F314041

General Info

Members Datasets Scaffolds Average Seq Length
205 137 410 231

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10309015|Ga0316576_103090151
Length 241
Sequence MSTPEILCRAQRLAKHVNGPGGQLTILRELNLEIGAGEAVAIVGASGSGKSTLLGLLAGLDQASSGDVELCGAALTTLDEDGRAALRAGQVGFVFQSFQLLPTLTALENVLLPLELTAANAKANNGADNGTAPRNAKSTALDALERVGLSARTGHYPRQLSGGEQQRVAIARAFAPGPRILFADEPTGNLDQATGERIIDLLFQLRADSGAALVLVTHDQALAQRCDRRLGMCDGHLEALT

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
67 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
76 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
77 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
78 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
88 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
92 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
116 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
125 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
126 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
127 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
128 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
129 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
130 2643221736 Bosea sp. Root483D1 Isolate Unclassified
131 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
132 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
133 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
134 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
135 639633007 Azoarcus olearius BH72 Isolate Unclassified
136 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
137 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.68
Metatranscriptomes 1.46
Isolates 5.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.37
Nodule 0
Rhizoplane 1.95
Rhizosphere 64.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10309015 3300031727 Bacteria 1181
2 JGI25151J46595_10019104 3300003187 Bacteria 2921
3 Ga0055526_1002439 3300003771 Bacteria 12600
4 Ga0055524_1000328 3300003775 Bacteria 44226
5 Ga0055536_1002515 3300003781 Bacteria 10279
6 Ga0055536_1018776 3300003781 Bacteria 2201
7 Ga0055536_1021355 3300003781 Bacteria 1967
8 Ga0055530_10000799 3300003791 Bacteria 26159
9 Ga0055531_10002706 3300003794 Bacteria 11670
10 Ga0055531_10005336 3300003794 Bacteria 7541
11 Ga0055531_10014389 3300003794 Bacteria 3563
12 Ga0055531_10020952 3300003794 Bacteria 2560
13 Ga0055531_10052466 3300003794 Bacteria 1062
14 Ga0070682_100001080 3300005337 Bacteria 15712
15 Ga0070687_100183133 3300005343 Bacteria 1256
16 Ga0070661_100224260 3300005344 Bacteria 1442
17 Ga0070688_100007200 3300005365 Bacteria 5990
18 Ga0070710_10312632 3300005437 Bacteria 1029
19 Ga0070685_10000049 3300005466 Bacteria 72567
20 Ga0070706_100634685 3300005467 Bacteria 992
21 Ga0070699_100177811 3300005518 Bacteria 1887
22 Ga0068853_100026070 3300005539 Bacteria 4906
23 Ga0070704_100049163 3300005549 Bacteria 2956
24 Ga0068859_100017383 3300005617 Bacteria 7225
25 Ga0068858_100099831 3300005842 Bacteria 2707
26 Ga0068860_100000600 3300005843 Bacteria 43032
27 Ga0081540_1006491 3300005983 Bacteria 8506
28 Ga0070717_10215519 3300006028 Bacteria 1686
29 Ga0075365_10033725 3300006038 Bacteria 3301
30 Ga0075364_10061809 3300006051 Bacteria 2457
31 Ga0075369_10009080 3300006186 Bacteria 3850
32 Ga0075428_100006504 3300006844 Bacteria 12990
33 Ga0075430_100009867 3300006846 Bacteria 8075
34 Ga0075430_100032852 3300006846 Bacteria 4404
35 Ga0075431_100002915 3300006847 Bacteria 16563
36 Ga0075431_100100139 3300006847 Bacteria 2990
37 Ga0075431_100140019 3300006847 Bacteria 2494
38 Ga0075429_100015177 3300006880 Bacteria 6677
39 Ga0075429_100099648 3300006880 Bacteria 2535
40 Ga0097620_100017383 3300006931 Bacteria 7225
41 Ga0105240_10029410 3300009093 Bacteria 7158
42 Ga0111539_10128308 3300009094 Bacteria 2971
43 Ga0105238_10090594 3300009551 Bacteria 3045
44 Ga0157370_10000898 3300013104 Bacteria 37747
45 Ga0171462_1039 3300013250 Bacteria 76960
46 Ga0163162_11339757 3300013306 Bacteria 814
47 Ga0157372_10004311 3300013307 Bacteria 15205
48 Ga0182008_10010036 3300014497 Bacteria 5084
49 Ga0157379_10772547 3300014968 Bacteria 905
50 Ga0207425_1021468 3300025245 Bacteria 1369
51 Ga0209673_1019692 3300025273 Bacteria 2415
52 Ga0209130_1003680 3300025284 Bacteria 6330
53 Ga0209675_1000542 3300025291 Bacteria 27681
54 Ga0209675_1015883 3300025291 Bacteria 2216
55 Ga0209675_1016038 3300025291 Bacteria 2198
56 Ga0209676_1001115 3300025292 Bacteria 29748
57 Ga0209676_1001441 3300025292 Bacteria 22414
58 Ga0209676_1002850 3300025292 Bacteria 11413
59 Ga0209676_1003521 3300025292 Bacteria 9550
60 Ga0209676_1004265 3300025292 Bacteria 8063
61 Ga0209676_1012831 3300025292 Bacteria 3258
62 Ga0209676_1022918 3300025292 Bacteria 2055
63 Ga0209676_1040531 3300025292 Bacteria 1311
64 Ga0209025_1000819 3300025294 Bacteria 49669
65 Ga0209025_1014364 3300025294 Bacteria 4876
66 Ga0209025_1025857 3300025294 Bacteria 2971
67 Ga0209025_1029996 3300025294 Bacteria 2615
68 Ga0209564_1000580 3300025295 Bacteria 58002
69 Ga0209564_1000790 3300025295 Bacteria 43638
70 Ga0209564_1017670 3300025295 Bacteria 2765
71 Ga0209758_1017551 3300025297 Bacteria 3555
72 Ga0209050_1004637 3300025298 Bacteria 9166
73 Ga0209256_1000504 3300025299 Bacteria 57416
74 Ga0209256_1000695 3300025299 Bacteria 44756
75 Ga0209256_1006381 3300025299 Bacteria 6277
76 Ga0209256_1006558 3300025299 Bacteria 6108
77 Ga0209257_1000916 3300025304 Bacteria 41029
78 Ga0209257_1002369 3300025304 Bacteria 18887
79 Ga0209257_1002959 3300025304 Bacteria 15567
80 Ga0209257_1003951 3300025304 Bacteria 12034
81 Ga0209257_1005514 3300025304 Bacteria 8831
82 Ga0209257_1056680 3300025304 Bacteria 1081
83 Ga0207695_10196172 3300025913 Bacteria 1935
84 Ga0207662_10071899 3300025918 Bacteria 2095
85 Ga0207704_10138194 3300025938 Bacteria 1700
86 Ga0207667_10622943 3300025949 Bacteria 1086
87 Ga0207640_10048621 3300025981 Bacteria 2743
88 Ga0207703_10042196 3300026035 Bacteria 3659
89 Ga0209813_10009303 3300027866 Bacteria 2509
90 Ga0207428_10001824 3300027907 Bacteria 21809
91 Ga0268265_10405233 3300028380 Bacteria 1262
92 Ga0268264_10000061 3300028381 Bacteria 303123
93 Ga0307515_10029006 3300028794 Bacteria 9377
94 Ga0307515_10223351 3300028794 Bacteria 1695
95 Ga0265332_10001920 3300031238 Bacteria 11004
96 Ga0265327_10000495 3300031251 Bacteria 68594
97 Ga0265327_10089158 3300031251 Bacteria 1507
98 Ga0307513_10331487 3300031456 Bacteria 1276
99 Ga0307408_100100089 3300031548 Bacteria 2207
100 Ga0316575_10000328 3300031665 Bacteria 13442
101 Ga0316575_10067904 3300031665 Bacteria 1430
102 Ga0316579_10006984 3300031691 Bacteria 4638
103 Ga0316579_10042704 3300031691 Bacteria 2107
104 Ga0265314_10067410 3300031711 Bacteria 2411
105 Ga0316576_10002341 3300031727 Bacteria 10766
106 Ga0316576_10002726 3300031727 Bacteria 10110
107 Ga0316576_10003145 3300031727 Bacteria 9624
108 Ga0316576_10005615 3300031727 Bacteria 7698
109 Ga0316576_10162668 3300031727 Bacteria 1683
110 Ga0316576_10165103 3300031727 Bacteria 1671
111 Ga0316576_10185292 3300031727 Bacteria 1570
112 Ga0316578_10002814 3300031728 Bacteria 7769
113 Ga0316578_10017552 3300031728 Bacteria 3897
114 Ga0316578_10027642 3300031728 Bacteria 3207
115 Ga0316577_10003187 3300031733 Bacteria 8255
116 Ga0316577_10004263 3300031733 Bacteria 7358
117 Ga0307413_10000179 3300031824 Bacteria 18068
118 Ga0307414_10098397 3300032004 Bacteria 2195
119 Ga0307411_10388916 3300032005 Bacteria 1149
120 Ga0307415_100708708 3300032126 Bacteria 909
121 Ga0316583_10006110 3300032133 Bacteria 4332
122 Ga0316583_10084148 3300032133 Bacteria 1111
123 Ga0316585_10021045 3300032137 Bacteria 2001
124 Ga0316585_10028075 3300032137 Bacteria 1759
125 Ga0316580_10000467 3300032139 Bacteria 9329
126 Ga0316580_10000553 3300032139 Bacteria 8719
127 Ga0316580_10000724 3300032139 Bacteria 7955
128 Ga0316580_10013822 3300032139 Bacteria 2461
129 Ga0316593_10026973 3300032168 Bacteria 1840
130 Ga0316593_10050255 3300032168 Bacteria 1406
131 Ga0316592_1004332 3300033524 Bacteria 2632
132 Ga0373943_0223398 3300035170 Bacteria 1050
133 Ga0316574_0002810 3300035398 Bacteria 8832
134 Ga0316574_0016924 3300035398 Bacteria 4256
135 Ga0316574_0021410 3300035398 Bacteria 3838
136 Ga0316574_0120951 3300035398 Bacteria 1681
137 Ga0316574_0126435 3300035398 Bacteria 1643
138 Ga0373947_0238226 3300035725 Bacteria 1200
139 Ga0316582_0000731 3300036647 Bacteria 13083
140 Ga0316582_0002794 3300036647 Bacteria 8322
141 Ga0316582_0004277 3300036647 Bacteria 7180
142 Ga0316582_0005675 3300036647 Bacteria 6460
143 Ga0316584_0001772 3300036712 Bacteria 13287
144 Ga0316584_0007452 3300036712 Bacteria 7485
145 Ga0316584_0019932 3300036712 Bacteria 4853
146 Ga0316584_0045242 3300036712 Bacteria 3286
147 Ga0373925_0003362 3300037068 Bacteria 12410
148 Ga0373925_0108233 3300037068 Bacteria 2145
149 Ga0395899_0346149 3300037312 Bacteria 995
150 Ga0316581_0005481 3300037588 Bacteria 3310
151 Ga0439465_0003427 3300041413 Bacteria 5169
152 Ga0451837_0856302 3300041494 Bacteria 1149
153 Ga0439449_0006713 3300042007 Bacteria 4393
154 Ga0439435_0049485 3300042436 Bacteria 1199
155 Ga0439459_0008965 3300042438 Bacteria 1721
156 Ga0453684_0278659 3300044712 Bacteria 1908
157 Ga0495610_0058841 3300046512 Bacteria 1837
158 Ga0495643_0040594 3300046522 Bacteria 2541
159 Ga0495586_0405363 3300046535 Bacteria 785
160 Ga0495671_0220611 3300046692 Bacteria 918
161 Ga0496100_0017258 3300048903 Bacteria 4258
162 Ga0496101_0094728 3300048904 Bacteria 2226
163 Ga0496110_0147868 3300048913 Bacteria 2126
164 Ga0496114_0026133 3300048917 Bacteria 4777
165 Ga0496117_0023843 3300048920 Bacteria 4859
166 Ga0496122_0090234 3300048925 Bacteria 2092
167 Ga0496123_0006488 3300048926 Bacteria 11321
168 Ga0496123_0035354 3300048926 Bacteria 3561
169 Ga0496124_0086294 3300048927 Bacteria 2569
170 Ga0496124_0409380 3300048927 Bacteria 938
171 Ga0501036_0207328 3300049572 Bacteria 1648
172 Ga0501036_0509643 3300049572 Bacteria 1001
173 Ga0501041_0231710 3300049577 Bacteria 1160
174 Ga0501043_0008435 3300049579 Bacteria 8112
175 Ga0501047_0081282 3300049581 Bacteria 3115
176 Ga0501069_0505058 3300049585 Bacteria 721
177 Ga0501071_0448636 3300049587 Bacteria 987
178 Ga0501075_0136274 3300049591 Bacteria 1870
179 Ga0501079_0424643 3300049741 Bacteria 1044
180 Ga0501081_0042696 3300049743 Bacteria 3108
181 Ga0501280_002373 3300049776 Bacteria 3159
182 Ga0501226_000003 3300049853 Bacteria 358977
183 nmdc:mga05p37_73233_c1 3300050507 Bacteria 4216
184 nmdc:mga09592_15365_c1 3300050508 Bacteria 6252
185 nmdc:mga0qj67_2047_c2 3300050509 Bacteria 7286
186 nmdc:mga06r32_111045_c1 3300050510 Bacteria 2698
187 nmdc:mga06r32_174466_c1 3300050510 Bacteria 2134
188 nmdc:mga08y16_3298_c1 3300050511 Bacteria 16712
189 nmdc:mga08y16_916376_c1 3300050511 Bacteria 862
190 nmdc:mga0n895_80059_c1 3300050512 Bacteria 3254
191 Ga0500616_0043694 3300053153 Bacteria 2394
192 Ga0500622_0000001 3300053156 Bacteria 657715
193 Ga0500636_0003230 3300053177 Bacteria 9126
194 2525557932 2524614729 Bacteria 3091755
195 2526212993 2526164512 Bacteria 4025691
196 2630650101 2627854209 Bacteria 3093011
197 2644026522 2643221603 Bacteria 6147767
198 2644746451 2643221736 Bacteria 6608466
199 2687580125 2687453129 Bacteria 4387428
200 2729148773 2728369097 Bacteria 4333476
201 2842806041 2842805378 Bacteria 5385175
202 2917703074 2917699015 Bacteria 7043791
203 639786814 639633007 Bacteria 4376040
204 8003017576 8003014200 Bacteria 4059994
205 8054360590 8054357960 Bacteria 2867777
206 Ga0316576_10309015
207 JGI25151J46595_10019104
208 Ga0055526_1002439
209 Ga0055524_1000328
210 Ga0055536_1002515
211 Ga0055536_1018776
212 Ga0055536_1021355
213 Ga0055530_10000799
214 Ga0055531_10002706
215 Ga0055531_10005336
216 Ga0055531_10014389
217 Ga0055531_10020952
218 Ga0055531_10052466
219 Ga0070682_100001080
220 Ga0070687_100183133
221 Ga0070661_100224260
222 Ga0070688_100007200
223 Ga0070710_10312632
224 Ga0070685_10000049
225 Ga0070706_100634685
226 Ga0070699_100177811
227 Ga0068853_100026070
228 Ga0070704_100049163
229 Ga0068859_100017383
230 Ga0068858_100099831
231 Ga0068860_100000600
232 Ga0081540_1006491
233 Ga0070717_10215519
234 Ga0075365_10033725
235 Ga0075364_10061809
236 Ga0075369_10009080
237 Ga0075428_100006504
238 Ga0075430_100009867
239 Ga0075430_100032852
240 Ga0075431_100002915
241 Ga0075431_100100139
242 Ga0075431_100140019
243 Ga0075429_100015177
244 Ga0075429_100099648
245 Ga0097620_100017383
246 Ga0105240_10029410
247 Ga0111539_10128308
248 Ga0105238_10090594
249 Ga0157370_10000898
250 Ga0171462_1039
251 Ga0163162_11339757
252 Ga0157372_10004311
253 Ga0182008_10010036
254 Ga0157379_10772547
255 Ga0207425_1021468
256 Ga0209673_1019692
257 Ga0209130_1003680
258 Ga0209675_1000542
259 Ga0209675_1015883
260 Ga0209675_1016038
261 Ga0209676_1001115
262 Ga0209676_1001441
263 Ga0209676_1002850
264 Ga0209676_1003521
265 Ga0209676_1004265
266 Ga0209676_1012831
267 Ga0209676_1022918
268 Ga0209676_1040531
269 Ga0209025_1000819
270 Ga0209025_1014364
271 Ga0209025_1025857
272 Ga0209025_1029996
273 Ga0209564_1000580
274 Ga0209564_1000790
275 Ga0209564_1017670
276 Ga0209758_1017551
277 Ga0209050_1004637
278 Ga0209256_1000504
279 Ga0209256_1000695
280 Ga0209256_1006381
281 Ga0209256_1006558
282 Ga0209257_1000916
283 Ga0209257_1002369
284 Ga0209257_1002959
285 Ga0209257_1003951
286 Ga0209257_1005514
287 Ga0209257_1056680
288 Ga0207695_10196172
289 Ga0207662_10071899
290 Ga0207704_10138194
291 Ga0207667_10622943
292 Ga0207640_10048621
293 Ga0207703_10042196
294 Ga0209813_10009303
295 Ga0207428_10001824
296 Ga0268265_10405233
297 Ga0268264_10000061
298 Ga0307515_10029006
299 Ga0307515_10223351
300 Ga0265332_10001920
301 Ga0265327_10000495
302 Ga0265327_10089158
303 Ga0307513_10331487
304 Ga0307408_100100089
305 Ga0316575_10000328
306 Ga0316575_10067904
307 Ga0316579_10006984
308 Ga0316579_10042704
309 Ga0265314_10067410
310 Ga0316576_10002341
311 Ga0316576_10002726
312 Ga0316576_10003145
313 Ga0316576_10005615
314 Ga0316576_10162668
315 Ga0316576_10165103
316 Ga0316576_10185292
317 Ga0316578_10002814
318 Ga0316578_10017552
319 Ga0316578_10027642
320 Ga0316577_10003187
321 Ga0316577_10004263
322 Ga0307413_10000179
323 Ga0307414_10098397
324 Ga0307411_10388916
325 Ga0307415_100708708
326 Ga0316583_10006110
327 Ga0316583_10084148
328 Ga0316585_10021045
329 Ga0316585_10028075
330 Ga0316580_10000467
331 Ga0316580_10000553
332 Ga0316580_10000724
333 Ga0316580_10013822
334 Ga0316593_10026973
335 Ga0316593_10050255
336 Ga0316592_1004332
337 Ga0373943_0223398
338 Ga0316574_0002810
339 Ga0316574_0016924
340 Ga0316574_0021410
341 Ga0316574_0120951
342 Ga0316574_0126435
343 Ga0373947_0238226
344 Ga0316582_0000731
345 Ga0316582_0002794
346 Ga0316582_0004277
347 Ga0316582_0005675
348 Ga0316584_0001772
349 Ga0316584_0007452
350 Ga0316584_0019932
351 Ga0316584_0045242
352 Ga0373925_0003362
353 Ga0373925_0108233
354 Ga0395899_0346149
355 Ga0316581_0005481
356 Ga0439465_0003427
357 Ga0451837_0856302
358 Ga0439449_0006713
359 Ga0439435_0049485
360 Ga0439459_0008965
361 Ga0453684_0278659
362 Ga0495610_0058841
363 Ga0495643_0040594
364 Ga0495586_0405363
365 Ga0495671_0220611
366 Ga0496100_0017258
367 Ga0496101_0094728
368 Ga0496110_0147868
369 Ga0496114_0026133
370 Ga0496117_0023843
371 Ga0496122_0090234
372 Ga0496123_0006488
373 Ga0496123_0035354
374 Ga0496124_0086294
375 Ga0496124_0409380
376 Ga0501036_0207328
377 Ga0501036_0509643
378 Ga0501041_0231710
379 Ga0501043_0008435
380 Ga0501047_0081282
381 Ga0501069_0505058
382 Ga0501071_0448636
383 Ga0501075_0136274
384 Ga0501079_0424643
385 Ga0501081_0042696
386 Ga0501280_002373
387 Ga0501226_000003
388 nmdc:mga05p37_73233_c1
389 nmdc:mga09592_15365_c1
390 nmdc:mga0qj67_2047_c2
391 nmdc:mga06r32_111045_c1
392 nmdc:mga06r32_174466_c1
393 nmdc:mga08y16_3298_c1
394 nmdc:mga08y16_916376_c1
395 nmdc:mga0n895_80059_c1
396 Ga0500616_0043694
397 Ga0500622_0000001
398 Ga0500636_0003230
399 2525557932
400 2526212993
401 2630650101
402 2644026522
403 2644746451
404 2687580125
405 2729148773
406 2842806041
407 2917703074
408 639786814
409 8003017576
410 8054360590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

27

188

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9626 14 232
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9625 15 232
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9606 12 232
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9566 14 229
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.955 13 232
ID Description Score Start End Superfamily
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.983 13 233 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9762 41 232 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9736 13 232 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9717 12 232 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9685 11 231 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A316F6D1-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9936 15 232 GO:0005524
GO:0016887
AF-R9PL83-F1-model_v4 ABC transporter ATP-binding protein YvcR 0.9898 41 233 GO:0005524
GO:0016887
AF-A0A2D5TSH3-F1-model_v4 ABC transporter 0.9883 13 232 GO:0005524
GO:0016887
AF-A0A7V9TM51-F1-model_v4 ABC transporter ATP-binding protein 0.985 31 232 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-R9PL83-F1-model_v4 ABC transporter ATP-binding protein YvcR 0.9847 41 233 GO:0005524
GO:0016887

Map