F314431

General Info

Members Datasets Scaffolds Average Seq Length
205 168 183 244

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_202766_c1|nmdc:mga0qj67_202766_c1_44_874
Length 276
Sequence VAGETVETDIGEAAAETVEHGADAVHGAAEHGVGGHSPLEQFQIKRLIPIEIGGLDLSFTNSALFMLIAVALITLFLTYSMSSRALVPGRLQSMAELSYEFIANMIRENVGTEGRRYFPFIFTLFMFILFGNLLGMIPYSFTYTSHIIVTFAMAAVVFVGVTVIGFARHGAKFLKLFVPSGVPVFLLPLLVVIEVLSYLTRPISLSVRLFANMMAGHTMLKVFAGFVVALGFLAGWAPLAFIVALTGLEIDIAVLQAYVFTILTCIYLNDAIHPGH

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2643221618 Ensifer sp. Root231 Isolate Unclassified
3 2643221626 Ensifer sp. Root31 Isolate Unclassified
4 2643221655 Ensifer sp. Root1252 Isolate Unclassified
5 2643221659 Ensifer sp. Root127 Isolate Unclassified
6 2643221698 Ensifer sp. Root142 Isolate Unclassified
7 2643221712 Ensifer sp. Root258 Isolate Unclassified
8 2738543024 Aminobacter sp. AP02 Isolate Unclassified
9 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
10 2844163670 Ensifer sp. 1H6 Isolate Unclassified
11 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
12 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
13 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
14 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
15 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
16 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
17 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
18 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
19 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
105 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
106 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
107 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
108 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
162 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
166 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
167 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
168 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.95
Metatranscriptomes 7.32
Isolates 10.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.37
Nodule 0.98
Rhizoplane 2.93
Rhizosphere 73.66
Stem 0
Stem Tuber 0
Unclassified 17.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006778J45830_1007246 3300003162 Unclassified 975
2 JGI25406J46586_10001122 3300003203 Bacteria 12547
3 Ga0006777J48905_1020548 3300003308 Unclassified 975
4 Ga0006781J51513_1019818 3300003568 Unclassified 929
5 Ga0007429J51699_1049622 3300003579 Unclassified 1025
6 Ga0006780_1016460 3300003735 Unclassified 863
7 Ga0070658_10031439 3300005327 Bacteria 4262
8 Ga0070660_100024762 3300005339 Bacteria 4456
9 Ga0070661_100002470 3300005344 Bacteria 12674
10 Ga0070669_100083586 3300005353 Bacteria 2381
11 Ga0070674_100007277 3300005356 Bacteria 6518
12 Ga0070708_100330147 3300005445 Bacteria 1437
13 Ga0070662_100231358 3300005457 Bacteria 1479
14 Ga0070681_10483686 3300005458 Bacteria 1151
15 Ga0070681_10612690 3300005458 Bacteria 1003
16 Ga0068867_100214991 3300005459 Bacteria 1546
17 Ga0070679_100208091 3300005530 Bacteria 1920
18 Ga0070665_100090225 3300005548 Bacteria 3070
19 Ga0070702_100028597 3300005615 Bacteria 3022
20 Ga0068864_100788792 3300005618 Bacteria 933
21 Ga0068861_100011611 3300005719 Bacteria 6127
22 Ga0068861_100289761 3300005719 Bacteria 1413
23 Ga0068862_100054293 3300005844 Bacteria 3430
24 Ga0081538_10015611 3300005981 Bacteria 5868
25 Ga0081539_10000224 3300005985 Bacteria 133057
26 Ga0075365_10367057 3300006038 Bacteria 1015
27 Ga0070716_100425293 3300006173 Bacteria 962
28 Ga0075431_100176348 3300006847 Bacteria 2195
29 Ga0075434_100160968 3300006871 Bacteria 2264
30 Ga0105240_10058515 3300009093 Bacteria 4811
31 Ga0111539_10346843 3300009094 Bacteria 1728
32 Ga0105245_10843263 3300009098 Bacteria 956
33 Ga0105238_10370821 3300009551 Bacteria 1422
34 Ga0105239_10379318 3300010375 Bacteria 1598
35 Ga0163163_10262513 3300014325 Bacteria 1778
36 Ga0157380_10139723 3300014326 Bacteria 2079
37 Ga0206350_10509138 3300020080 Bacteria 1451
38 Ga0213875_10000490 3300021388 Bacteria 33517
39 Ga0213875_10001084 3300021388 Bacteria 18926
40 Ga0213875_10147968 3300021388 Bacteria 1100
41 Ga0213871_10034696 3300021441 Bacteria 1331
42 Ga0224712_10194973 3300022467 Unclassified 919
43 Ga0207425_1010266 3300025245 Bacteria 2286
44 Ga0207705_10013398 3300025909 Bacteria 5915
45 Ga0207707_10065429 3300025912 Bacteria 3167
46 Ga0207695_10234836 3300025913 Bacteria 1736
47 Ga0207660_10095796 3300025917 Bacteria 2208
48 Ga0207649_10020794 3300025920 Bacteria 3768
49 Ga0207652_10153163 3300025921 Bacteria 2065
50 Ga0207646_10265671 3300025922 Bacteria 1551
51 Ga0207669_10027258 3300025937 Bacteria 3124
52 Ga0207665_10392665 3300025939 Bacteria 1055
53 Ga0207678_10029592 3300026067 Bacteria 4782
54 Ga0207708_10077135 3300026075 Bacteria 2557
55 Ga0207641_10017857 3300026088 Bacteria 5812
56 Ga0207675_100019947 3300026118 Bacteria 6255
57 Ga0207675_100423584 3300026118 Bacteria 1315
58 Ga0268266_10031928 3300028379 Bacteria 4474
59 Ga0268265_10104662 3300028380 Bacteria 2294
60 Ga0310981_1020372 3300029285 Bacteria 1473
61 Ga0265325_10046605 3300031241 Bacteria 2248
62 Ga0265340_10058871 3300031247 Bacteria 1844
63 Ga0265331_10001177 3300031250 Bacteria 19917
64 Ga0265331_10001663 3300031250 Bacteria 16137
65 Ga0265327_10000176 3300031251 Bacteria 137002
66 Ga0265316_10158056 3300031344 Bacteria 1696
67 Ga0307513_10341783 3300031456 Bacteria 1247
68 Ga0265313_10000138 3300031595 Bacteria 75121
69 Ga0265314_10029232 3300031711 Bacteria 4099
70 Ga0265314_10053296 3300031711 Bacteria 2807
71 Ga0265342_10020473 3300031712 Bacteria 4241
72 Ga0307516_10098326 3300031730 Bacteria 2745
73 Ga0307414_10210701 3300032004 Bacteria 1588
74 Ga0316596_1006021 3300033541 Bacteria 2801
75 Ga0373936_0056786 3300035113 Bacteria 1591
76 Ga0373939_0010164 3300035114 Bacteria 2347
77 Ga0373954_0242335 3300035118 Bacteria 887
78 Ga0316574_0067452 3300035398 Bacteria 2256
79 Ga0316574_0183541 3300035398 Bacteria 1346
80 Ga0373931_0220495 3300035691 Bacteria 1142
81 Ga0373937_0292658 3300036401 Bacteria 1538
82 Ga0310110_018947 3300036535 Unclassified 962
83 Ga0316584_0015955 3300036712 Bacteria 5381
84 Ga0395899_0066851 3300037312 Bacteria 2639
85 Ga0395900_0056555 3300037418 Bacteria 4038
86 Ga0395898_0074918 3300037466 Bacteria 3269
87 Ga0395898_0519359 3300037466 Bacteria 1132
88 Ga0395905_0116076 3300037471 Bacteria 2516
89 Ga0436364_0062837 3300037853 Bacteria 22445
90 Ga0436364_0205608 3300037853 Bacteria 5765
91 Ga0436364_0707766 3300037853 Bacteria 1515
92 Ga0436364_0875927 3300037853 Bacteria 33532
93 Ga0436364_1181167 3300037853 Bacteria 15069
94 Ga0436364_1397714 3300037853 Bacteria 794
95 Ga0436364_1462713 3300037853 Bacteria 1560
96 Ga0395901_0026871 3300038443 Bacteria 5909
97 Ga0436365_1788744 3300039437 Bacteria 3164
98 Ga0436365_1935444 3300039437 Bacteria 15382
99 Ga0436360_0584810 3300039438 Bacteria 3882
100 Ga0436360_0936834 3300039438 Bacteria 1115
101 Ga0436360_1314866 3300039438 Bacteria 1522
102 Ga0436361_0572077 3300039447 Bacteria 4726
103 Ga0436361_1064904 3300039447 Bacteria 2230
104 Ga0436361_1068321 3300039447 Bacteria 5660
105 Ga0436363_0366934 3300039450 Bacteria 1872
106 Ga0436363_0684304 3300039450 Bacteria 1234
107 Ga0451794_50074 3300041446 Unclassified 1079
108 Ga0451850_26570 3300041506 Unclassified 1314
109 Ga0452268_32197 3300041907 Unclassified 1283
110 Ga0439441_038086 3300042001 Bacteria 955
111 Ga0439435_0042957 3300042436 Bacteria 1270
112 Ga0466963_0162863 3300044694 Bacteria 1553
113 Ga0495638_0218810 3300046460 Bacteria 1066
114 Ga0495585_0198228 3300046492 Bacteria 1024
115 Ga0495630_0027158 3300046517 Bacteria 4243
116 Ga0495597_0170381 3300046542 Bacteria 884
117 Ga0495622_0031491 3300046557 Bacteria 2478
118 Ga0495625_0168246 3300046660 Bacteria 1465
119 Ga0495657_0052370 3300046675 Bacteria 2737
120 Ga0495649_0021600 3300046694 Bacteria 3606
121 Ga0495589_0035193 3300046794 Bacteria 2512
122 Ga0495674_0154366 3300047319 Bacteria 1924
123 Ga0495672_0011352 3300047320 Bacteria 6293
124 Ga0495676_0188409 3300047321 Bacteria 1441
125 Ga0495683_0164449 3300047323 Bacteria 1024
126 Ga0495602_0030336 3300048088 Bacteria 5130
127 Ga0495602_0107293 3300048088 Bacteria 2277
128 Ga0496100_0234831 3300048903 Bacteria 1351
129 Ga0496102_0311137 3300048905 Bacteria 1484
130 Ga0496106_0045270 3300048909 Bacteria 3305
131 Ga0496110_0368248 3300048913 Bacteria 1309
132 Ga0496113_0271788 3300048916 Bacteria 1355
133 Ga0496121_0363078 3300048924 Bacteria 961
134 Ga0501317_005116 3300049533 Bacteria 1394
135 Ga0501325_007140 3300049541 Bacteria 938
136 Ga0501032_0133626 3300049569 Bacteria 1636
137 Ga0501033_0024413 3300049570 Bacteria 4561
138 Ga0501033_0187300 3300049570 Bacteria 1482
139 Ga0501033_0192476 3300049570 Bacteria 1459
140 Ga0501033_0279956 3300049570 Bacteria 1177
141 Ga0501034_0106592 3300049571 Bacteria 2795
142 Ga0501034_0214401 3300049571 Bacteria 1880
143 Ga0501034_0229050 3300049571 Bacteria 1808
144 Ga0501036_0493110 3300049572 Bacteria 1020
145 Ga0501037_0029761 3300049573 Bacteria 4034
146 Ga0501038_0122562 3300049574 Bacteria 2142
147 Ga0501039_0057685 3300049575 Bacteria 3007
148 Ga0501040_0191351 3300049576 Bacteria 1452
149 Ga0501042_0077582 3300049578 Bacteria 2379
150 Ga0501047_0040863 3300049581 Bacteria 4484
151 Ga0501047_0088572 3300049581 Bacteria 2972
152 Ga0501047_0359410 3300049581 Bacteria 1292
153 Ga0501067_0038933 3300049583 Bacteria 2640
154 Ga0501070_0042251 3300049586 Bacteria 3797
155 Ga0501072_0240227 3300049588 Bacteria 1443
156 Ga0501073_0068890 3300049589 Bacteria 2466
157 Ga0501073_0200393 3300049589 Bacteria 1380
158 Ga0501074_0069806 3300049590 Bacteria 2526
159 Ga0501080_0065470 3300049742 Bacteria 3380
160 Ga0501080_0176555 3300049742 Bacteria 1967
161 Ga0501080_0267308 3300049742 Bacteria 1557
162 Ga0501083_0020437 3300049744 Bacteria 4606
163 Ga0501044_0050120 3300049823 Bacteria 4309
164 Ga0501044_0401517 3300049823 Bacteria 1283
165 Ga0501044_0466175 3300049823 Bacteria 1168
166 nmdc:mga0yw44_392348_c1 3300050492 Bacteria 938
167 nmdc:mga05p37_814175_c1 3300050507 Bacteria 1020
168 nmdc:mga0qj67_202766_c1 3300050509 Bacteria 1611
169 nmdc:mga0qj67_486569_c1 3300050509 Bacteria 992
170 nmdc:mga06r32_370184_c1 3300050510 Bacteria 1416
171 nmdc:mga0n895_212366_c1 3300050512 Bacteria 1965
172 Ga0495619_0096259 3300053085 Bacteria 2010
173 Ga0500643_047781 3300053087 Bacteria 1232
174 Ga0500595_033744 3300053119 Bacteria 1696
175 Ga0500568_0000004 3300053139 Bacteria 621666
176 Ga0500616_0002234 3300053153 Bacteria 16550
177 Ga0500616_0074193 3300053153 Bacteria 1725
178 Ga0500616_0126020 3300053153 Bacteria 1216
179 Ga0500622_0048234 3300053156 Bacteria 2198
180 Ga0500637_0092921 3300053178 Bacteria 1748
181 Ga0590071_007965 3300059421 Bacteria 2503
182 Ga0501082_0326147 3300060353 Bacteria 1338
183 Ga0530510_0442891 3300061734 Unclassified 982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1462713 Ga0436364_1462713_559_1314 182
2 3300037466 Ga0395898_0519359 Ga0395898_0519359_11_703 205
3 iso_pu_bacteria 2876377896 2876384852 207
4 3300047321 Ga0495676_0188409 Ga0495676_0188409_265_1002 208
5 3300048924 Ga0496121_0363078 Ga0496121_0363078_10_663 210
6 3300021388 Ga0213875_10001084 Ga0213875_1000108411 212
7 3300037853 Ga0436364_0062837 Ga0436364_0062837_9096_9827 212
8 3300025939 Ga0207665_10392665 Ga0207665_103926652 213
9 3300031730 Ga0307516_10098326 Ga0307516_100983263 213
10 3300036401 Ga0373937_0292658 Ga0373937_0292658_547_1263 213
11 3300046675 Ga0495657_0052370 Ga0495657_0052370_699_1415 213
12 3300048088 Ga0495602_0030336 Ga0495602_0030336_3879_4595 213
13 3300053085 Ga0495619_0096259 Ga0495619_0096259_875_1591 213
14 3300049533 Ga0501317_005116 Ga0501317_005116_541_1341 214
15 3300049742 Ga0501080_0267308 Ga0501080_0267308_168_911 214
16 3300021388 Ga0213875_10000490 Ga0213875_1000049022 217
17 3300021388 Ga0213875_10147968 Ga0213875_101479681 217
18 3300037853 Ga0436364_0875927 Ga0436364_0875927_22541_23272 217
19 3300047319 Ga0495674_0154366 Ga0495674_0154366_478_1236 217
20 3300048088 Ga0495602_0107293 Ga0495602_0107293_1504_2262 217
21 3300037853 Ga0436364_0205608 Ga0436364_0205608_3393_4151 218
22 3300005327 Ga0070658_10031439 Ga0070658_100314395 219
23 3300005339 Ga0070660_100024762 Ga0070660_1000247625 219
24 3300005458 Ga0070681_10612690 Ga0070681_106126901 219
25 3300005530 Ga0070679_100208091 Ga0070679_1002080912 219
26 3300005548 Ga0070665_100090225 Ga0070665_1000902254 219
27 3300025909 Ga0207705_10013398 Ga0207705_100133983 219
28 3300025912 Ga0207707_10065429 Ga0207707_100654296 219
29 3300025921 Ga0207652_10153163 Ga0207652_101531633 219
30 3300028379 Ga0268266_10031928 Ga0268266_100319283 219
31 3300031456 Ga0307513_10341783 Ga0307513_103417832 219
32 3300035398 Ga0316574_0067452 Ga0316574_0067452_33_752 220
33 3300039438 Ga0436360_1314866 Ga0436360_1314866_34_804 221
34 3300046460 Ga0495638_0218810 Ga0495638_0218810_122_811 221
35 3300026088 Ga0207641_10017857 Ga0207641_100178574 225
36 3300037853 Ga0436364_1181167 Ga0436364_1181167_13846_14604 225
37 3300049541 Ga0501325_007140 Ga0501325_007140_98_841 225
38 3300037853 Ga0436364_0707766 Ga0436364_0707766_289_1020 226
39 3300053153 Ga0500616_0126020 Ga0500616_0126020_185_952 228
40 3300005459 Ga0068867_100214991 Ga0068867_1002149911 229
41 3300005615 Ga0070702_100028597 Ga0070702_1000285975 229
42 3300005719 Ga0068861_100289761 Ga0068861_1002897612 229
43 3300006038 Ga0075365_10367057 Ga0075365_103670572 229
44 3300009098 Ga0105245_10843263 Ga0105245_108432631 229
45 3300026067 Ga0207678_10029592 Ga0207678_100295925 229
46 3300026075 Ga0207708_10077135 Ga0207708_100771354 229
47 3300026118 Ga0207675_100423584 Ga0207675_1004235842 229
48 3300031250 Ga0265331_10001177 Ga0265331_100011775 229
49 3300031251 Ga0265327_10000176 Ga0265327_10000176107 229
50 3300046660 Ga0495625_0168246 Ga0495625_0168246_99_815 229
51 3300050492 nmdc:mga0yw44_392348_c1 nmdc:mga0yw44_392348_c1_11_727 229
52 3300053153 Ga0500616_0002234 Ga0500616_0002234_1475_2191 229
53 3300005344 Ga0070661_100002470 Ga0070661_1000024706 230
54 3300021441 Ga0213871_10034696 Ga0213871_100346961 230
55 3300033541 Ga0316596_1006021 Ga0316596_10060212 230
56 3300035114 Ga0373939_0010164 Ga0373939_0010164_1468_2223 230
57 3300036712 Ga0316584_0015955 Ga0316584_0015955_590_1345 230
58 3300039438 Ga0436360_0584810 Ga0436360_0584810_2218_2976 230
59 3300039450 Ga0436363_0366934 Ga0436363_0366934_798_1556 230
60 3300049573 Ga0501037_0029761 Ga0501037_0029761_961_1725 230
61 3300005457 Ga0070662_100231358 Ga0070662_1002313582 231
62 3300006871 Ga0075434_100160968 Ga0075434_1001609683 231
63 3300009551 Ga0105238_10370821 Ga0105238_103708213 231
64 3300035691 Ga0373931_0220495 Ga0373931_0220495_31_840 231
65 3300039437 Ga0436365_1788744 Ga0436365_1788744_268_1026 231
66 3300039450 Ga0436363_0684304 Ga0436363_0684304_109_867 231
67 3300048903 Ga0496100_0234831 Ga0496100_0234831_165_974 231
68 3300048905 Ga0496102_0311137 Ga0496102_0311137_156_965 231
69 3300048909 Ga0496106_0045270 Ga0496106_0045270_2228_3037 231
70 3300048913 Ga0496110_0368248 Ga0496110_0368248_488_1297 231
71 3300048916 Ga0496113_0271788 Ga0496113_0271788_355_1164 231
72 3300050512 nmdc:mga0n895_212366_c1 nmdc:mga0n895_212366_c1_451_1260 231
73 iso_pu_bacteria 2883291878 2883292703 231
74 iso_pu_bacteria 2524023250 2524610203 232
75 3300010375 Ga0105239_10379318 Ga0105239_103793182 233
76 3300039437 Ga0436365_1935444 Ga0436365_1935444_9231_9962 233
77 3300039447 Ga0436361_1068321 Ga0436361_1068321_3739_4461 233
78 3300049578 Ga0501042_0077582 Ga0501042_0077582_62_784 233
79 3300049581 Ga0501047_0359410 Ga0501047_0359410_305_1036 233
80 3300061734 Ga0530510_0442891 Ga0530510_0442891_172_894 233
81 iso_pu_bacteria 2883354860 2883355669 233
82 3300005981 Ga0081538_10015611 Ga0081538_100156116 234
83 3300039447 Ga0436361_1064904 Ga0436361_1064904_1111_1836 234
84 iso_pu_bacteria 2643221618 2644103057 234
85 iso_pu_bacteria 2643221626 2644152014 234
86 iso_pu_bacteria 2643221655 2644305984 234
87 iso_pu_bacteria 2643221659 2644330292 234
88 iso_pu_bacteria 2643221698 2644542961 234
89 iso_pu_bacteria 2643221712 2644619065 234
90 iso_pu_bacteria 2738543024 2739308706 234
91 iso_pu_bacteria 2844163670 2844170617 234
92 iso_pu_bacteria 2941499720 2941500590 234
93 iso_pu_bacteria 8002285264 8002288145 234
94 3300005458 Ga0070681_10483686 Ga0070681_104836861 235
95 3300009093 Ga0105240_10058515 Ga0105240_100585156 235
96 3300014325 Ga0163163_10262513 Ga0163163_102625132 235
97 3300025913 Ga0207695_10234836 Ga0207695_102348362 235
98 3300025920 Ga0207649_10020794 Ga0207649_100207942 235
99 3300025922 Ga0207646_10265671 Ga0207646_102656713 235
100 3300031711 Ga0265314_10029232 Ga0265314_100292323 235
101 3300037312 Ga0395899_0066851 Ga0395899_0066851_1410_2216 235
102 3300037418 Ga0395900_0056555 Ga0395900_0056555_555_1361 235
103 3300037471 Ga0395905_0116076 Ga0395905_0116076_1122_1928 235
104 3300038443 Ga0395901_0026871 Ga0395901_0026871_3624_4430 235
105 3300049569 Ga0501032_0133626 Ga0501032_0133626_205_966 235
106 3300049570 Ga0501033_0024413 Ga0501033_0024413_1701_2453 235
107 3300049570 Ga0501033_0279956 Ga0501033_0279956_366_1118 235
108 3300049572 Ga0501036_0493110 Ga0501036_0493110_205_966 235
109 3300049574 Ga0501038_0122562 Ga0501038_0122562_179_931 235
110 3300049575 Ga0501039_0057685 Ga0501039_0057685_1451_2185 235
111 3300049581 Ga0501047_0088572 Ga0501047_0088572_137_889 235
112 3300049589 Ga0501073_0200393 Ga0501073_0200393_591_1343 235
113 3300049742 Ga0501080_0065470 Ga0501080_0065470_55_807 235
114 3300049742 Ga0501080_0176555 Ga0501080_0176555_811_1563 235
115 3300049823 Ga0501044_0401517 Ga0501044_0401517_172_924 235
116 3300049823 Ga0501044_0466175 Ga0501044_0466175_250_1002 235
117 3300053119 Ga0500595_033744 Ga0500595_033744_428_1186 235
118 3300053139 Ga0500568_0000004 Ga0500568_0000004_525469_526203 235
119 3300053178 Ga0500637_0092921 Ga0500637_0092921_109_867 235
120 3300060353 Ga0501082_0326147 Ga0501082_0326147_78_830 235
121 iso_pu_bacteria 2842775625 2842776996 235
122 iso_pu_bacteria 2883577096 2883578653 235
123 iso_pu_bacteria 2894772417 2894776465 235
124 iso_pu_bacteria 2909399089 2909402338 235
125 iso_pu_bacteria 2929199973 2929204533 235
126 iso_pu_bacteria 641228493 641335122 235
127 iso_pu_bacteria 643348555 643391419 235
128 iso_pu_bacteria 8055909800 8055914510 235
129 3300005353 Ga0070669_100083586 Ga0070669_1000835863 236
130 3300005356 Ga0070674_100007277 Ga0070674_1000072775 236
131 3300005719 Ga0068861_100011611 Ga0068861_1000116116 236
132 3300005844 Ga0068862_100054293 Ga0068862_1000542934 236
133 3300006847 Ga0075431_100176348 Ga0075431_1001763482 236
134 3300009094 Ga0111539_10346843 Ga0111539_103468432 236
135 3300014326 Ga0157380_10139723 Ga0157380_101397233 236
136 3300020080 Ga0206350_10509138 Ga0206350_105091382 236
137 3300025917 Ga0207660_10095796 Ga0207660_100957962 236
138 3300025937 Ga0207669_10027258 Ga0207669_100272585 236
139 3300026118 Ga0207675_100019947 Ga0207675_1000199475 236
140 3300028380 Ga0268265_10104662 Ga0268265_101046623 236
141 3300031241 Ga0265325_10046605 Ga0265325_100466052 236
142 3300031247 Ga0265340_10058871 Ga0265340_100588712 236
143 3300031250 Ga0265331_10001663 Ga0265331_100016637 236
144 3300031344 Ga0265316_10158056 Ga0265316_101580562 236
145 3300031595 Ga0265313_10000138 Ga0265313_1000013864 236
146 3300031711 Ga0265314_10053296 Ga0265314_100532961 236
147 3300031712 Ga0265342_10020473 Ga0265342_100204736 236
148 3300035113 Ga0373936_0056786 Ga0373936_0056786_382_1113 236
149 3300035118 Ga0373954_0242335 Ga0373954_0242335_29_766 236
150 3300039438 Ga0436360_0936834 Ga0436360_0936834_358_1095 236
151 3300039447 Ga0436361_0572077 Ga0436361_0572077_496_1233 236
152 3300042001 Ga0439441_038086 Ga0439441_038086_149_883 236
153 3300049571 Ga0501034_0229050 Ga0501034_0229050_959_1708 236
154 3300049576 Ga0501040_0191351 Ga0501040_0191351_224_961 236
155 3300050507 nmdc:mga05p37_814175_c1 nmdc:mga05p37_814175_c1_99_833 236
156 3300005445 Ga0070708_100330147 Ga0070708_1003301472 237
157 3300006173 Ga0070716_100425293 Ga0070716_1004252932 237
158 3300035398 Ga0316574_0183541 Ga0316574_0183541_138_884 237
159 3300037853 Ga0436364_1397714 Ga0436364_1397714_16_762 237
160 3300044694 Ga0466963_0162863 Ga0466963_0162863_405_1139 237
161 3300046492 Ga0495585_0198228 Ga0495585_0198228_189_944 237
162 3300046517 Ga0495630_0027158 Ga0495630_0027158_2833_3588 237
163 3300046542 Ga0495597_0170381 Ga0495597_0170381_98_853 237
164 3300046557 Ga0495622_0031491 Ga0495622_0031491_512_1267 237
165 3300046694 Ga0495649_0021600 Ga0495649_0021600_898_1653 237
166 3300046794 Ga0495589_0035193 Ga0495589_0035193_63_818 237
167 3300047320 Ga0495672_0011352 Ga0495672_0011352_2963_3718 237
168 3300047323 Ga0495683_0164449 Ga0495683_0164449_82_837 237
169 3300049570 Ga0501033_0192476 Ga0501033_0192476_707_1447 237
170 3300049571 Ga0501034_0214401 Ga0501034_0214401_492_1232 237
171 3300049589 Ga0501073_0068890 Ga0501073_0068890_1126_1863 237
172 3300049744 Ga0501083_0020437 Ga0501083_0020437_3535_4272 237
173 3300050509 nmdc:mga0qj67_486569_c1 nmdc:mga0qj67_486569_c1_151_888 237
174 3300050510 nmdc:mga06r32_370184_c1 nmdc:mga06r32_370184_c1_439_1179 237
175 3300053087 Ga0500643_047781 Ga0500643_047781_323_1057 237
176 3300053156 Ga0500622_0048234 Ga0500622_0048234_1156_1890 237
177 3300025245 Ga0207425_1010266 Ga0207425_10102663 238
178 3300042436 Ga0439435_0042957 Ga0439435_0042957_344_1138 238
179 3300053153 Ga0500616_0074193 Ga0500616_0074193_480_1265 238
180 3300003203 JGI25406J46586_10001122 JGI25406J46586_100011222 239
181 3300005985 Ga0081539_10000224 Ga0081539_10000224100 239
182 3300029285 Ga0310981_1020372 Ga0310981_10203722 239
183 3300032004 Ga0307414_10210701 Ga0307414_102107012 239
184 3300050509 nmdc:mga0qj67_202766_c1 nmdc:mga0qj67_202766_c1_44_874 239
185 3300005618 Ga0068864_100788792 Ga0068864_1007887921 240
186 3300037466 Ga0395898_0074918 Ga0395898_0074918_2151_2888 240
187 3300041506 Ga0451850_26570 Ga0451850_26570_482_1264 240
188 3300049570 Ga0501033_0187300 Ga0501033_0187300_283_1050 242
189 3300049571 Ga0501034_0106592 Ga0501034_0106592_1629_2396 242
190 3300049581 Ga0501047_0040863 Ga0501047_0040863_1515_2282 242
191 3300049583 Ga0501067_0038933 Ga0501067_0038933_1557_2324 242
192 3300049586 Ga0501070_0042251 Ga0501070_0042251_1287_2054 242
193 3300049588 Ga0501072_0240227 Ga0501072_0240227_165_935 242
194 3300049590 Ga0501074_0069806 Ga0501074_0069806_623_1390 242
195 3300049823 Ga0501044_0050120 Ga0501044_0050120_1664_2431 242
196 3300059421 Ga0590071_007965 Ga0590071_007965_1160_1999 242
197 3300036535 Ga0310110_018947 Ga0310110_018947_14_778 254
198 3300003162 Ga0006778J45830_1007246 Ga0006778J45830_10072461 260
199 3300003308 Ga0006777J48905_1020548 Ga0006777J48905_10205481 260
200 3300003568 Ga0006781J51513_1019818 Ga0006781J51513_10198181 260
201 3300003579 Ga0007429J51699_1049622 Ga0007429J51699_10496221 260
202 3300003735 Ga0006780_1016460 Ga0006780_10164601 260
203 3300022467 Ga0224712_10194973 Ga0224712_101949731 260
204 3300041446 Ga0451794_50074 Ga0451794_50074_93_875 260
205 3300041907 Ga0452268_32197 Ga0452268_32197_376_1158 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

63

269

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.8367 39 260
6cp6-assembly1.cif.gz_X monomer yeast atp synthase (f1fo) reconstituted in nanodisc. 0.8298 39 260
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.8267 39 260
6b2z-assembly1.cif.gz_a cryo-em structure of the dimeric fo region of yeast mitochondrial atp synthase 0.8242 14 260
6cp6-assembly1.cif.gz_X monomer yeast atp synthase (f1fo) reconstituted in nanodisc. 0.8199 39 260
ID Description Score Start End Superfamily
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8727 94 260 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8706 95 260 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8609 95 260 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8495 94 260 1.20.120.220
af_P00854_92_259_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8128 95 260 1.20.120.220
ID Description Score Start End GO Terms
AF-A0A6M8E4P0-F1-model_v4 ATP synthase subunit a 0.9203 31 260 GO:0005743
GO:0045263
GO:0046933
AF-A0A4Y5WYR7-F1-model_v4 ATP synthase subunit a 0.9175 31 260 GO:0005743
GO:0045263
GO:0046933
AF-E9NZY3-F1-model_v4 ATP synthase subunit a 0.9169 38 260 GO:0005743
GO:0016787
GO:0045263
GO:0046933
AF-A0A343DRA5-F1-model_v4 ATP synthase subunit a 0.9113 31 260 GO:0005743
GO:0045263
GO:0046933
AF-A0A126TH03-F1-model_v4 ATP synthase subunit a 0.9101 46 260 GO:0005743
GO:0015078
GO:0015986
GO:0045263

Feature Viewer

pLDDT pTM Quality
73.94 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map