F316753

General Info

Members Datasets Scaffolds Average Seq Length
207 156 414 213

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0006622|Ga0395901_0006622_1975_2715
Length 246
Sequence VIVGDASSRGQAARSRIGAHRRPTAEMTAADRQSSPAAERNRQPILEVLRRVLPPAGRALDIASGSGQHVSWFARHLPGWTWQPSEYAAASLASIAAWSVLDEADLAESPLAAARTGPLANIVPPLQLDVCAAAWPVTGAFDAITCINMLHASPPATLPGLMQGVGRHLARGGVLVTYGPYILDDEPLAPSNVEFDRWLKTERDPSWGIRRLADVAAHARDAGLRLRERVSMPANNLVLVFDREGA

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
112 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
118 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
119 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
148 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
151 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
152 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.46
Nodule 0
Rhizoplane 4.83
Rhizosphere 70.53
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0006622 3300038443 Bacteria 11705
2 JGI25156J39149_1000035 3300002705 Bacteria 112093
3 JGI25157J39369_1000048 3300002741 Bacteria 117419
4 rootH1_10041148 3300003316 Bacteria 1085
5 rootH2_10040495 3300003320 Bacteria 6410
6 rootH2_10237011 3300003320 Bacteria 1567
7 rootH1_10028968 3300003323 Bacteria 1434
8 rootH1_10070149 3300003323 Bacteria 3481
9 rootH1_10127547 3300003323 Bacteria 3837
10 Ga0055539_1000029 3300003752 Bacteria 257094
11 Ga0055539_1002019 3300003752 Bacteria 3333
12 Ga0055539_1006000 3300003752 Bacteria 1564
13 Ga0055533_1000008 3300003756 Bacteria 575861
14 Ga0055525_1001056 3300003759 Bacteria 7093
15 Ga0055535_1000346 3300003761 Bacteria 46216
16 Ga0055529_1000156 3300003763 Bacteria 93167
17 Ga0070683_100048916 3300005329 Bacteria 3909
18 Ga0070683_101155409 3300005329 Unclassified 744
19 Ga0070690_100008031 3300005330 Bacteria 6059
20 Ga0070670_100357466 3300005331 Bacteria 1284
21 Ga0068869_100037410 3300005334 Bacteria 3451
22 Ga0070666_10309846 3300005335 Bacteria 1125
23 Ga0070689_100099734 3300005340 Bacteria 2297
24 Ga0070689_100408590 3300005340 Bacteria 1149
25 Ga0070675_100057961 3300005354 Bacteria 3194
26 Ga0070673_100005052 3300005364 Bacteria 8415
27 Ga0070673_100012519 3300005364 Bacteria 5828
28 Ga0070659_100438281 3300005366 Bacteria 1107
29 Ga0070667_100249116 3300005367 Bacteria 1588
30 Ga0070694_100602770 3300005444 Unclassified 885
31 Ga0070663_100295950 3300005455 Bacteria 1294
32 Ga0070679_100004338 3300005530 Bacteria 13103
33 Ga0070684_100662921 3300005535 Unclassified 972
34 Ga0070686_100666915 3300005544 Unclassified 826
35 Ga0070696_100930035 3300005546 Unclassified 723
36 Ga0070665_100261788 3300005548 Bacteria 1731
37 Ga0068855_100001811 3300005563 Bacteria 26672
38 Ga0068855_100062109 3300005563 Bacteria 4363
39 Ga0068855_100084049 3300005563 Bacteria 3686
40 Ga0068855_100340164 3300005563 Bacteria 1655
41 Ga0068857_100013363 3300005577 Bacteria 7150
42 Ga0068856_100007173 3300005614 Bacteria 10869
43 Ga0068856_100049030 3300005614 Bacteria 4162
44 Ga0068852_100000142 3300005616 Bacteria 48221
45 Ga0068852_100539625 3300005616 Bacteria 1165
46 Ga0068852_101167371 3300005616 Unclassified 791
47 Ga0068866_10103356 3300005718 Bacteria 1576
48 Ga0068861_100058721 3300005719 Bacteria 2943
49 Ga0068861_100188825 3300005719 Bacteria 1721
50 Ga0068863_100030959 3300005841 Bacteria 5109
51 Ga0068863_100553422 3300005841 Bacteria 1136
52 Ga0075363_100098316 3300006048 Bacteria 1617
53 Ga0070716_100116352 3300006173 Bacteria 1666
54 Ga0097621_100524170 3300006237 Bacteria 1076
55 Ga0075431_100005246 3300006847 Bacteria 12759
56 Ga0075429_100072974 3300006880 Bacteria 2989
57 Ga0105240_10123149 3300009093 Bacteria 3120
58 Ga0105240_10185459 3300009093 Bacteria 2451
59 Ga0105240_10316298 3300009093 Bacteria 1781
60 Ga0111539_10027905 3300009094 Bacteria 6893
61 Ga0111539_10108625 3300009094 Bacteria 3256
62 Ga0105245_10658763 3300009098 Bacteria 1077
63 Ga0105243_10575248 3300009148 Unclassified 1080
64 Ga0105237_10085805 3300009545 Bacteria 3138
65 Ga0105237_10210849 3300009545 Bacteria 1943
66 Ga0105239_10075338 3300010375 Bacteria 3710
67 Ga0157369_10069340 3300013105 Bacteria 3788
68 Ga0157378_10213351 3300013297 Bacteria 1831
69 Ga0163162_10181028 3300013306 Bacteria 2234
70 Ga0157375_10320975 3300013308 Bacteria 1713
71 Ga0157375_10395732 3300013308 Bacteria 1548
72 Ga0209674_100015 3300025226 Bacteria 697299
73 Ga0209563_100017 3300025230 Bacteria 796449
74 Ga0207427_100227 3300025231 Bacteria 47278
75 Ga0209258_100025 3300025242 Bacteria 534777
76 Ga0209258_100341 3300025242 Bacteria 68437
77 Ga0209646_1000131 3300025246 Bacteria 128289
78 Ga0209026_1000038 3300025250 Bacteria 281227
79 Ga0209677_100022 3300025253 Bacteria 410724
80 Ga0209677_100074 3300025253 Bacteria 133019
81 Ga0209677_101718 3300025253 Bacteria 9109
82 Ga0209148_1003096 3300025254 Bacteria 4868
83 Ga0209759_1000031 3300025256 Bacteria 281227
84 Ga0209759_1000877 3300025256 Bacteria 23001
85 Ga0209759_1003786 3300025256 Bacteria 5893
86 Ga0209455_1000089 3300025272 Bacteria 235612
87 Ga0209257_1000791 3300025304 Bacteria 46307
88 Ga0207705_10016730 3300025909 Bacteria 5252
89 Ga0207705_10036394 3300025909 Bacteria 3523
90 Ga0207705_10075072 3300025909 Bacteria 2455
91 Ga0207695_10007510 3300025913 Bacteria 13831
92 Ga0207695_10226639 3300025913 Bacteria 1775
93 Ga0207671_10027124 3300025914 Bacteria 4284
94 Ga0207671_10050978 3300025914 Bacteria 3065
95 Ga0207660_10262685 3300025917 Bacteria 1366
96 Ga0207652_10016009 3300025921 Bacteria 6114
97 Ga0207694_10057108 3300025924 Bacteria 3033
98 Ga0207694_10608224 3300025924 Unclassified 919
99 Ga0207650_10227208 3300025925 Bacteria 1504
100 Ga0207659_10042041 3300025926 Bacteria 3203
101 Ga0207687_10183451 3300025927 Bacteria 1623
102 Ga0207644_10110136 3300025931 Bacteria 2081
103 Ga0207709_10539416 3300025935 Unclassified 916
104 Ga0207670_10090422 3300025936 Unclassified 2163
105 Ga0207691_10138463 3300025940 Bacteria 2146
106 Ga0207711_10978573 3300025941 Unclassified 785
107 Ga0207689_10036779 3300025942 Bacteria 4064
108 Ga0207689_10250703 3300025942 Bacteria 1464
109 Ga0207661_10034983 3300025944 Bacteria 3911
110 Ga0207661_10089584 3300025944 Bacteria 2560
111 Ga0207667_10001765 3300025949 Bacteria 27224
112 Ga0207667_10103917 3300025949 Bacteria 2930
113 Ga0207667_10200526 3300025949 Bacteria 2047
114 Ga0207667_10575786 3300025949 Bacteria 1137
115 Ga0207651_10001106 3300025960 Bacteria 11995
116 Ga0207651_10029764 3300025960 Bacteria 3466
117 Ga0207640_10044008 3300025981 Bacteria 2858
118 Ga0207677_10062720 3300026023 Bacteria 2580
119 Ga0207677_10556105 3300026023 Bacteria 1001
120 Ga0207639_10720700 3300026041 Bacteria 926
121 Ga0207708_10591210 3300026075 Unclassified 939
122 Ga0207702_10012295 3300026078 Bacteria 7125
123 Ga0207702_10069672 3300026078 Bacteria 3024
124 Ga0207641_10013882 3300026088 Bacteria 6607
125 Ga0207676_10005827 3300026095 Bacteria 8712
126 Ga0207674_10055729 3300026116 Bacteria 4017
127 Ga0207674_10119701 3300026116 Bacteria 2602
128 Ga0207675_100045549 3300026118 Bacteria 4098
129 Ga0207675_100458870 3300026118 Bacteria 1263
130 Ga0207698_10000705 3300026142 Bacteria 19409
131 Ga0207428_10006338 3300027907 Bacteria 10942
132 Ga0265337_1000657 3300028556 Bacteria 18216
133 Ga0265334_10001864 3300028573 Bacteria 10023
134 Ga0265334_10109243 3300028573 Bacteria 995
135 Ga0265336_10000010 3300028666 Bacteria 277947
136 Ga0265338_10350610 3300028800 Unclassified 1061
137 Ga0265324_10000745 3300029957 Bacteria 21629
138 Ga0307511_10114603 3300030521 Bacteria 1698
139 Ga0265320_10027266 3300031240 Bacteria 2981
140 Ga0307508_10451567 3300031616 Bacteria 878
141 Ga0307516_10007800 3300031730 Bacteria 12221
142 Ga0307413_10041601 3300031824 Bacteria 2692
143 Ga0373934_0018670 3300035086 Bacteria 2655
144 Ga0373932_0090813 3300035112 Bacteria 979
145 Ga0373931_0008283 3300035691 Bacteria 4926
146 Ga0316584_0416510 3300036712 Bacteria 955
147 Ga0395899_0025258 3300037312 Bacteria 4485
148 Ga0395900_0012296 3300037418 Bacteria 8755
149 Ga0395900_0198955 3300037418 Bacteria 2028
150 Ga0395898_0029392 3300037466 Bacteria 5505
151 Ga0395898_0074624 3300037466 Bacteria 3276
152 Ga0395901_0042630 3300038443 Bacteria 4705
153 Ga0436361_0048707 3300039447 Bacteria 700
154 Ga0451789_1018388 3300041443 Bacteria 896
155 Ga0451791_0573656 3300041451 Bacteria 6901
156 Ga0451800_0254721 3300041459 Bacteria 1070
157 Ga0451802_0865572 3300041460 Bacteria 1957
158 Ga0451807_0884064 3300041486 Bacteria 3008
159 Ga0451837_0389365 3300041494 Bacteria 1944
160 Ga0451843_1093872 3300041509 Bacteria 1500
161 Ga0451853_1127782 3300041512 Bacteria 2678
162 Ga0439441_029062 3300042001 Unclassified 1063
163 Ga0439435_0034631 3300042436 Unclassified 1389
164 Ga0439460_0027161 3300042461 Unclassified 1606
165 Ga0495580_0124158 3300046472 Bacteria 1792
166 Ga0495582_0403417 3300046473 Unclassified 788
167 Ga0495639_0011555 3300046475 Bacteria 3809
168 Ga0495584_0162779 3300046491 Unclassified 1134
169 Ga0495585_0218459 3300046492 Unclassified 963
170 Ga0495583_0000524 3300046506 Bacteria 54376
171 Ga0495606_0002526 3300046507 Bacteria 21043
172 Ga0495621_0320058 3300046539 Unclassified 646
173 Ga0495656_0375076 3300046615 Unclassified 741
174 Ga0495668_0058597 3300046616 Bacteria 2125
175 Ga0495668_0121430 3300046616 Bacteria 1429
176 Ga0495625_0008155 3300046660 Bacteria 8971
177 Ga0495649_0003434 3300046694 Bacteria 10695
178 Ga0495589_0006539 3300046794 Bacteria 6145
179 Ga0495581_0400241 3300047315 Bacteria 801
180 Ga0495674_0346199 3300047319 Bacteria 1207
181 Ga0496100_0273127 3300048903 Bacteria 1258
182 Ga0496108_0103541 3300048911 Bacteria 2429
183 Ga0496109_0058095 3300048912 Bacteria 3533
184 Ga0496110_0064486 3300048913 Bacteria 3238
185 Ga0496112_0226602 3300048915 Bacteria 1824
186 Ga0501072_0698468 3300049588 Unclassified 797
187 Ga0501077_0277113 3300049593 Unclassified 1067
188 nmdc:mga0yw44_722992_c1 3300050492 Bacteria 676
189 nmdc:mga09592_77565_c1 3300050508 Bacteria 2826
190 nmdc:mga06r32_11820_c1 3300050510 Bacteria 7862
191 nmdc:mga08y16_3626_c1 3300050511 Bacteria 16036
192 nmdc:mga08y16_97879_c1 3300050511 Bacteria 3055
193 nmdc:mga0sz30_354854_c1 3300050516 Bacteria 655
194 Ga0500635_0000060 3300053080 Bacteria 72066
195 Ga0500635_0000076 3300053080 Bacteria 63630
196 Ga0500635_0029282 3300053080 Bacteria 1766
197 Ga0500595_011186 3300053119 Bacteria 3525
198 Ga0500595_026454 3300053119 Bacteria 1999
199 Ga0500559_0007017 3300053136 Bacteria 5035
200 Ga0500603_163543 3300053150 Bacteria 695
201 Ga0500636_0004332 3300053177 Bacteria 8032
202 Ga0500636_0008509 3300053177 Bacteria 5948
203 Ga0500637_0052638 3300053178 Bacteria 2322
204 Ga0501084_0530491 3300054114 Unclassified 995
205 Ga0500661_016081 3300055283 Bacteria 1340
206 Ga0501082_0484050 3300060353 Unclassified 1082
207 Ga0530510_0797845 3300061734 Unclassified 720
208 Ga0395901_0006622
209 JGI25156J39149_1000035
210 JGI25157J39369_1000048
211 rootH1_10041148
212 rootH2_10040495
213 rootH2_10237011
214 rootH1_10028968
215 rootH1_10070149
216 rootH1_10127547
217 Ga0055539_1000029
218 Ga0055539_1002019
219 Ga0055539_1006000
220 Ga0055533_1000008
221 Ga0055525_1001056
222 Ga0055535_1000346
223 Ga0055529_1000156
224 Ga0070683_100048916
225 Ga0070683_101155409
226 Ga0070690_100008031
227 Ga0070670_100357466
228 Ga0068869_100037410
229 Ga0070666_10309846
230 Ga0070689_100099734
231 Ga0070689_100408590
232 Ga0070675_100057961
233 Ga0070673_100005052
234 Ga0070673_100012519
235 Ga0070659_100438281
236 Ga0070667_100249116
237 Ga0070694_100602770
238 Ga0070663_100295950
239 Ga0070679_100004338
240 Ga0070684_100662921
241 Ga0070686_100666915
242 Ga0070696_100930035
243 Ga0070665_100261788
244 Ga0068855_100001811
245 Ga0068855_100062109
246 Ga0068855_100084049
247 Ga0068855_100340164
248 Ga0068857_100013363
249 Ga0068856_100007173
250 Ga0068856_100049030
251 Ga0068852_100000142
252 Ga0068852_100539625
253 Ga0068852_101167371
254 Ga0068866_10103356
255 Ga0068861_100058721
256 Ga0068861_100188825
257 Ga0068863_100030959
258 Ga0068863_100553422
259 Ga0075363_100098316
260 Ga0070716_100116352
261 Ga0097621_100524170
262 Ga0075431_100005246
263 Ga0075429_100072974
264 Ga0105240_10123149
265 Ga0105240_10185459
266 Ga0105240_10316298
267 Ga0111539_10027905
268 Ga0111539_10108625
269 Ga0105245_10658763
270 Ga0105243_10575248
271 Ga0105237_10085805
272 Ga0105237_10210849
273 Ga0105239_10075338
274 Ga0157369_10069340
275 Ga0157378_10213351
276 Ga0163162_10181028
277 Ga0157375_10320975
278 Ga0157375_10395732
279 Ga0209674_100015
280 Ga0209563_100017
281 Ga0207427_100227
282 Ga0209258_100025
283 Ga0209258_100341
284 Ga0209646_1000131
285 Ga0209026_1000038
286 Ga0209677_100022
287 Ga0209677_100074
288 Ga0209677_101718
289 Ga0209148_1003096
290 Ga0209759_1000031
291 Ga0209759_1000877
292 Ga0209759_1003786
293 Ga0209455_1000089
294 Ga0209257_1000791
295 Ga0207705_10016730
296 Ga0207705_10036394
297 Ga0207705_10075072
298 Ga0207695_10007510
299 Ga0207695_10226639
300 Ga0207671_10027124
301 Ga0207671_10050978
302 Ga0207660_10262685
303 Ga0207652_10016009
304 Ga0207694_10057108
305 Ga0207694_10608224
306 Ga0207650_10227208
307 Ga0207659_10042041
308 Ga0207687_10183451
309 Ga0207644_10110136
310 Ga0207709_10539416
311 Ga0207670_10090422
312 Ga0207691_10138463
313 Ga0207711_10978573
314 Ga0207689_10036779
315 Ga0207689_10250703
316 Ga0207661_10034983
317 Ga0207661_10089584
318 Ga0207667_10001765
319 Ga0207667_10103917
320 Ga0207667_10200526
321 Ga0207667_10575786
322 Ga0207651_10001106
323 Ga0207651_10029764
324 Ga0207640_10044008
325 Ga0207677_10062720
326 Ga0207677_10556105
327 Ga0207639_10720700
328 Ga0207708_10591210
329 Ga0207702_10012295
330 Ga0207702_10069672
331 Ga0207641_10013882
332 Ga0207676_10005827
333 Ga0207674_10055729
334 Ga0207674_10119701
335 Ga0207675_100045549
336 Ga0207675_100458870
337 Ga0207698_10000705
338 Ga0207428_10006338
339 Ga0265337_1000657
340 Ga0265334_10001864
341 Ga0265334_10109243
342 Ga0265336_10000010
343 Ga0265338_10350610
344 Ga0265324_10000745
345 Ga0307511_10114603
346 Ga0265320_10027266
347 Ga0307508_10451567
348 Ga0307516_10007800
349 Ga0307413_10041601
350 Ga0373934_0018670
351 Ga0373932_0090813
352 Ga0373931_0008283
353 Ga0316584_0416510
354 Ga0395899_0025258
355 Ga0395900_0012296
356 Ga0395900_0198955
357 Ga0395898_0029392
358 Ga0395898_0074624
359 Ga0395901_0042630
360 Ga0436361_0048707
361 Ga0451789_1018388
362 Ga0451791_0573656
363 Ga0451800_0254721
364 Ga0451802_0865572
365 Ga0451807_0884064
366 Ga0451837_0389365
367 Ga0451843_1093872
368 Ga0451853_1127782
369 Ga0439441_029062
370 Ga0439435_0034631
371 Ga0439460_0027161
372 Ga0495580_0124158
373 Ga0495582_0403417
374 Ga0495639_0011555
375 Ga0495584_0162779
376 Ga0495585_0218459
377 Ga0495583_0000524
378 Ga0495606_0002526
379 Ga0495621_0320058
380 Ga0495656_0375076
381 Ga0495668_0058597
382 Ga0495668_0121430
383 Ga0495625_0008155
384 Ga0495649_0003434
385 Ga0495589_0006539
386 Ga0495581_0400241
387 Ga0495674_0346199
388 Ga0496100_0273127
389 Ga0496108_0103541
390 Ga0496109_0058095
391 Ga0496110_0064486
392 Ga0496112_0226602
393 Ga0501072_0698468
394 Ga0501077_0277113
395 nmdc:mga0yw44_722992_c1
396 nmdc:mga09592_77565_c1
397 nmdc:mga06r32_11820_c1
398 nmdc:mga08y16_3626_c1
399 nmdc:mga08y16_97879_c1
400 nmdc:mga0sz30_354854_c1
401 Ga0500635_0000060
402 Ga0500635_0000076
403 Ga0500635_0029282
404 Ga0500595_011186
405 Ga0500595_026454
406 Ga0500559_0007017
407 Ga0500603_163543
408 Ga0500636_0004332
409 Ga0500636_0008509
410 Ga0500637_0052638
411 Ga0501084_0530491
412 Ga0500661_016081
413 Ga0501082_0484050
414 Ga0530510_0797845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06080

DUF938

Protein of unknown function (DUF938)

32

243

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gwz-assembly1.cif.gz_A structure of the mitomycin 7-o-methyltransferase mmcr 0.8553 30 217
8bij-assembly1.cif.gz_B o-methyltransferase plu4894 (mutant i88m, w91l, c97y, s142l, g146v, y258m, l270f, s309y) in complex with sah 0.8544 11 215
2r3s-assembly1.cif.gz_A crystal structure of a putative o-methyltransferase (npun_r0239) from nostoc punctiforme pcc 73102 at 2.15 a resolution 0.8467 16 217
2r3s-assembly1.cif.gz_B crystal structure of a putative o-methyltransferase (npun_r0239) from nostoc punctiforme pcc 73102 at 2.15 a resolution 0.8355 17 217
8big-assembly4.cif.gz_G o-methyltransferase plu4895 in complex with sah 0.8305 16 218
ID Description Score Start End Superfamily
af_Q7YWR7_1_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9042 7 217 3.40.50.150
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9032 8 215 3.40.50.150
af_Q9VLF6_13_218_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8977 6 213 3.40.50.150
af_Q7YWR7_1_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8956 7 217 3.40.50.150
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8943 8 215 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A212ET64-F1-model_v4 Uncharacterized protein 0.9691 116 218
AF-A0A4Q5NIM2-F1-model_v4 DUF938 domain-containing protein 0.9687 93 217
AF-A5V9T8-F1-model_v4 deleted 0.9681 3 219
AF-A0A2U1VQA9-F1-model_v4 SAM-dependent methyltransferase 0.9667 3 217 GO:0008168
GO:0032259
AF-A0A4Q3PFP2-F1-model_v4 deleted 0.9649 94 219

Map