Ga0068864_100421560 | 3300005618 | Bacteria | 1272 |
| 44 | Ga0068864_102081832 | 3300005618 | Bacteria | 574 |
| 45 | Ga0068864_102257199 | 3300005618 | Bacteria | 551 |
| 46 | Ga0068851_10086150 | 3300005834 | Unclassified | 1648 |
| 47 | Ga0068870_10614735 | 3300005840 | Bacteria | 740 |
| 48 | Ga0068858_100948256 | 3300005842 | Unclassified | 842 |
| 49 | Ga0068858_100950135 | 3300005842 | Unclassified | 841 |
| 50 | Ga0068862_100139161 | 3300005844 | Bacteria | 2153 |
| 51 | Ga0068862_101282369 | 3300005844 | Unclassified | 733 |
| 52 | Ga0070717_10732275 | 3300006028 | Unclassified | 899 |
| 53 | Ga0097621_100058944 | 3300006237 | Unclassified | 3142 |
| 54 | Ga0097621_100199832 | 3300006237 | Bacteria | 1735 |
| 55 | Ga0097621_100522900 | 3300006237 | Bacteria | 1077 |
| 56 | Ga0097621_100682823 | 3300006237 | Unclassified | 944 |
| 57 | Ga0097621_101283290 | 3300006237 | Unclassified | 691 |
| 58 | Ga0068871_100004043 | 3300006358 | Bacteria | 10138 |
| 59 | Ga0068871_100225023 | 3300006358 | Bacteria | 1627 |
| 60 | Ga0068871_100624018 | 3300006358 | Unclassified | 982 |
| 61 | Ga0075428_100409814 | 3300006844 | Bacteria | 1452 |
| 62 | Ga0075428_100540354 | 3300006844 | Unclassified | 1246 |
| 63 | Ga0075428_101070101 | 3300006844 | Bacteria | 852 |
| 64 | Ga0075428_101511315 | 3300006844 | Unclassified | 703 |
| 65 | Ga0075430_100097780 | 3300006846 | Bacteria | 2452 |
| 66 | Ga0075430_100270826 | 3300006846 | Bacteria | 1405 |
| 67 | Ga0075431_100742271 | 3300006847 | Bacteria | 957 |
| 68 | Ga0075431_100828356 | 3300006847 | Bacteria | 897 |
| 69 | Ga0075429_100362342 | 3300006880 | Bacteria | 1269 |
| 70 | Ga0075429_100816459 | 3300006880 | Bacteria | 816 |
| 71 | Ga0097620_102592025 | 3300006931 | Unclassified | 558 |
| 72 | Ga0075435_101480003 | 3300007076 | Unclassified | 595 |
| 73 | Ga0105240_10458275 | 3300009093 | Unclassified | 1425 |
| 74 | Ga0105240_11003699 | 3300009093 | Archaea | 892 |
| 75 | Ga0111539_10026611 | 3300009094 | Bacteria | 7071 |
| 76 | Ga0105245_10301112 | 3300009098 | Bacteria | 1573 |
| 77 | Ga0105245_10573165 | 3300009098 | Bacteria | 1153 |
| 78 | Ga0105245_11053633 | 3300009098 | Unclassified | 859 |
| 79 | Ga0114129_11523020 | 3300009147 | Unclassified | 821 |
| 80 | Ga0105242_10271043 | 3300009176 | Bacteria | 1538 |
| 81 | Ga0105242_10281305 | 3300009176 | Bacteria | 1511 |
| 82 | Ga0105248_10393040 | 3300009177 | Bacteria | 1561 |
| 83 | Ga0105248_10634562 | 3300009177 | Unclassified | 1205 |
| 84 | Ga0105248_12156720 | 3300009177 | Bacteria | 634 |
| 85 | Ga0105238_11406319 | 3300009551 | Bacteria | 725 |
| 86 | Ga0105249_12413654 | 3300009553 | Bacteria | 598 |
| 87 | Ga0105249_12967320 | 3300009553 | Bacteria | 545 |
| 88 | Ga0105246_11343241 | 3300011119 | Unclassified | 664 |
| 89 | Ga0157369_10330181 | 3300013105 | Bacteria | 1585 |
| 90 | Ga0157374_10275518 | 3300013296 | Bacteria | 1660 |
| 91 | Ga0163162_11110592 | 3300013306 | Unclassified | 896 |
| 92 | Ga0163163_10116430 | 3300014325 | Bacteria | 2704 |
| 93 | Ga0163163_10432571 | 3300014325 | Bacteria | 1375 |
| 94 | Ga0157380_10374090 | 3300014326 | Bacteria | 1342 |
| 95 | Ga0157379_10266039 | 3300014968 | Bacteria | 1559 |
| 96 | Ga0207656_10076145 | 3300025321 | Unclassified | 1500 |
| 97 | Ga0207680_10555567 | 3300025903 | Unclassified | 820 |
| 98 | Ga0207699_11263587 | 3300025906 | Unclassified | 546 |
| 99 | Ga0207645_10115719 | 3300025907 | Unclassified | 1738 |
| 100 | Ga0207645_10346646 | 3300025907 | Viruses | 993 |
| 101 | Ga0207643_10017070 | 3300025908 | Bacteria | 3964 |
| 102 | Ga0207705_10050552 | 3300025909 | Unclassified | 2993 |
| 103 | Ga0207705_10106189 | 3300025909 | Bacteria | 2071 |
| 104 | Ga0207705_10310388 | 3300025909 | Bacteria | 1211 |
| 105 | Ga0207695_10438972 | 3300025913 | Unclassified | 1189 |
| 106 | Ga0207695_10968383 | 3300025913 | Archaea | 730 |
| 107 | Ga0207649_10682051 | 3300025920 | Unclassified | 796 |
| 108 | Ga0207687_10665846 | 3300025927 | Unclassified | 881 |
| 109 | Ga0207664_10117351 | 3300025929 | Unclassified | 2222 |
| 110 | Ga0207664_11499122 | 3300025929 | Bacteria | 596 |
| 111 | Ga0207706_10283550 | 3300025933 | Bacteria | 1444 |
| 112 | Ga0207686_11442217 | 3300025934 | Bacteria | 567 |
| 113 | Ga0207670_10442205 | 3300025936 | Bacteria | 1047 |
| 114 | Ga0207669_11303157 | 3300025937 | Unclassified | 617 |
| 115 | Ga0207704_11163124 | 3300025938 | Bacteria | 657 |
| 116 | Ga0207691_10329972 | 3300025940 | Bacteria | 1307 |
| 117 | Ga0207711_11691034 | 3300025941 | Unclassified | 576 |
| 118 | Ga0207711_11923307 | 3300025941 | Unclassified | 534 |
| 119 | Ga0207712_11770959 | 3300025961 | Bacteria | 553 |
| 120 | Ga0207668_10009973 | 3300025972 | Bacteria | 5716 |
| 121 | Ga0207640_11162053 | 3300025981 | Bacteria | 685 |
| 122 | Ga0207677_10626664 | 3300026023 | Unclassified | 947 |
| 123 | Ga0207703_10871802 | 3300026035 | Unclassified | 861 |
| 124 | Ga0207703_11701508 | 3300026035 | Bacteria | 607 |
| 125 | Ga0207708_10875914 | 3300026075 | Bacteria | 776 |
| 126 | Ga0207648_10208134 | 3300026089 | Bacteria | 1736 |
| 127 | Ga0207648_10514985 | 3300026089 | Bacteria | 1096 |
| 128 | Ga0207676_10379879 | 3300026095 | Bacteria | 1315 |
| 129 | Ga0207676_12032849 | 3300026095 | Bacteria | 573 |
| 130 | Ga0207675_100135961 | 3300026118 | Bacteria | 2332 |
| 131 | Ga0207698_10009267 | 3300026142 | Bacteria | 6265 |
| 132 | Ga0207698_10898757 | 3300026142 | Bacteria | 893 |
| 133 | Ga0207698_11408574 | 3300026142 | Bacteria | 712 |
| 134 | Ga0207698_11956135 | 3300026142 | Bacteria | 601 |
| 135 | Ga0209982_1010820 | 3300027552 | Bacteria | 1355 |
| 136 | Ga0210002_1006485 | 3300027617 | Bacteria | 1767 |
| 137 | Ga0209983_1007194 | 3300027665 | Bacteria | 2283 |
| 138 | Ga0209966_1126574 | 3300027695 | Bacteria | 588 |
| 139 | Ga0209974_10004050 | 3300027876 | Bacteria | 5239 |
| 140 | Ga0268265_10545951 | 3300028380 | Bacteria | 1099 |
| 141 | Ga0268265_11513439 | 3300028380 | Unclassified | 675 |
| 142 | Ga0268264_12635774 | 3300028381 | Unclassified | 507 |
| 143 | Ga0307508_10040377 | 3300031616 | Bacteria | 4189 |
| 144 | Ga0307508_10152732 | 3300031616 | Bacteria | 1913 |
| 145 | Ga0307405_10579476 | 3300031731 | Bacteria | 912 |
| 146 | Ga0307413_10138200 | 3300031824 | Bacteria | 1679 |
| 147 | Ga0307410_10334594 | 3300031852 | Bacteria | 1205 |
| 148 | Ga0307410_11210128 | 3300031852 | Unclassified | 658 |
| 149 | Ga0326468_10067283 | 3300031889 | Unclassified | 586 |
| 150 | Ga0307406_10534281 | 3300031901 | Bacteria | 956 |
| 151 | Ga0307406_10739435 | 3300031901 | Bacteria | 825 |
| 152 | Ga0307407_10008601 | 3300031903 | Bacteria | 4699 |
| 153 | Ga0307407_11554697 | 3300031903 | Bacteria | 524 |
| 154 | Ga0307412_10067579 | 3300031911 | Bacteria | 2427 |
| 155 | Ga0307412_10409280 | 3300031911 | Bacteria | 1107 |
| 156 | Ga0307409_100060175 | 3300031995 | Bacteria | 2960 |
| 157 | Ga0307416_100120333 | 3300032002 | Bacteria | 2338 |
| 158 | Ga0307416_102933881 | 3300032002 | Unclassified | 571 |
| 159 | Ga0307414_10497741 | 3300032004 | Bacteria | 1078 |
| 160 | Ga0307411_12123629 | 3300032005 | Bacteria | 526 |
| 161 | Ga0307415_100348705 | 3300032126 | Bacteria | 1245 |
| 162 | Ga0373961_0341976 | 3300035241 | Unclassified | 562 |
| 163 | Ga0395899_0572517 | 3300037312 | Archaea | 723 |
| 164 | Ga0395905_0610470 | 3300037471 | Archaea | 993 |
| 165 | Ga0395901_0211084 | 3300038443 | Unclassified | 2032 |
| 166 | Ga0451795_0487749 | 3300041456 | Unclassified | 668 |
| 167 | Ga0451804_0801453 | 3300041463 | Unclassified | 628 |
| 168 | Ga0451807_1823370 | 3300041486 | Unclassified | 656 |
| 169 | Ga0451807_2159200 | 3300041486 | Unclassified | 544 |
| 170 | Ga0451807_2585915 | 3300041486 | Bacteria | 1514 |
| 171 | Ga0451851_1334464 | 3300041507 | Bacteria | 641 |
| 172 | Ga0450923_009885 | 3300042125 | Bacteria | 1679 |
| 173 | Ga0450896_005312 | 3300042133 | Bacteria | 1756 |
| 174 | Ga0450899_026584 | 3300042135 | Bacteria | 693 |
| 175 | Ga0450910_101888 | 3300042147 | Bacteria | 516 |
| 176 | Ga0450918_073227 | 3300042531 | Bacteria | 645 |
| 177 | Ga0450893_0032602 | 3300042532 | Bacteria | 933 |
| 178 | Ga0451577_0834311 | 3300042876 | Unclassified | 832 |
| 179 | Ga0451577_1604892 | 3300042876 | Unclassified | 574 |
| 180 | Ga0495598_0174135 | 3300046537 | Unclassified | 764 |
| 181 | Ga0495598_0213836 | 3300046537 | Bacteria | 701 |
| 182 | Ga0495621_0009850 | 3300046539 | Bacteria | 2915 |
| 183 | Ga0495621_0137506 | 3300046539 | Unclassified | 954 |
| 184 | Ga0495670_0101456 | 3300046691 | Bacteria | 1482 |
| 185 | Ga0496104_0003465 | 3300048907 | Bacteria | 13599 |
| 186 | Ga0496105_0050858 | 3300048908 | Bacteria | 3424 |
| 187 | Ga0496105_0509797 | 3300048908 | Unclassified | 943 |
| 188 | Ga0496108_1201489 | 3300048911 | Unclassified | 641 |
| 189 | Ga0496109_0118850 | 3300048912 | Bacteria | 2461 |
| 190 | Ga0496109_1451142 | 3300048912 | Unclassified | 621 |
| 191 | Ga0496110_0119683 | 3300048913 | Bacteria | 2372 |
| 192 | Ga0496110_0127237 | 3300048913 | Bacteria | 2299 |
| 193 | Ga0496111_0256637 | 3300048914 | Bacteria | 1297 |
| 194 | Ga0496111_1223184 | 3300048914 | Unclassified | 532 |
| 195 | Ga0496114_0000031 | 3300048917 | Bacteria | 168230 |
| 196 | Ga0501067_0004468 | 3300049583 | Bacteria | 7714 |
| 197 | Ga0501080_0974821 | 3300049742 | Bacteria | 736 |
| 198 | Ga0501083_0008997 | 3300049744 | Bacteria | 7048 |
| 199 | nmdc:mga05p37_1179833_c1 | 3300050507 | Unclassified | 793 |
| 200 | nmdc:mga09592_306807_c1 | 3300050508 | Bacteria | 1376 |
| 201 | nmdc:mga09592_91829_c1 | 3300050508 | Bacteria | 2595 |
| 202 | nmdc:mga0qj67_114957_c1 | 3300050509 | Bacteria | 2174 |
| 203 | nmdc:mga0qj67_311821_c1 | 3300050509 | Bacteria | 1274 |
| 204 | nmdc:mga06r32_172548_c1 | 3300050510 | Bacteria | 2147 |
| 205 | nmdc:mga06r32_65457_c1 | 3300050510 | Bacteria | 3506 |
| 206 | nmdc:mga08y16_623785_c1 | 3300050511 | Bacteria | 1085 |
| 207 | nmdc:mga08x19_331657_c1 | 3300050514 | Bacteria | 1060 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005354 | Ga0070675_102035546 | Ga0070675_1020355461 | 63 |
| 2 | 3300005344 | Ga0070661_100458551 | Ga0070661_1004585512 | 76 |
| 3 | 3300005366 | Ga0070659_102002957 | Ga0070659_1020029572 | 76 |
| 4 | 3300005564 | Ga0070664_100092816 | Ga0070664_1000928163 | 76 |
| 5 | 3300025920 | Ga0207649_10682051 | Ga0207649_106820512 | 76 |
| 6 | 3300031731 | Ga0307405_10579476 | Ga0307405_105794761 | 76 |
| 7 | 3300031824 | Ga0307413_10138200 | Ga0307413_101382002 | 76 |
| 8 | 3300031852 | Ga0307410_10334594 | Ga0307410_103345942 | 76 |
| 9 | 3300031901 | Ga0307406_10534281 | Ga0307406_105342812 | 76 |
| 10 | 3300031903 | Ga0307407_10008601 | Ga0307407_100086015 | 76 |
| 11 | 3300031911 | Ga0307412_10067579 | Ga0307412_100675793 | 76 |
| 12 | 3300031995 | Ga0307409_100060175 | Ga0307409_1000601752 | 76 |
| 13 | 3300032004 | Ga0307414_10497741 | Ga0307414_104977412 | 76 |
| 14 | 3300032005 | Ga0307411_12123629 | Ga0307411_121236292 | 76 |
| 15 | 3300032126 | Ga0307415_100348705 | Ga0307415_1003487052 | 76 |
| 16 | 3300050514 | nmdc:mga08x19_331657_c1 | nmdc:mga08x19_331657_c1_328_564 | 76 |
| 17 | 3300042147 | Ga0450910_101888 | Ga0450910_101888_101_340 | 77 |
| 18 | 3300042876 | Ga0451577_1604892 | Ga0451577_1604892_44_283 | 77 |
| 19 | 3300005330 | Ga0070690_101117635 | Ga0070690_1011176351 | 78 |
| 20 | 3300005336 | Ga0070680_101199841 | Ga0070680_1011998412 | 78 |
| 21 | 3300005353 | Ga0070669_100111486 | Ga0070669_1001114863 | 78 |
| 22 | 3300005457 | Ga0070662_100130410 | Ga0070662_1001304104 | 78 |
| 23 | 3300005459 | Ga0068867_100382569 | Ga0068867_1003825693 | 78 |
| 24 | 3300005518 | Ga0070699_100966440 | Ga0070699_1009664402 | 78 |
| 25 | 3300005543 | Ga0070672_100230913 | Ga0070672_1002309132 | 78 |
| 26 | 3300005546 | Ga0070696_101471413 | Ga0070696_1014714132 | 78 |
| 27 | 3300005577 | Ga0068857_100670034 | Ga0068857_1006700342 | 78 |
| 28 | 3300005618 | Ga0068864_100358373 | Ga0068864_1003583731 | 78 |
| 29 | 3300005618 | Ga0068864_102081832 | Ga0068864_1020818321 | 78 |
| 30 | 3300005840 | Ga0068870_10614735 | Ga0068870_106147352 | 78 |
| 31 | 3300005844 | Ga0068862_100139161 | Ga0068862_1001391614 | 78 |
| 32 | 3300006844 | Ga0075428_100409814 | Ga0075428_1004098142 | 78 |
| 33 | 3300006844 | Ga0075428_101070101 | Ga0075428_1010701012 | 78 |
| 34 | 3300006846 | Ga0075430_100097780 | Ga0075430_1000977803 | 78 |
| 35 | 3300006846 | Ga0075430_100270826 | Ga0075430_1002708263 | 78 |
| 36 | 3300006847 | Ga0075431_100742271 | Ga0075431_1007422712 | 78 |
| 37 | 3300006847 | Ga0075431_100828356 | Ga0075431_1008283562 | 78 |
| 38 | 3300006880 | Ga0075429_100362342 | Ga0075429_1003623422 | 78 |
| 39 | 3300006880 | Ga0075429_100816459 | Ga0075429_1008164592 | 78 |
| 40 | 3300009094 | Ga0111539_10026611 | Ga0111539_100266113 | 78 |
| 41 | 3300009553 | Ga0105249_12967320 | Ga0105249_129673202 | 78 |
| 42 | 3300013105 | Ga0157369_10330181 | Ga0157369_103301812 | 78 |
| 43 | 3300014326 | Ga0157380_10374090 | Ga0157380_103740903 | 78 |
| 44 | 3300025908 | Ga0207643_10017070 | Ga0207643_100170702 | 78 |
| 45 | 3300025933 | Ga0207706_10283550 | Ga0207706_102835502 | 78 |
| 46 | 3300025938 | Ga0207704_11163124 | Ga0207704_111631242 | 78 |
| 47 | 3300025940 | Ga0207691_10329972 | Ga0207691_103299722 | 78 |
| 48 | 3300025972 | Ga0207668_10009973 | Ga0207668_100099737 | 78 |
| 49 | 3300026075 | Ga0207708_10875914 | Ga0207708_108759141 | 78 |
| 50 | 3300026089 | Ga0207648_10208134 | Ga0207648_102081343 | 78 |
| 51 | 3300026118 | Ga0207675_100135961 | Ga0207675_1001359613 | 78 |
| 52 | 3300027552 | Ga0209982_1010820 | Ga0209982_10108204 | 78 |
| 53 | 3300027617 | Ga0210002_1006485 | Ga0210002_10064852 | 78 |
| 54 | 3300027665 | Ga0209983_1007194 | Ga0209983_10071943 | 78 |
| 55 | 3300027695 | Ga0209966_1126574 | Ga0209966_11265741 | 78 |
| 56 | 3300027876 | Ga0209974_10004050 | Ga0209974_100040505 | 78 |
| 57 | 3300028380 | Ga0268265_10545951 | Ga0268265_105459513 | 78 |
| 58 | 3300028380 | Ga0268265_11513439 | Ga0268265_115134392 | 78 |
| 59 | 3300031911 | Ga0307412_10409280 | Ga0307412_104092803 | 78 |
| 60 | 3300032002 | Ga0307416_100120333 | Ga0307416_1001203332 | 78 |
| 61 | 3300041486 | Ga0451807_1823370 | Ga0451807_1823370_262_504 | 78 |
| 62 | 3300042125 | Ga0450923_009885 | Ga0450923_009885_793_1035 | 78 |
| 63 | 3300042133 | Ga0450896_005312 | Ga0450896_005312_724_966 | 78 |
| 64 | 3300042135 | Ga0450899_026584 | Ga0450899_026584_114_356 | 78 |
| 65 | 3300042531 | Ga0450918_073227 | Ga0450918_073227_52_294 | 78 |
| 66 | 3300042532 | Ga0450893_0032602 | Ga0450893_0032602_313_555 | 78 |
| 67 | 3300049742 | Ga0501080_0974821 | Ga0501080_0974821_63_308 | 78 |
| 68 | 3300050508 | nmdc:mga09592_306807_c1 | nmdc:mga09592_306807_c1_334_576 | 78 |
| 69 | 3300050508 | nmdc:mga09592_91829_c1 | nmdc:mga09592_91829_c1_357_599 | 78 |
| 70 | 3300050509 | nmdc:mga0qj67_114957_c1 | nmdc:mga0qj67_114957_c1_650_892 | 78 |
| 71 | 3300050509 | nmdc:mga0qj67_311821_c1 | nmdc:mga0qj67_311821_c1_692_934 | 78 |
| 72 | 3300050510 | nmdc:mga06r32_172548_c1 | nmdc:mga06r32_172548_c1_617_859 | 78 |
| 73 | 3300050510 | nmdc:mga06r32_65457_c1 | nmdc:mga06r32_65457_c1_1901_2143 | 78 |
| 74 | 3300050511 | nmdc:mga08y16_623785_c1 | nmdc:mga08y16_623785_c1_434_676 | 78 |
| 75 | 3300005328 | Ga0070676_10106821 | Ga0070676_101068214 | 79 |
| 76 | 3300005335 | Ga0070666_10673675 | Ga0070666_106736752 | 79 |
| 77 | 3300005338 | Ga0068868_100121594 | Ga0068868_1001215945 | 79 |
| 78 | 3300005343 | Ga0070687_101471916 | Ga0070687_1014719161 | 79 |
| 79 | 3300005356 | Ga0070674_101131407 | Ga0070674_1011314072 | 79 |
| 80 | 3300005366 | Ga0070659_101130581 | Ga0070659_1011305811 | 79 |
| 81 | 3300005434 | Ga0070709_11511481 | Ga0070709_115114811 | 79 |
| 82 | 3300005435 | Ga0070714_100232054 | Ga0070714_1002320543 | 79 |
| 83 | 3300005435 | Ga0070714_101639817 | Ga0070714_1016398171 | 79 |
| 84 | 3300005438 | Ga0070701_10184700 | Ga0070701_101847002 | 79 |
| 85 | 3300005440 | Ga0070705_101351986 | Ga0070705_1013519861 | 79 |
| 86 | 3300005456 | Ga0070678_100983563 | Ga0070678_1009835631 | 79 |
| 87 | 3300005459 | Ga0068867_100996896 | Ga0068867_1009968962 | 79 |
| 88 | 3300005535 | Ga0070684_100668745 | Ga0070684_1006687452 | 79 |
| 89 | 3300005536 | Ga0070697_101487617 | Ga0070697_1014876171 | 79 |
| 90 | 3300005544 | Ga0070686_100448663 | Ga0070686_1004486632 | 79 |
| 91 | 3300005563 | Ga0068855_100581083 | Ga0068855_1005810832 | 79 |
| 92 | 3300005578 | Ga0068854_100851266 | Ga0068854_1008512662 | 79 |
| 93 | 3300005616 | Ga0068852_100003917 | Ga0068852_1000039174 | 79 |
| 94 | 3300005616 | Ga0068852_100130549 | Ga0068852_1001305493 | 79 |
| 95 | 3300005616 | Ga0068852_102802064 | Ga0068852_1028020642 | 79 |
| 96 | 3300005617 | Ga0068859_102592235 | Ga0068859_1025922352 | 79 |
| 97 | 3300005618 | Ga0068864_100421560 | Ga0068864_1004215601 | 79 |
| 98 | 3300005618 | Ga0068864_102257199 | Ga0068864_1022571992 | 79 |
| 99 | 3300005834 | Ga0068851_10086150 | Ga0068851_100861502 | 79 |
| 100 | 3300005842 | Ga0068858_100948256 | Ga0068858_1009482561 | 79 |
| 101 | 3300005842 | Ga0068858_100950135 | Ga0068858_1009501352 | 79 |
| 102 | 3300006028 | Ga0070717_10732275 | Ga0070717_107322752 | 79 |
| 103 | 3300006237 | Ga0097621_100058944 | Ga0097621_1000589447 | 79 |
| 104 | 3300006237 | Ga0097621_100522900 | Ga0097621_1005229003 | 79 |
| 105 | 3300006237 | Ga0097621_100682823 | Ga0097621_1006828232 | 79 |
| 106 | 3300006237 | Ga0097621_101283290 | Ga0097621_1012832902 | 79 |
| 107 | 3300006358 | Ga0068871_100004043 | Ga0068871_10000404310 | 79 |
| 108 | 3300006358 | Ga0068871_100225023 | Ga0068871_1002250234 | 79 |
| 109 | 3300006358 | Ga0068871_100624018 | Ga0068871_1006240182 | 79 |
| 110 | 3300006931 | Ga0097620_102592025 | Ga0097620_1025920252 | 79 |
| 111 | 3300009093 | Ga0105240_10458275 | Ga0105240_104582753 | 79 |
| 112 | 3300009093 | Ga0105240_11003699 | Ga0105240_110036992 | 79 |
| 113 | 3300009098 | Ga0105245_10301112 | Ga0105245_103011125 | 79 |
| 114 | 3300009098 | Ga0105245_10573165 | Ga0105245_105731653 | 79 |
| 115 | 3300009147 | Ga0114129_11523020 | Ga0114129_115230202 | 79 |
| 116 | 3300009176 | Ga0105242_10271043 | Ga0105242_102710432 | 79 |
| 117 | 3300009176 | Ga0105242_10281305 | Ga0105242_102813053 | 79 |
| 118 | 3300009177 | Ga0105248_10393040 | Ga0105248_103930403 | 79 |
| 119 | 3300009177 | Ga0105248_10634562 | Ga0105248_106345622 | 79 |
| 120 | 3300009551 | Ga0105238_11406319 | Ga0105238_114063192 | 79 |
| 121 | 3300009553 | Ga0105249_12413654 | Ga0105249_124136542 | 79 |
| 122 | 3300011119 | Ga0105246_11343241 | Ga0105246_113432411 | 79 |
| 123 | 3300013296 | Ga0157374_10275518 | Ga0157374_102755182 | 79 |
| 124 | 3300013306 | Ga0163162_11110592 | Ga0163162_111105921 | 79 |
| 125 | 3300014325 | Ga0163163_10116430 | Ga0163163_101164304 | 79 |
| 126 | 3300014968 | Ga0157379_10266039 | Ga0157379_102660392 | 79 |
| 127 | 3300025321 | Ga0207656_10076145 | Ga0207656_100761451 | 79 |
| 128 | 3300025903 | Ga0207680_10555567 | Ga0207680_105555671 | 79 |
| 129 | 3300025906 | Ga0207699_11263587 | Ga0207699_112635872 | 79 |
| 130 | 3300025907 | Ga0207645_10115719 | Ga0207645_101157194 | 79 |
| 131 | 3300025907 | Ga0207645_10346646 | Ga0207645_103466462 | 79 |
| 132 | 3300025909 | Ga0207705_10050552 | Ga0207705_100505523 | 79 |
| 133 | 3300025909 | Ga0207705_10106189 | Ga0207705_101061894 | 79 |
| 134 | 3300025913 | Ga0207695_10438972 | Ga0207695_104389723 | 79 |
| 135 | 3300025913 | Ga0207695_10968383 | Ga0207695_109683832 | 79 |
| 136 | 3300025927 | Ga0207687_10665846 | Ga0207687_106658462 | 79 |
| 137 | 3300025929 | Ga0207664_10117351 | Ga0207664_101173512 | 79 |
| 138 | 3300025929 | Ga0207664_11499122 | Ga0207664_114991222 | 79 |
| 139 | 3300025934 | Ga0207686_11442217 | Ga0207686_114422171 | 79 |
| 140 | 3300025936 | Ga0207670_10442205 | Ga0207670_104422052 | 79 |
| 141 | 3300025937 | Ga0207669_11303157 | Ga0207669_113031572 | 79 |
| 142 | 3300025941 | Ga0207711_11691034 | Ga0207711_116910342 | 79 |
| 143 | 3300025961 | Ga0207712_11770959 | Ga0207712_117709591 | 79 |
| 144 | 3300025981 | Ga0207640_11162053 | Ga0207640_111620532 | 79 |
| 145 | 3300026023 | Ga0207677_10626664 | Ga0207677_106266642 | 79 |
| 146 | 3300026035 | Ga0207703_10871802 | Ga0207703_108718022 | 79 |
| 147 | 3300026035 | Ga0207703_11701508 | Ga0207703_117015082 | 79 |
| 148 | 3300026089 | Ga0207648_10514985 | Ga0207648_105149852 | 79 |
| 149 | 3300026095 | Ga0207676_10379879 | Ga0207676_103798793 | 79 |
| 150 | 3300026095 | Ga0207676_12032849 | Ga0207676_120328492 | 79 |
| 151 | 3300026142 | Ga0207698_10009267 | Ga0207698_100092675 | 79 |
| 152 | 3300026142 | Ga0207698_10898757 | Ga0207698_108987572 | 79 |
| 153 | 3300031616 | Ga0307508_10040377 | Ga0307508_100403775 | 79 |
| 154 | 3300031616 | Ga0307508_10152732 | Ga0307508_101527324 | 79 |
| 155 | 3300031852 | Ga0307410_11210128 | Ga0307410_112101282 | 79 |
| 156 | 3300031889 | Ga0326468_10067283 | Ga0326468_100672832 | 79 |
| 157 | 3300031901 | Ga0307406_10739435 | Ga0307406_107394352 | 79 |
| 158 | 3300031903 | Ga0307407_11554697 | Ga0307407_115546972 | 79 |
| 159 | 3300032002 | Ga0307416_102933881 | Ga0307416_1029338811 | 79 |
| 160 | 3300035241 | Ga0373961_0341976 | Ga0373961_0341976_74_319 | 79 |
| 161 | 3300037312 | Ga0395899_0572517 | Ga0395899_0572517_241_486 | 79 |
| 162 | 3300037471 | Ga0395905_0610470 | Ga0395905_0610470_306_551 | 79 |
| 163 | 3300038443 | Ga0395901_0211084 | Ga0395901_0211084_1659_1904 | 79 |
| 164 | 3300041456 | Ga0451795_0487749 | Ga0451795_0487749_221_466 | 79 |
| 165 | 3300041463 | Ga0451804_0801453 | Ga0451804_0801453_206_511 | 79 |
| 166 | 3300041486 | Ga0451807_2159200 | Ga0451807_2159200_131_379 | 79 |
| 167 | 3300041486 | Ga0451807_2585915 | Ga0451807_2585915_135_380 | 79 |
| 168 | 3300041507 | Ga0451851_1334464 | Ga0451851_1334464_58_306 | 79 |
| 169 | 3300042876 | Ga0451577_0834311 | Ga0451577_0834311_93_332 | 79 |
| 170 | 3300046537 | Ga0495598_0174135 | Ga0495598_0174135_459_707 | 79 |
| 171 | 3300046537 | Ga0495598_0213836 | Ga0495598_0213836_423_671 | 79 |
| 172 | 3300046539 | Ga0495621_0009850 | Ga0495621_0009850_2087_2335 | 79 |
| 173 | 3300046539 | Ga0495621_0137506 | Ga0495621_0137506_178_426 | 79 |
| 174 | 3300046691 | Ga0495670_0101456 | Ga0495670_0101456_716_964 | 79 |
| 175 | 3300048907 | Ga0496104_0003465 | Ga0496104_0003465_11654_11899 | 79 |
| 176 | 3300048907 | Ga0496104_0003465 | Ga0496104_0003465_797_1045 | 79 |
| 177 | 3300048908 | Ga0496105_0050858 | Ga0496105_0050858_1699_1944 | 79 |
| 178 | 3300048908 | Ga0496105_0509797 | Ga0496105_0509797_609_854 | 79 |
| 179 | 3300048911 | Ga0496108_1201489 | Ga0496108_1201489_83_328 | 79 |
| 180 | 3300048912 | Ga0496109_0118850 | Ga0496109_0118850_1108_1356 | 79 |
| 181 | 3300048912 | Ga0496109_1451142 | Ga0496109_1451142_276_521 | 79 |
| 182 | 3300048913 | Ga0496110_0119683 | Ga0496110_0119683_2052_2297 | 79 |
| 183 | 3300048913 | Ga0496110_0127237 | Ga0496110_0127237_48_296 | 79 |
| 184 | 3300048914 | Ga0496111_0256637 | Ga0496111_0256637_932_1180 | 79 |
| 185 | 3300048914 | Ga0496111_1223184 | Ga0496111_1223184_55_321 | 79 |
| 186 | 3300048917 | Ga0496114_0000031 | Ga0496114_0000031_76039_76284 | 79 |
| 187 | 3300049744 | Ga0501083_0008997 | Ga0501083_0008997_3022_3267 | 79 |
| 188 | 3300050507 | nmdc:mga05p37_1179833_c1 | nmdc:mga05p37_1179833_c1_290_538 | 79 |
| 189 | 3300000546 | LJNas_1007894 | LJNas_10078943 | 80 |
| 190 | 3300005327 | Ga0070658_10872205 | Ga0070658_108722051 | 80 |
| 191 | 3300005329 | Ga0070683_100423967 | Ga0070683_1004239672 | 80 |
| 192 | 3300005335 | Ga0070666_11420550 | Ga0070666_114205501 | 80 |
| 193 | 3300005530 | Ga0070679_101080390 | Ga0070679_1010803902 | 80 |
| 194 | 3300005616 | Ga0068852_101815636 | Ga0068852_1018156362 | 80 |
| 195 | 3300005844 | Ga0068862_101282369 | Ga0068862_1012823692 | 80 |
| 196 | 3300006237 | Ga0097621_100199832 | Ga0097621_1001998322 | 80 |
| 197 | 3300006844 | Ga0075428_100540354 | Ga0075428_1005403542 | 80 |
| 198 | 3300006844 | Ga0075428_101511315 | Ga0075428_1015113152 | 80 |
| 199 | 3300007076 | Ga0075435_101480003 | Ga0075435_1014800032 | 80 |
| 200 | 3300009098 | Ga0105245_11053633 | Ga0105245_110536332 | 80 |
| 201 | 3300009177 | Ga0105248_12156720 | Ga0105248_121567202 | 80 |
| 202 | 3300014325 | Ga0163163_10432571 | Ga0163163_104325712 | 80 |
| 203 | 3300025909 | Ga0207705_10310388 | Ga0207705_103103882 | 80 |
| 204 | 3300025941 | Ga0207711_11923307 | Ga0207711_119233071 | 80 |
| 205 | 3300026142 | Ga0207698_11408574 | Ga0207698_114085742 | 80 |
| 206 | 3300026142 | Ga0207698_11956135 | Ga0207698_119561351 | 80 |
| 207 | 3300028381 | Ga0268264_12635774 | Ga0268264_126357741 | 80 |
| 208 | 3300049583 | Ga0501067_0004468 | Ga0501067_0004468_429_677 | 80 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar