F317550

General Info

Members Datasets Scaffolds Average Seq Length
208 144 207 81

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100581083|Ga0068855_1005810832
Length 95
Sequence MRLTSDARCFSIRCMRTTLDIADDVLQAAKERARRENKTAGEVISELARAALTMPVPTATKASEPRAHYGIRPFPKRGGVVTNELIDRLREDDAY

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
116 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
119 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
120 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
121 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
122 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
123 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
124 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.17
Rhizosphere 90.38
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1007894 3300000546 Bacteria 1146
2 Ga0070658_10872205 3300005327 Bacteria 782
3 Ga0070676_10106821 3300005328 Unclassified 1737
4 Ga0070683_100423967 3300005329 Bacteria 1269
5 Ga0070690_101117635 3300005330 Bacteria 626
6 Ga0070666_10673675 3300005335 Unclassified 757
7 Ga0070666_11420550 3300005335 Unclassified 518
8 Ga0070680_101199841 3300005336 Unclassified 656
9 Ga0068868_100121594 3300005338 Bacteria 2130
10 Ga0070687_101471916 3300005343 Unclassified 511
11 Ga0070661_100458551 3300005344 Unclassified 1015
12 Ga0070669_100111486 3300005353 Bacteria 2076
13 Ga0070675_102035546 3300005354 Unclassified 529
14 Ga0070674_101131407 3300005356 Unclassified 692
15 Ga0070659_101130581 3300005366 Unclassified 691
16 Ga0070659_102002957 3300005366 Bacteria 520
17 Ga0070709_11511481 3300005434 Unclassified 545
18 Ga0070714_100232054 3300005435 Unclassified 1700
19 Ga0070714_101639817 3300005435 Unclassified 628
20 Ga0070701_10184700 3300005438 Bacteria 1223
21 Ga0070705_101351986 3300005440 Unclassified 592
22 Ga0070678_100983563 3300005456 Unclassified 775
23 Ga0070662_100130410 3300005457 Bacteria 1937
24 Ga0068867_100382569 3300005459 Bacteria 1182
25 Ga0068867_100996896 3300005459 Bacteria 759
26 Ga0070699_100966440 3300005518 Unclassified 781
27 Ga0070679_101080390 3300005530 Bacteria 747
28 Ga0070684_100668745 3300005535 Bacteria 967
29 Ga0070697_101487617 3300005536 Bacteria 605
30 Ga0070672_100230913 3300005543 Bacteria 1554
31 Ga0070686_100448663 3300005544 Bacteria 991
32 Ga0070696_101471413 3300005546 Bacteria 582
33 Ga0068855_100581083 3300005563 Bacteria 1210
34 Ga0070664_100092816 3300005564 Bacteria 2614
35 Ga0068857_100670034 3300005577 Bacteria 984
36 Ga0068854_100851266 3300005578 Bacteria 798
37 Ga0068852_100003917 3300005616 Bacteria 10457
38 Ga0068852_100130549 3300005616 Bacteria 2313
39 Ga0068852_101815636 3300005616 Bacteria 632
40 Ga0068852_102802064 3300005616 Unclassified 506
41 Ga0068859_102592235 3300005617 Unclassified 558
42 Ga0068864_100358373 3300005618 Bacteria 1378
43 Ga0068864_100421560 3300005618 Bacteria 1272
44 Ga0068864_102081832 3300005618 Bacteria 574
45 Ga0068864_102257199 3300005618 Bacteria 551
46 Ga0068851_10086150 3300005834 Unclassified 1648
47 Ga0068870_10614735 3300005840 Bacteria 740
48 Ga0068858_100948256 3300005842 Unclassified 842
49 Ga0068858_100950135 3300005842 Unclassified 841
50 Ga0068862_100139161 3300005844 Bacteria 2153
51 Ga0068862_101282369 3300005844 Unclassified 733
52 Ga0070717_10732275 3300006028 Unclassified 899
53 Ga0097621_100058944 3300006237 Unclassified 3142
54 Ga0097621_100199832 3300006237 Bacteria 1735
55 Ga0097621_100522900 3300006237 Bacteria 1077
56 Ga0097621_100682823 3300006237 Unclassified 944
57 Ga0097621_101283290 3300006237 Unclassified 691
58 Ga0068871_100004043 3300006358 Bacteria 10138
59 Ga0068871_100225023 3300006358 Bacteria 1627
60 Ga0068871_100624018 3300006358 Unclassified 982
61 Ga0075428_100409814 3300006844 Bacteria 1452
62 Ga0075428_100540354 3300006844 Unclassified 1246
63 Ga0075428_101070101 3300006844 Bacteria 852
64 Ga0075428_101511315 3300006844 Unclassified 703
65 Ga0075430_100097780 3300006846 Bacteria 2452
66 Ga0075430_100270826 3300006846 Bacteria 1405
67 Ga0075431_100742271 3300006847 Bacteria 957
68 Ga0075431_100828356 3300006847 Bacteria 897
69 Ga0075429_100362342 3300006880 Bacteria 1269
70 Ga0075429_100816459 3300006880 Bacteria 816
71 Ga0097620_102592025 3300006931 Unclassified 558
72 Ga0075435_101480003 3300007076 Unclassified 595
73 Ga0105240_10458275 3300009093 Unclassified 1425
74 Ga0105240_11003699 3300009093 Archaea 892
75 Ga0111539_10026611 3300009094 Bacteria 7071
76 Ga0105245_10301112 3300009098 Bacteria 1573
77 Ga0105245_10573165 3300009098 Bacteria 1153
78 Ga0105245_11053633 3300009098 Unclassified 859
79 Ga0114129_11523020 3300009147 Unclassified 821
80 Ga0105242_10271043 3300009176 Bacteria 1538
81 Ga0105242_10281305 3300009176 Bacteria 1511
82 Ga0105248_10393040 3300009177 Bacteria 1561
83 Ga0105248_10634562 3300009177 Unclassified 1205
84 Ga0105248_12156720 3300009177 Bacteria 634
85 Ga0105238_11406319 3300009551 Bacteria 725
86 Ga0105249_12413654 3300009553 Bacteria 598
87 Ga0105249_12967320 3300009553 Bacteria 545
88 Ga0105246_11343241 3300011119 Unclassified 664
89 Ga0157369_10330181 3300013105 Bacteria 1585
90 Ga0157374_10275518 3300013296 Bacteria 1660
91 Ga0163162_11110592 3300013306 Unclassified 896
92 Ga0163163_10116430 3300014325 Bacteria 2704
93 Ga0163163_10432571 3300014325 Bacteria 1375
94 Ga0157380_10374090 3300014326 Bacteria 1342
95 Ga0157379_10266039 3300014968 Bacteria 1559
96 Ga0207656_10076145 3300025321 Unclassified 1500
97 Ga0207680_10555567 3300025903 Unclassified 820
98 Ga0207699_11263587 3300025906 Unclassified 546
99 Ga0207645_10115719 3300025907 Unclassified 1738
100 Ga0207645_10346646 3300025907 Viruses 993
101 Ga0207643_10017070 3300025908 Bacteria 3964
102 Ga0207705_10050552 3300025909 Unclassified 2993
103 Ga0207705_10106189 3300025909 Bacteria 2071
104 Ga0207705_10310388 3300025909 Bacteria 1211
105 Ga0207695_10438972 3300025913 Unclassified 1189
106 Ga0207695_10968383 3300025913 Archaea 730
107 Ga0207649_10682051 3300025920 Unclassified 796
108 Ga0207687_10665846 3300025927 Unclassified 881
109 Ga0207664_10117351 3300025929 Unclassified 2222
110 Ga0207664_11499122 3300025929 Bacteria 596
111 Ga0207706_10283550 3300025933 Bacteria 1444
112 Ga0207686_11442217 3300025934 Bacteria 567
113 Ga0207670_10442205 3300025936 Bacteria 1047
114 Ga0207669_11303157 3300025937 Unclassified 617
115 Ga0207704_11163124 3300025938 Bacteria 657
116 Ga0207691_10329972 3300025940 Bacteria 1307
117 Ga0207711_11691034 3300025941 Unclassified 576
118 Ga0207711_11923307 3300025941 Unclassified 534
119 Ga0207712_11770959 3300025961 Bacteria 553
120 Ga0207668_10009973 3300025972 Bacteria 5716
121 Ga0207640_11162053 3300025981 Bacteria 685
122 Ga0207677_10626664 3300026023 Unclassified 947
123 Ga0207703_10871802 3300026035 Unclassified 861
124 Ga0207703_11701508 3300026035 Bacteria 607
125 Ga0207708_10875914 3300026075 Bacteria 776
126 Ga0207648_10208134 3300026089 Bacteria 1736
127 Ga0207648_10514985 3300026089 Bacteria 1096
128 Ga0207676_10379879 3300026095 Bacteria 1315
129 Ga0207676_12032849 3300026095 Bacteria 573
130 Ga0207675_100135961 3300026118 Bacteria 2332
131 Ga0207698_10009267 3300026142 Bacteria 6265
132 Ga0207698_10898757 3300026142 Bacteria 893
133 Ga0207698_11408574 3300026142 Bacteria 712
134 Ga0207698_11956135 3300026142 Bacteria 601
135 Ga0209982_1010820 3300027552 Bacteria 1355
136 Ga0210002_1006485 3300027617 Bacteria 1767
137 Ga0209983_1007194 3300027665 Bacteria 2283
138 Ga0209966_1126574 3300027695 Bacteria 588
139 Ga0209974_10004050 3300027876 Bacteria 5239
140 Ga0268265_10545951 3300028380 Bacteria 1099
141 Ga0268265_11513439 3300028380 Unclassified 675
142 Ga0268264_12635774 3300028381 Unclassified 507
143 Ga0307508_10040377 3300031616 Bacteria 4189
144 Ga0307508_10152732 3300031616 Bacteria 1913
145 Ga0307405_10579476 3300031731 Bacteria 912
146 Ga0307413_10138200 3300031824 Bacteria 1679
147 Ga0307410_10334594 3300031852 Bacteria 1205
148 Ga0307410_11210128 3300031852 Unclassified 658
149 Ga0326468_10067283 3300031889 Unclassified 586
150 Ga0307406_10534281 3300031901 Bacteria 956
151 Ga0307406_10739435 3300031901 Bacteria 825
152 Ga0307407_10008601 3300031903 Bacteria 4699
153 Ga0307407_11554697 3300031903 Bacteria 524
154 Ga0307412_10067579 3300031911 Bacteria 2427
155 Ga0307412_10409280 3300031911 Bacteria 1107
156 Ga0307409_100060175 3300031995 Bacteria 2960
157 Ga0307416_100120333 3300032002 Bacteria 2338
158 Ga0307416_102933881 3300032002 Unclassified 571
159 Ga0307414_10497741 3300032004 Bacteria 1078
160 Ga0307411_12123629 3300032005 Bacteria 526
161 Ga0307415_100348705 3300032126 Bacteria 1245
162 Ga0373961_0341976 3300035241 Unclassified 562
163 Ga0395899_0572517 3300037312 Archaea 723
164 Ga0395905_0610470 3300037471 Archaea 993
165 Ga0395901_0211084 3300038443 Unclassified 2032
166 Ga0451795_0487749 3300041456 Unclassified 668
167 Ga0451804_0801453 3300041463 Unclassified 628
168 Ga0451807_1823370 3300041486 Unclassified 656
169 Ga0451807_2159200 3300041486 Unclassified 544
170 Ga0451807_2585915 3300041486 Bacteria 1514
171 Ga0451851_1334464 3300041507 Bacteria 641
172 Ga0450923_009885 3300042125 Bacteria 1679
173 Ga0450896_005312 3300042133 Bacteria 1756
174 Ga0450899_026584 3300042135 Bacteria 693
175 Ga0450910_101888 3300042147 Bacteria 516
176 Ga0450918_073227 3300042531 Bacteria 645
177 Ga0450893_0032602 3300042532 Bacteria 933
178 Ga0451577_0834311 3300042876 Unclassified 832
179 Ga0451577_1604892 3300042876 Unclassified 574
180 Ga0495598_0174135 3300046537 Unclassified 764
181 Ga0495598_0213836 3300046537 Bacteria 701
182 Ga0495621_0009850 3300046539 Bacteria 2915
183 Ga0495621_0137506 3300046539 Unclassified 954
184 Ga0495670_0101456 3300046691 Bacteria 1482
185 Ga0496104_0003465 3300048907 Bacteria 13599
186 Ga0496105_0050858 3300048908 Bacteria 3424
187 Ga0496105_0509797 3300048908 Unclassified 943
188 Ga0496108_1201489 3300048911 Unclassified 641
189 Ga0496109_0118850 3300048912 Bacteria 2461
190 Ga0496109_1451142 3300048912 Unclassified 621
191 Ga0496110_0119683 3300048913 Bacteria 2372
192 Ga0496110_0127237 3300048913 Bacteria 2299
193 Ga0496111_0256637 3300048914 Bacteria 1297
194 Ga0496111_1223184 3300048914 Unclassified 532
195 Ga0496114_0000031 3300048917 Bacteria 168230
196 Ga0501067_0004468 3300049583 Bacteria 7714
197 Ga0501080_0974821 3300049742 Bacteria 736
198 Ga0501083_0008997 3300049744 Bacteria 7048
199 nmdc:mga05p37_1179833_c1 3300050507 Unclassified 793
200 nmdc:mga09592_306807_c1 3300050508 Bacteria 1376
201 nmdc:mga09592_91829_c1 3300050508 Bacteria 2595
202 nmdc:mga0qj67_114957_c1 3300050509 Bacteria 2174
203 nmdc:mga0qj67_311821_c1 3300050509 Bacteria 1274
204 nmdc:mga06r32_172548_c1 3300050510 Bacteria 2147
205 nmdc:mga06r32_65457_c1 3300050510 Bacteria 3506
206 nmdc:mga08y16_623785_c1 3300050511 Bacteria 1085
207 nmdc:mga08x19_331657_c1 3300050514 Bacteria 1060

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_102035546 Ga0070675_1020355461 63
2 3300005344 Ga0070661_100458551 Ga0070661_1004585512 76
3 3300005366 Ga0070659_102002957 Ga0070659_1020029572 76
4 3300005564 Ga0070664_100092816 Ga0070664_1000928163 76
5 3300025920 Ga0207649_10682051 Ga0207649_106820512 76
6 3300031731 Ga0307405_10579476 Ga0307405_105794761 76
7 3300031824 Ga0307413_10138200 Ga0307413_101382002 76
8 3300031852 Ga0307410_10334594 Ga0307410_103345942 76
9 3300031901 Ga0307406_10534281 Ga0307406_105342812 76
10 3300031903 Ga0307407_10008601 Ga0307407_100086015 76
11 3300031911 Ga0307412_10067579 Ga0307412_100675793 76
12 3300031995 Ga0307409_100060175 Ga0307409_1000601752 76
13 3300032004 Ga0307414_10497741 Ga0307414_104977412 76
14 3300032005 Ga0307411_12123629 Ga0307411_121236292 76
15 3300032126 Ga0307415_100348705 Ga0307415_1003487052 76
16 3300050514 nmdc:mga08x19_331657_c1 nmdc:mga08x19_331657_c1_328_564 76
17 3300042147 Ga0450910_101888 Ga0450910_101888_101_340 77
18 3300042876 Ga0451577_1604892 Ga0451577_1604892_44_283 77
19 3300005330 Ga0070690_101117635 Ga0070690_1011176351 78
20 3300005336 Ga0070680_101199841 Ga0070680_1011998412 78
21 3300005353 Ga0070669_100111486 Ga0070669_1001114863 78
22 3300005457 Ga0070662_100130410 Ga0070662_1001304104 78
23 3300005459 Ga0068867_100382569 Ga0068867_1003825693 78
24 3300005518 Ga0070699_100966440 Ga0070699_1009664402 78
25 3300005543 Ga0070672_100230913 Ga0070672_1002309132 78
26 3300005546 Ga0070696_101471413 Ga0070696_1014714132 78
27 3300005577 Ga0068857_100670034 Ga0068857_1006700342 78
28 3300005618 Ga0068864_100358373 Ga0068864_1003583731 78
29 3300005618 Ga0068864_102081832 Ga0068864_1020818321 78
30 3300005840 Ga0068870_10614735 Ga0068870_106147352 78
31 3300005844 Ga0068862_100139161 Ga0068862_1001391614 78
32 3300006844 Ga0075428_100409814 Ga0075428_1004098142 78
33 3300006844 Ga0075428_101070101 Ga0075428_1010701012 78
34 3300006846 Ga0075430_100097780 Ga0075430_1000977803 78
35 3300006846 Ga0075430_100270826 Ga0075430_1002708263 78
36 3300006847 Ga0075431_100742271 Ga0075431_1007422712 78
37 3300006847 Ga0075431_100828356 Ga0075431_1008283562 78
38 3300006880 Ga0075429_100362342 Ga0075429_1003623422 78
39 3300006880 Ga0075429_100816459 Ga0075429_1008164592 78
40 3300009094 Ga0111539_10026611 Ga0111539_100266113 78
41 3300009553 Ga0105249_12967320 Ga0105249_129673202 78
42 3300013105 Ga0157369_10330181 Ga0157369_103301812 78
43 3300014326 Ga0157380_10374090 Ga0157380_103740903 78
44 3300025908 Ga0207643_10017070 Ga0207643_100170702 78
45 3300025933 Ga0207706_10283550 Ga0207706_102835502 78
46 3300025938 Ga0207704_11163124 Ga0207704_111631242 78
47 3300025940 Ga0207691_10329972 Ga0207691_103299722 78
48 3300025972 Ga0207668_10009973 Ga0207668_100099737 78
49 3300026075 Ga0207708_10875914 Ga0207708_108759141 78
50 3300026089 Ga0207648_10208134 Ga0207648_102081343 78
51 3300026118 Ga0207675_100135961 Ga0207675_1001359613 78
52 3300027552 Ga0209982_1010820 Ga0209982_10108204 78
53 3300027617 Ga0210002_1006485 Ga0210002_10064852 78
54 3300027665 Ga0209983_1007194 Ga0209983_10071943 78
55 3300027695 Ga0209966_1126574 Ga0209966_11265741 78
56 3300027876 Ga0209974_10004050 Ga0209974_100040505 78
57 3300028380 Ga0268265_10545951 Ga0268265_105459513 78
58 3300028380 Ga0268265_11513439 Ga0268265_115134392 78
59 3300031911 Ga0307412_10409280 Ga0307412_104092803 78
60 3300032002 Ga0307416_100120333 Ga0307416_1001203332 78
61 3300041486 Ga0451807_1823370 Ga0451807_1823370_262_504 78
62 3300042125 Ga0450923_009885 Ga0450923_009885_793_1035 78
63 3300042133 Ga0450896_005312 Ga0450896_005312_724_966 78
64 3300042135 Ga0450899_026584 Ga0450899_026584_114_356 78
65 3300042531 Ga0450918_073227 Ga0450918_073227_52_294 78
66 3300042532 Ga0450893_0032602 Ga0450893_0032602_313_555 78
67 3300049742 Ga0501080_0974821 Ga0501080_0974821_63_308 78
68 3300050508 nmdc:mga09592_306807_c1 nmdc:mga09592_306807_c1_334_576 78
69 3300050508 nmdc:mga09592_91829_c1 nmdc:mga09592_91829_c1_357_599 78
70 3300050509 nmdc:mga0qj67_114957_c1 nmdc:mga0qj67_114957_c1_650_892 78
71 3300050509 nmdc:mga0qj67_311821_c1 nmdc:mga0qj67_311821_c1_692_934 78
72 3300050510 nmdc:mga06r32_172548_c1 nmdc:mga06r32_172548_c1_617_859 78
73 3300050510 nmdc:mga06r32_65457_c1 nmdc:mga06r32_65457_c1_1901_2143 78
74 3300050511 nmdc:mga08y16_623785_c1 nmdc:mga08y16_623785_c1_434_676 78
75 3300005328 Ga0070676_10106821 Ga0070676_101068214 79
76 3300005335 Ga0070666_10673675 Ga0070666_106736752 79
77 3300005338 Ga0068868_100121594 Ga0068868_1001215945 79
78 3300005343 Ga0070687_101471916 Ga0070687_1014719161 79
79 3300005356 Ga0070674_101131407 Ga0070674_1011314072 79
80 3300005366 Ga0070659_101130581 Ga0070659_1011305811 79
81 3300005434 Ga0070709_11511481 Ga0070709_115114811 79
82 3300005435 Ga0070714_100232054 Ga0070714_1002320543 79
83 3300005435 Ga0070714_101639817 Ga0070714_1016398171 79
84 3300005438 Ga0070701_10184700 Ga0070701_101847002 79
85 3300005440 Ga0070705_101351986 Ga0070705_1013519861 79
86 3300005456 Ga0070678_100983563 Ga0070678_1009835631 79
87 3300005459 Ga0068867_100996896 Ga0068867_1009968962 79
88 3300005535 Ga0070684_100668745 Ga0070684_1006687452 79
89 3300005536 Ga0070697_101487617 Ga0070697_1014876171 79
90 3300005544 Ga0070686_100448663 Ga0070686_1004486632 79
91 3300005563 Ga0068855_100581083 Ga0068855_1005810832 79
92 3300005578 Ga0068854_100851266 Ga0068854_1008512662 79
93 3300005616 Ga0068852_100003917 Ga0068852_1000039174 79
94 3300005616 Ga0068852_100130549 Ga0068852_1001305493 79
95 3300005616 Ga0068852_102802064 Ga0068852_1028020642 79
96 3300005617 Ga0068859_102592235 Ga0068859_1025922352 79
97 3300005618 Ga0068864_100421560 Ga0068864_1004215601 79
98 3300005618 Ga0068864_102257199 Ga0068864_1022571992 79
99 3300005834 Ga0068851_10086150 Ga0068851_100861502 79
100 3300005842 Ga0068858_100948256 Ga0068858_1009482561 79
101 3300005842 Ga0068858_100950135 Ga0068858_1009501352 79
102 3300006028 Ga0070717_10732275 Ga0070717_107322752 79
103 3300006237 Ga0097621_100058944 Ga0097621_1000589447 79
104 3300006237 Ga0097621_100522900 Ga0097621_1005229003 79
105 3300006237 Ga0097621_100682823 Ga0097621_1006828232 79
106 3300006237 Ga0097621_101283290 Ga0097621_1012832902 79
107 3300006358 Ga0068871_100004043 Ga0068871_10000404310 79
108 3300006358 Ga0068871_100225023 Ga0068871_1002250234 79
109 3300006358 Ga0068871_100624018 Ga0068871_1006240182 79
110 3300006931 Ga0097620_102592025 Ga0097620_1025920252 79
111 3300009093 Ga0105240_10458275 Ga0105240_104582753 79
112 3300009093 Ga0105240_11003699 Ga0105240_110036992 79
113 3300009098 Ga0105245_10301112 Ga0105245_103011125 79
114 3300009098 Ga0105245_10573165 Ga0105245_105731653 79
115 3300009147 Ga0114129_11523020 Ga0114129_115230202 79
116 3300009176 Ga0105242_10271043 Ga0105242_102710432 79
117 3300009176 Ga0105242_10281305 Ga0105242_102813053 79
118 3300009177 Ga0105248_10393040 Ga0105248_103930403 79
119 3300009177 Ga0105248_10634562 Ga0105248_106345622 79
120 3300009551 Ga0105238_11406319 Ga0105238_114063192 79
121 3300009553 Ga0105249_12413654 Ga0105249_124136542 79
122 3300011119 Ga0105246_11343241 Ga0105246_113432411 79
123 3300013296 Ga0157374_10275518 Ga0157374_102755182 79
124 3300013306 Ga0163162_11110592 Ga0163162_111105921 79
125 3300014325 Ga0163163_10116430 Ga0163163_101164304 79
126 3300014968 Ga0157379_10266039 Ga0157379_102660392 79
127 3300025321 Ga0207656_10076145 Ga0207656_100761451 79
128 3300025903 Ga0207680_10555567 Ga0207680_105555671 79
129 3300025906 Ga0207699_11263587 Ga0207699_112635872 79
130 3300025907 Ga0207645_10115719 Ga0207645_101157194 79
131 3300025907 Ga0207645_10346646 Ga0207645_103466462 79
132 3300025909 Ga0207705_10050552 Ga0207705_100505523 79
133 3300025909 Ga0207705_10106189 Ga0207705_101061894 79
134 3300025913 Ga0207695_10438972 Ga0207695_104389723 79
135 3300025913 Ga0207695_10968383 Ga0207695_109683832 79
136 3300025927 Ga0207687_10665846 Ga0207687_106658462 79
137 3300025929 Ga0207664_10117351 Ga0207664_101173512 79
138 3300025929 Ga0207664_11499122 Ga0207664_114991222 79
139 3300025934 Ga0207686_11442217 Ga0207686_114422171 79
140 3300025936 Ga0207670_10442205 Ga0207670_104422052 79
141 3300025937 Ga0207669_11303157 Ga0207669_113031572 79
142 3300025941 Ga0207711_11691034 Ga0207711_116910342 79
143 3300025961 Ga0207712_11770959 Ga0207712_117709591 79
144 3300025981 Ga0207640_11162053 Ga0207640_111620532 79
145 3300026023 Ga0207677_10626664 Ga0207677_106266642 79
146 3300026035 Ga0207703_10871802 Ga0207703_108718022 79
147 3300026035 Ga0207703_11701508 Ga0207703_117015082 79
148 3300026089 Ga0207648_10514985 Ga0207648_105149852 79
149 3300026095 Ga0207676_10379879 Ga0207676_103798793 79
150 3300026095 Ga0207676_12032849 Ga0207676_120328492 79
151 3300026142 Ga0207698_10009267 Ga0207698_100092675 79
152 3300026142 Ga0207698_10898757 Ga0207698_108987572 79
153 3300031616 Ga0307508_10040377 Ga0307508_100403775 79
154 3300031616 Ga0307508_10152732 Ga0307508_101527324 79
155 3300031852 Ga0307410_11210128 Ga0307410_112101282 79
156 3300031889 Ga0326468_10067283 Ga0326468_100672832 79
157 3300031901 Ga0307406_10739435 Ga0307406_107394352 79
158 3300031903 Ga0307407_11554697 Ga0307407_115546972 79
159 3300032002 Ga0307416_102933881 Ga0307416_1029338811 79
160 3300035241 Ga0373961_0341976 Ga0373961_0341976_74_319 79
161 3300037312 Ga0395899_0572517 Ga0395899_0572517_241_486 79
162 3300037471 Ga0395905_0610470 Ga0395905_0610470_306_551 79
163 3300038443 Ga0395901_0211084 Ga0395901_0211084_1659_1904 79
164 3300041456 Ga0451795_0487749 Ga0451795_0487749_221_466 79
165 3300041463 Ga0451804_0801453 Ga0451804_0801453_206_511 79
166 3300041486 Ga0451807_2159200 Ga0451807_2159200_131_379 79
167 3300041486 Ga0451807_2585915 Ga0451807_2585915_135_380 79
168 3300041507 Ga0451851_1334464 Ga0451851_1334464_58_306 79
169 3300042876 Ga0451577_0834311 Ga0451577_0834311_93_332 79
170 3300046537 Ga0495598_0174135 Ga0495598_0174135_459_707 79
171 3300046537 Ga0495598_0213836 Ga0495598_0213836_423_671 79
172 3300046539 Ga0495621_0009850 Ga0495621_0009850_2087_2335 79
173 3300046539 Ga0495621_0137506 Ga0495621_0137506_178_426 79
174 3300046691 Ga0495670_0101456 Ga0495670_0101456_716_964 79
175 3300048907 Ga0496104_0003465 Ga0496104_0003465_11654_11899 79
176 3300048907 Ga0496104_0003465 Ga0496104_0003465_797_1045 79
177 3300048908 Ga0496105_0050858 Ga0496105_0050858_1699_1944 79
178 3300048908 Ga0496105_0509797 Ga0496105_0509797_609_854 79
179 3300048911 Ga0496108_1201489 Ga0496108_1201489_83_328 79
180 3300048912 Ga0496109_0118850 Ga0496109_0118850_1108_1356 79
181 3300048912 Ga0496109_1451142 Ga0496109_1451142_276_521 79
182 3300048913 Ga0496110_0119683 Ga0496110_0119683_2052_2297 79
183 3300048913 Ga0496110_0127237 Ga0496110_0127237_48_296 79
184 3300048914 Ga0496111_0256637 Ga0496111_0256637_932_1180 79
185 3300048914 Ga0496111_1223184 Ga0496111_1223184_55_321 79
186 3300048917 Ga0496114_0000031 Ga0496114_0000031_76039_76284 79
187 3300049744 Ga0501083_0008997 Ga0501083_0008997_3022_3267 79
188 3300050507 nmdc:mga05p37_1179833_c1 nmdc:mga05p37_1179833_c1_290_538 79
189 3300000546 LJNas_1007894 LJNas_10078943 80
190 3300005327 Ga0070658_10872205 Ga0070658_108722051 80
191 3300005329 Ga0070683_100423967 Ga0070683_1004239672 80
192 3300005335 Ga0070666_11420550 Ga0070666_114205501 80
193 3300005530 Ga0070679_101080390 Ga0070679_1010803902 80
194 3300005616 Ga0068852_101815636 Ga0068852_1018156362 80
195 3300005844 Ga0068862_101282369 Ga0068862_1012823692 80
196 3300006237 Ga0097621_100199832 Ga0097621_1001998322 80
197 3300006844 Ga0075428_100540354 Ga0075428_1005403542 80
198 3300006844 Ga0075428_101511315 Ga0075428_1015113152 80
199 3300007076 Ga0075435_101480003 Ga0075435_1014800032 80
200 3300009098 Ga0105245_11053633 Ga0105245_110536332 80
201 3300009177 Ga0105248_12156720 Ga0105248_121567202 80
202 3300014325 Ga0163163_10432571 Ga0163163_104325712 80
203 3300025909 Ga0207705_10310388 Ga0207705_103103882 80
204 3300025941 Ga0207711_11923307 Ga0207711_119233071 80
205 3300026142 Ga0207698_11408574 Ga0207698_114085742 80
206 3300026142 Ga0207698_11956135 Ga0207698_119561351 80
207 3300028381 Ga0268264_12635774 Ga0268264_126357741 80
208 3300049583 Ga0501067_0004468 Ga0501067_0004468_429_677 80

Feature Viewer

pLDDT pTM Quality
75.73 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map